Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54974.1
JCVISYN3A_0807
50S ribosomal protein L10.
M. mycoides homolog: Q6MRX8.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 18
Unique PROST Go: 0
Unique BLAST Go: 1
Unique Foldseek Go: 3
Total Homologs: 782
Unique PROST Homologs: 6
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 57
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q03LT2
(50S ribosomal protein L10) with a FATCAT P-Value: 0 and RMSD of 1.95 angstrom. The sequence alignment identity is 39.5%.
Structural alignment shown in left. Query protein AVX54974.1 colored as red in alignment, homolog Q03LT2 colored as blue.
Query protein AVX54974.1 is also shown in right top, homolog Q03LT2 showed in right bottom. They are colored based on secondary structures.
AVX54974.1 MSNSRPAHARKAEIVAEIVSKIKSAQGVAIAEYKHLTVAKMTELRVQALKQN-IDIKVYKDSLVRRAAEELGLVDL--IPFLTQQNVFIFSNEDSISAAK 97 Q03LT2 MSEA--IIAKKAEQVAIVADKMKAAASIVVVDSRGLTVDQDTVLRRN-LRESGVEFKVIKNSILSRAAEKAGLEDLKKL-FVGPSAV-AFSNEDVIAPAK 95 AVX54974.1 LVANFAKKNDALKLKAGIYEGKVVDTAGINEVASLPSKEELYSMFASSLLYPLRKVMAAINAVAETRN---- 165 Q03LT2 VISEFAKGAEALEIKGGVVDGAITSVEEINALASLPNKEGMLSMLLSVLQAPVRNVAYAVKAVAESKEDGAA 167
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006412 | translation |
| 1. PBF | GO:0003735 | structural constituent of ribosome |
| 1. PBF | GO:0070180 | large ribosomal subunit rRNA binding |
| 1. PBF | GO:0015934 | large ribosomal subunit |
| 1. PBF | GO:0022625 | cytosolic large ribosomal subunit |
| 1. PBF | GO:0005829 | cytosol |
| 1. PBF | GO:0005840 | ribosome |
| 1. PBF | GO:0019843 | rRNA binding |
| 2. PF | GO:0005737 | cytoplasm |
| 2. PF | GO:0042273 | ribosomal large subunit biogenesis |
| 2. PF | GO:0000956 | nuclear-transcribed mRNA catabolic process |
| 2. PF | GO:0005634 | nucleus |
| 3. BF | GO:1990904 | ribonucleoprotein complex |
| 4. PB | GO:0005886 | plasma membrane |
| 6. F | GO:0042254 | ribosome biogenesis |
| 6. F | GO:0000027 | ribosomal large subunit assembly |
| 6. F | GO:0002181 | cytoplasmic translation |
| 7. B | GO:0005762 | mitochondrial large ribosomal subunit |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0006412 | translation |
| GO:0003723 | RNA binding |
| GO:1990904 | ribonucleoprotein complex |
| GO:0070180 | large ribosomal subunit rRNA binding |
| GO:0005840 | ribosome |
| GO:0019843 | rRNA binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | A3PV75 | 50S ribosomal protein L10 | 0.00e+00 | 5.85e-19 | 2.69e-14 | 0.8262 |
| 1. PBF | Q98N68 | 50S ribosomal protein L10 | 0.00e+00 | 6.09e-24 | 1.06e-13 | 0.88 |
| 1. PBF | A0Q869 | 50S ribosomal protein L10 | 0.00e+00 | 5.58e-30 | 5.69e-15 | 0.8925 |
| 1. PBF | B4SG13 | 50S ribosomal protein L10 | 0.00e+00 | 7.25e-28 | 4.17e-18 | 0.8396 |
| 1. PBF | A8HTY1 | 50S ribosomal protein L10 | 0.00e+00 | 2.39e-21 | 9.87e-12 | 0.9013 |
| 1. PBF | A5GWK0 | 50S ribosomal protein L10 | 1.11e-16 | 3.16e-29 | 6.47e-17 | 0.8072 |
| 1. PBF | Q2NZX6 | 50S ribosomal protein L10 | 0.00e+00 | 3.58e-17 | 1.01e-15 | 0.9227 |
| 1. PBF | Q32AF7 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8469 |
| 1. PBF | Q8RHI4 | 50S ribosomal protein L10 | 0.00e+00 | 6.31e-34 | 6.04e-14 | 0.8786 |
| 1. PBF | A9W8N6 | 50S ribosomal protein L10 | 0.00e+00 | 5.50e-26 | 1.43e-13 | 0.9156 |
| 1. PBF | Q1IHH2 | 50S ribosomal protein L10 | 0.00e+00 | 2.76e-21 | 2.01e-17 | 0.8754 |
| 1. PBF | A5GPD3 | 50S ribosomal protein L10 | 0.00e+00 | 1.06e-32 | 1.68e-14 | 0.8066 |
| 1. PBF | Q8UE06 | 50S ribosomal protein L10 | 0.00e+00 | 4.55e-24 | 7.35e-09 | 0.95 |
| 1. PBF | A8YZN7 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.9394 |
| 1. PBF | Q3BWZ3 | 50S ribosomal protein L10 | 0.00e+00 | 1.90e-13 | 1.28e-15 | 0.9282 |
| 1. PBF | A6Q1M1 | 50S ribosomal protein L10 | 0.00e+00 | 1.06e-27 | 2.68e-17 | 0.8573 |
| 1. PBF | B1L937 | 50S ribosomal protein L10 | 4.77e-15 | 1.72e-24 | 1.59e-11 | 0.741 |
| 1. PBF | C3K2Y5 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-26 | 4.66e-14 | 0.8936 |
| 1. PBF | Q47LI3 | 50S ribosomal protein L10 | 2.22e-16 | 1.69e-22 | 4.61e-20 | 0.8005 |
| 1. PBF | Q5F5R3 | 50S ribosomal protein L10 | 0.00e+00 | 9.33e-31 | 4.21e-21 | 0.8929 |
| 1. PBF | Q5NPK9 | 50S ribosomal protein L10 | 0.00e+00 | 1.17e-26 | 3.42e-11 | 0.8615 |
| 1. PBF | B9JDR9 | 50S ribosomal protein L10 | 0.00e+00 | 4.79e-25 | 1.14e-11 | 0.9537 |
| 1. PBF | Q0K604 | 50S ribosomal protein L10 | 0.00e+00 | 2.02e-22 | 3.51e-27 | 0.9478 |
| 1. PBF | Q9RSS9 | 50S ribosomal protein L10 | 0.00e+00 | 3.20e-27 | 2.24e-06 | 0.8295 |
| 1. PBF | B8J1A6 | 50S ribosomal protein L10 | 0.00e+00 | 2.48e-26 | 2.80e-10 | 0.7505 |
| 1. PBF | B7LUL7 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8514 |
| 1. PBF | A9VNB2 | 50S ribosomal protein L10 | 0.00e+00 | 7.32e-33 | 1.04e-35 | 0.904 |
| 1. PBF | Q30TP9 | 50S ribosomal protein L10 | 0.00e+00 | 6.33e-36 | 4.93e-16 | 0.9051 |
| 1. PBF | Q11QA3 | 50S ribosomal protein L10 | 2.70e-14 | 2.78e-30 | 8.75e-04 | 0.7042 |
| 1. PBF | A7H4Q7 | 50S ribosomal protein L10 | 0.00e+00 | 2.67e-34 | 6.12e-19 | 0.8425 |
| 1. PBF | Q8XHR6 | 50S ribosomal protein L10 | 0.00e+00 | 2.76e-38 | 2.66e-23 | 0.9431 |
| 1. PBF | A0LII2 | 50S ribosomal protein L10 | 0.00e+00 | 4.08e-27 | 4.40e-16 | 0.8288 |
| 1. PBF | B8IS75 | 50S ribosomal protein L10 | 0.00e+00 | 4.49e-23 | 2.24e-15 | 0.9202 |
| 1. PBF | Q7VKL4 | 50S ribosomal protein L10 | 0.00e+00 | 2.59e-29 | 2.29e-17 | 0.8054 |
| 1. PBF | B8JB72 | 50S ribosomal protein L10 | 0.00e+00 | 1.11e-26 | 4.04e-16 | 0.898 |
| 1. PBF | B4TQJ3 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8326 |
| 1. PBF | A7I3U1 | 50S ribosomal protein L10 | 0.00e+00 | 1.17e-39 | 1.16e-14 | 0.8311 |
| 1. PBF | B7NFS5 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8488 |
| 1. PBF | O51352 | 50S ribosomal protein L10 | 0.00e+00 | 4.63e-36 | 8.37e-13 | 0.9256 |
| 1. PBF | Q5X868 | 50S ribosomal protein L10 | 0.00e+00 | 2.29e-19 | 7.15e-13 | 0.7461 |
| 1. PBF | B4E5B0 | 50S ribosomal protein L10 | 0.00e+00 | 3.87e-33 | 6.14e-30 | 0.8839 |
| 1. PBF | A8GYW7 | 50S ribosomal protein L10 | 0.00e+00 | 5.50e-26 | 3.88e-16 | 0.8393 |
| 1. PBF | Q92J88 | 50S ribosomal protein L10 | 0.00e+00 | 1.23e-21 | 5.57e-17 | 0.9389 |
| 1. PBF | Q8PNT2 | 50S ribosomal protein L10 | 0.00e+00 | 1.90e-13 | 1.28e-15 | 0.9291 |
| 1. PBF | Q88YW8 | 50S ribosomal protein L10 | 0.00e+00 | 3.13e-33 | 1.60e-33 | 0.9682 |
| 1. PBF | B0SUP2 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 1.45e-14 | 0.8384 |
| 1. PBF | B8G989 | 50S ribosomal protein L10 | 2.45e-14 | 6.16e-22 | 8.18e-12 | 0.7166 |
| 1. PBF | Q4FQH1 | 50S ribosomal protein L10 | 0.00e+00 | 1.51e-26 | 6.86e-16 | 0.8475 |
| 1. PBF | C5BHE2 | 50S ribosomal protein L10 | 0.00e+00 | 1.12e-25 | 1.43e-14 | 0.8367 |
| 1. PBF | B7JWT6 | 50S ribosomal protein L10 | 1.11e-16 | 7.26e-15 | 1.00e-11 | 0.7783 |
| 1. PBF | Q0AF51 | 50S ribosomal protein L10 | 0.00e+00 | 1.61e-26 | 4.31e-21 | 0.8345 |
| 1. PBF | Q1LI18 | 50S ribosomal protein L10 | 0.00e+00 | 1.29e-22 | 1.46e-25 | 0.9342 |
| 1. PBF | P99155 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.9254 |
| 1. PBF | A7IKP8 | 50S ribosomal protein L10 | 0.00e+00 | 1.12e-19 | 9.67e-12 | 0.9047 |
| 1. PBF | B1JU12 | 50S ribosomal protein L10 | 0.00e+00 | 3.25e-33 | 1.48e-28 | 0.8817 |
| 1. PBF | B7MR71 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8546 |
| 1. PBF | A9KW93 | 50S ribosomal protein L10 | 0.00e+00 | 3.08e-30 | 6.74e-14 | 0.828 |
| 1. PBF | Q6A6K4 | 50S ribosomal protein L10 | 5.55e-16 | 2.38e-06 | 2.41e-16 | 0.8045 |
| 1. PBF | A7NRZ6 | 50S ribosomal protein L10 | 1.73e-12 | 2.43e-17 | 4.10e-11 | 0.6863 |
| 1. PBF | Q73FA7 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9573 |
| 1. PBF | B4EYV1 | 50S ribosomal protein L10 | 0.00e+00 | 2.72e-33 | 1.60e-17 | 0.8412 |
| 1. PBF | Q65PB8 | 50S ribosomal protein L10 | 0.00e+00 | 3.96e-34 | 1.48e-35 | 0.9485 |
| 1. PBF | Q2SU17 | 50S ribosomal protein L10 | 0.00e+00 | 1.02e-33 | 5.19e-26 | 0.8843 |
| 1. PBF | Q9PA84 | 50S ribosomal protein L10 | 0.00e+00 | 1.25e-23 | 2.41e-15 | 0.9085 |
| 1. PBF | B1YRC0 | 50S ribosomal protein L10 | 0.00e+00 | 2.82e-33 | 9.10e-26 | 0.88 |
| 1. PBF | A9ADI3 | 50S ribosomal protein L10 | 0.00e+00 | 7.15e-34 | 1.98e-25 | 0.8781 |
| 1. PBF | O84319 | 50S ribosomal protein L10 | 0.00e+00 | 3.23e-25 | 4.56e-06 | 0.8931 |
| 1. PBF | A0LRL1 | 50S ribosomal protein L10 | 0.00e+00 | 4.08e-28 | 9.19e-19 | 0.7689 |
| 1. PBF | B3PW57 | 50S ribosomal protein L10 | 0.00e+00 | 1.42e-25 | 1.10e-10 | 0.9283 |
| 1. PBF | Q0I0B4 | 50S ribosomal protein L10 | 0.00e+00 | 3.59e-30 | 1.24e-15 | 0.83 |
| 1. PBF | B5EFP1 | 50S ribosomal protein L10 | 0.00e+00 | 7.66e-29 | 6.08e-19 | 0.9254 |
| 1. PBF | A2SLG7 | 50S ribosomal protein L10 | 0.00e+00 | 4.62e-26 | 1.61e-26 | 0.8897 |
| 1. PBF | Q1H4P6 | 50S ribosomal protein L10 | 0.00e+00 | 9.89e-22 | 2.71e-26 | 0.8893 |
| 1. PBF | A9M5R2 | 50S ribosomal protein L10 | 0.00e+00 | 3.67e-22 | 3.15e-15 | 0.9065 |
| 1. PBF | A0JZ99 | 50S ribosomal protein L10 | 3.33e-16 | 4.14e-05 | 1.93e-14 | 0.8075 |
| 1. PBF | P75240 | 50S ribosomal protein L10 | 0.00e+00 | 2.53e-34 | 2.09e-13 | 0.8111 |
| 1. PBF | Q88QP3 | 50S ribosomal protein L10 | 0.00e+00 | 1.33e-27 | 5.64e-13 | 0.8785 |
| 1. PBF | P42923 | 50S ribosomal protein L10 | 0.00e+00 | 3.46e-35 | 2.13e-34 | 0.9443 |
| 1. PBF | P41107 | 50S ribosomal protein L10 | 0.00e+00 | 1.11e-22 | 6.73e-16 | 0.8953 |
| 1. PBF | A0QL54 | 50S ribosomal protein L10 | 0.00e+00 | 9.89e-10 | 2.54e-18 | 0.8532 |
| 1. PBF | Q21M95 | 50S ribosomal protein L10 | 0.00e+00 | 3.32e-23 | 8.93e-16 | 0.9145 |
| 1. PBF | Q134R6 | 50S ribosomal protein L10 | 0.00e+00 | 4.13e-26 | 4.42e-11 | 0.8778 |
| 1. PBF | C4K4F3 | 50S ribosomal protein L10 | 0.00e+00 | 2.66e-28 | 1.78e-13 | 0.8379 |
| 1. PBF | B0CAD1 | 50S ribosomal protein L10 | 1.11e-16 | 1.51e-29 | 5.61e-10 | 0.7844 |
| 1. PBF | B8DVY4 | 50S ribosomal protein L10 | 0.00e+00 | 6.28e-24 | 5.87e-20 | 0.8471 |
| 1. PBF | Q89J72 | 50S ribosomal protein L10 | 0.00e+00 | 7.36e-22 | 2.43e-13 | 0.8604 |
| 1. PBF | Q2YSC2 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.9238 |
| 1. PBF | B4SKV4 | 50S ribosomal protein L10 | 0.00e+00 | 2.69e-15 | 1.70e-16 | 0.9213 |
| 1. PBF | B3QYL2 | 50S ribosomal protein L10 | 0.00e+00 | 6.32e-27 | 2.04e-15 | 0.8931 |
| 1. PBF | Q9KGE4 | 50S ribosomal protein L10 | 0.00e+00 | 1.64e-34 | 5.25e-33 | 0.9274 |
| 1. PBF | Q2K9M6 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-25 | 1.51e-11 | 0.9451 |
| 1. PBF | Q73SE9 | 50S ribosomal protein L10 | 1.11e-16 | 2.55e-09 | 2.73e-18 | 0.8432 |
| 1. PBF | A8G1F7 | 50S ribosomal protein L10 | 0.00e+00 | 3.64e-26 | 1.55e-15 | 0.8281 |
| 1. PBF | P0A7J5 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8515 |
| 1. PBF | Q2ST51 | 50S ribosomal protein L10 | 0.00e+00 | 2.58e-82 | 2.05e-115 | 0.9077 |
| 1. PBF | P57148 | 50S ribosomal protein L10 | 0.00e+00 | 1.53e-34 | 9.16e-05 | 0.809 |
| 1. PBF | Q6G3X7 | 50S ribosomal protein L10 | 0.00e+00 | 1.04e-24 | 2.80e-11 | 0.9467 |
| 1. PBF | A1VTG0 | 50S ribosomal protein L10 | 0.00e+00 | 1.63e-16 | 7.13e-21 | 0.8637 |
| 1. PBF | B2G5T6 | 50S ribosomal protein L10 | 0.00e+00 | 7.79e-29 | 1.25e-29 | 0.9173 |
| 1. PBF | Q39KH7 | 50S ribosomal protein L10 | 0.00e+00 | 6.58e-33 | 3.28e-30 | 0.8831 |
| 1. PBF | A2BUH9 | 50S ribosomal protein L10 | 0.00e+00 | 1.53e-31 | 2.44e-17 | 0.7959 |
| 1. PBF | B5YEX8 | 50S ribosomal protein L10 | 0.00e+00 | 4.99e-24 | 3.12e-13 | 0.8702 |
| 1. PBF | Q0SY15 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8544 |
| 1. PBF | Q8NT29 | 50S ribosomal protein L10 | 0.00e+00 | 5.25e-21 | 8.59e-15 | 0.8117 |
| 1. PBF | Q8EVJ0 | 50S ribosomal protein L10 | 0.00e+00 | 2.20e-35 | 3.10e-24 | 0.7876 |
| 1. PBF | Q83HB1 | 50S ribosomal protein L10 | 0.00e+00 | 3.44e-21 | 4.22e-12 | 0.8347 |
| 1. PBF | C1CL63 | 50S ribosomal protein L10 | 0.00e+00 | 7.08e-38 | 1.10e-28 | 0.9002 |
| 1. PBF | Q3K0K8 | 50S ribosomal protein L10 | 0.00e+00 | 2.48e-36 | 6.18e-29 | 0.8873 |
| 1. PBF | A3PAS0 | 50S ribosomal protein L10 | 0.00e+00 | 6.40e-31 | 8.38e-19 | 0.8108 |
| 1. PBF | Q7NQE4 | 50S ribosomal protein L10 | 0.00e+00 | 1.70e-34 | 6.44e-25 | 0.8866 |
| 1. PBF | B2GIJ3 | 50S ribosomal protein L10 | 0.00e+00 | 4.62e-19 | 1.21e-12 | 0.8108 |
| 1. PBF | B5F0W5 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8335 |
| 1. PBF | A6T3L5 | 50S ribosomal protein L10 | 0.00e+00 | 1.43e-12 | 2.59e-26 | 0.9095 |
| 1. PBF | P23350 | 50S ribosomal protein L10 | 1.11e-16 | 2.08e-30 | 5.30e-14 | 0.7846 |
| 1. PBF | A6W5S8 | 50S ribosomal protein L10 | 6.66e-16 | 9.57e-11 | 8.98e-13 | 0.7548 |
| 1. PBF | A9ISF5 | 50S ribosomal protein L10 | 0.00e+00 | 5.15e-24 | 7.20e-11 | 0.8594 |
| 1. PBF | Q8DUH2 | 50S ribosomal protein L10 | 0.00e+00 | 7.28e-35 | 1.66e-28 | 0.9057 |
| 1. PBF | B7HJ37 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9407 |
| 1. PBF | Q31U12 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8521 |
| 1. PBF | A8LLK4 | 50S ribosomal protein L10 | 0.00e+00 | 7.21e-19 | 3.52e-10 | 0.9212 |
| 1. PBF | Q72UB0 | 50S ribosomal protein L10 | 0.00e+00 | 2.90e-25 | 1.62e-18 | 0.8377 |
| 1. PBF | C6E4R6 | 50S ribosomal protein L10 | 0.00e+00 | 7.66e-29 | 6.08e-19 | 0.8799 |
| 1. PBF | Q2RQV1 | 50S ribosomal protein L10 | 0.00e+00 | 9.12e-28 | 9.97e-14 | 0.8953 |
| 1. PBF | C1KYI2 | 50S ribosomal protein L10 | 0.00e+00 | 6.22e-36 | 9.98e-32 | 0.9378 |
| 1. PBF | B7LA78 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8581 |
| 1. PBF | B7MIX1 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8486 |
| 1. PBF | C5A0S5 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.849 |
| 1. PBF | Q5LMQ3 | 50S ribosomal protein L10 | 0.00e+00 | 1.46e-19 | 3.06e-18 | 0.8577 |
| 1. PBF | B7HQT3 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.95 |
| 1. PBF | C1D0S4 | 50S ribosomal protein L10 | 0.00e+00 | 2.38e-29 | 1.19e-07 | 0.8344 |
| 1. PBF | A6TZ16 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.93 |
| 1. PBF | Q9HWC7 | 50S ribosomal protein L10 | 0.00e+00 | 9.65e-24 | 4.61e-14 | 0.8814 |
| 1. PBF | B9M6V4 | 50S ribosomal protein L10 | 0.00e+00 | 5.05e-29 | 1.16e-16 | 0.9038 |
| 1. PBF | B7UPE0 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8522 |
| 1. PBF | Q2YM13 | 50S ribosomal protein L10 | 0.00e+00 | 3.67e-22 | 3.15e-15 | 0.9069 |
| 1. PBF | Q8ZAP3 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.11e-16 | 0.811 |
| 1. PBF | Q7VDY7 | 50S ribosomal protein L10 | 0.00e+00 | 8.43e-33 | 3.01e-13 | 0.8149 |
| 1. PBF | A4G9U7 | 50S ribosomal protein L10 | 0.00e+00 | 4.04e-12 | 5.78e-28 | 0.93 |
| 1. PBF | B5Y932 | 50S ribosomal protein L10 | 0.00e+00 | 1.82e-29 | 5.43e-16 | 0.8163 |
| 1. PBF | O83267 | 50S ribosomal protein L10 | 0.00e+00 | 8.97e-28 | 5.55e-08 | 0.8692 |
| 1. PBF | Q3A6Q6 | 50S ribosomal protein L10 | 0.00e+00 | 7.92e-27 | 1.00e-19 | 0.912 |
| 1. PBF | Q2S903 | 50S ribosomal protein L10 | 0.00e+00 | 2.10e-20 | 1.56e-17 | 0.8907 |
| 1. PBF | Q2JFI7 | 50S ribosomal protein L10 | 1.11e-16 | 4.33e-13 | 1.00e-18 | 0.7613 |
| 1. PBF | Q3Z7T5 | 50S ribosomal protein L10 | 0.00e+00 | 1.64e-25 | 1.08e-08 | 0.8633 |
| 1. PBF | B7IT08 | 50S ribosomal protein L10 | 0.00e+00 | 2.05e-31 | 3.22e-37 | 0.9468 |
| 1. PBF | A7FNI5 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.11e-16 | 0.837 |
| 1. PBF | Q2W2H9 | 50S ribosomal protein L10 | 0.00e+00 | 1.70e-28 | 7.87e-12 | 0.8644 |
| 1. PBF | B1JDX3 | 50S ribosomal protein L10 | 0.00e+00 | 5.73e-27 | 1.14e-12 | 0.8845 |
| 1. PBF | Q46WD2 | 50S ribosomal protein L10 | 0.00e+00 | 3.92e-23 | 3.01e-25 | 0.9377 |
| 1. PBF | B1KMZ2 | 50S ribosomal protein L10 | 0.00e+00 | 1.20e-25 | 1.47e-15 | 0.8293 |
| 1. PBF | Q87KQ2 | 50S ribosomal protein L10 | 0.00e+00 | 7.33e-26 | 3.02e-13 | 0.8133 |
| 1. PBF | Q5FTX5 | 50S ribosomal protein L10 | 0.00e+00 | 7.68e-26 | 6.49e-11 | 0.7976 |
| 1. PBF | B2TWH1 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8539 |
| 1. PBF | B2SQP9 | 50S ribosomal protein L10 | 0.00e+00 | 3.58e-17 | 1.01e-15 | 0.9202 |
| 1. PBF | Q3YST7 | 50S ribosomal protein L10 | 1.11e-16 | 3.15e-27 | 0.004 | 0.7923 |
| 1. PBF | B8F6N1 | 50S ribosomal protein L10 | 0.00e+00 | 1.70e-29 | 1.05e-16 | 0.8091 |
| 1. PBF | B2T761 | 50S ribosomal protein L10 | 0.00e+00 | 1.15e-30 | 3.06e-26 | 0.8878 |
| 1. PBF | Q0BYA5 | 50S ribosomal protein L10 | 0.00e+00 | 1.29e-23 | 3.45e-09 | 0.8363 |
| 1. PBF | Q1R5V0 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8483 |
| 1. PBF | P0A298 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8371 |
| 1. PBF | Q2NWR8 | 50S ribosomal protein L10 | 0.00e+00 | 1.08e-26 | 3.33e-17 | 0.8381 |
| 1. PBF | A1A032 | 50S ribosomal protein L10 | 0.00e+00 | 3.84e-24 | 5.51e-20 | 0.8443 |
| 1. PBF | A1TYI8 | 50S ribosomal protein L10 | 0.00e+00 | 4.28e-24 | 9.39e-15 | 0.9292 |
| 1. PBF | A4W5A5 | 50S ribosomal protein L10 | 0.00e+00 | 3.50e-25 | 5.95e-14 | 0.837 |
| 1. PBF | A4QBF9 | 50S ribosomal protein L10 | 0.00e+00 | 3.11e-21 | 6.74e-15 | 0.8161 |
| 1. PBF | B3EL59 | 50S ribosomal protein L10 | 0.00e+00 | 8.45e-26 | 5.62e-16 | 0.8841 |
| 1. PBF | B7KN43 | 50S ribosomal protein L10 | 0.00e+00 | 5.50e-26 | 1.43e-13 | 0.91 |
| 1. PBF | A0KRL5 | 50S ribosomal protein L10 | 0.00e+00 | 3.59e-30 | 1.24e-15 | 0.8275 |
| 1. PBF | Q7W0S1 | 50S ribosomal protein L10 | 0.00e+00 | 1.18e-24 | 2.05e-21 | 0.8262 |
| 1. PBF | B4UDT4 | 50S ribosomal protein L10 | 0.00e+00 | 1.71e-26 | 4.50e-16 | 0.8835 |
| 1. PBF | B1LNT7 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8494 |
| 1. PBF | Q8P159 | 50S ribosomal protein L10 | 0.00e+00 | 3.28e-37 | 3.18e-26 | 0.8831 |
| 1. PBF | Q3AUJ7 | 50S ribosomal protein L10 | 0.00e+00 | 2.59e-32 | 1.53e-12 | 0.83 |
| 1. PBF | B8CNC3 | 50S ribosomal protein L10 | 0.00e+00 | 3.59e-30 | 7.48e-17 | 0.8395 |
| 1. PBF | B8DLM5 | 50S ribosomal protein L10 | 0.00e+00 | 6.24e-25 | 1.11e-09 | 0.7638 |
| 1. PBF | B5XYF7 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8354 |
| 1. PBF | Q5M0W5 | 50S ribosomal protein L10 | 0.00e+00 | 4.81e-36 | 1.17e-30 | 0.8917 |
| 1. PBF | B1AHZ6 | 50S ribosomal protein L10 | 0.00e+00 | 1.65e-37 | 8.08e-22 | 0.8572 |
| 1. PBF | A1R8V8 | 50S ribosomal protein L10 | 8.88e-16 | 3.83e-05 | 3.53e-13 | 0.8255 |
| 1. PBF | Q048U4 | 50S ribosomal protein L10 | 0.00e+00 | 6.70e-33 | 4.64e-26 | 0.8804 |
| 1. PBF | B1MVU2 | 50S ribosomal protein L10 | 0.00e+00 | 2.59e-25 | 7.21e-23 | 0.9151 |
| 1. PBF | Q123G1 | 50S ribosomal protein L10 | 0.00e+00 | 9.83e-23 | 2.74e-20 | 0.8858 |
| 1. PBF | P66045 | 50S ribosomal protein L10 | 0.00e+00 | 1.36e-15 | 1.45e-17 | 0.8227 |
| 1. PBF | Q68XN0 | 50S ribosomal protein L10 | 0.00e+00 | 2.00e-27 | 2.13e-18 | 0.8293 |
| 1. PBF | C5CKF1 | 50S ribosomal protein L10 | 0.00e+00 | 6.44e-22 | 3.15e-20 | 0.883 |
| 1. PBF | Q13TG0 | 50S ribosomal protein L10 | 0.00e+00 | 1.15e-30 | 3.06e-26 | 0.9226 |
| 1. PBF | Q3SSY2 | 50S ribosomal protein L10 | 0.00e+00 | 4.09e-25 | 6.18e-12 | 0.9316 |
| 1. PBF | A1JIH8 | 50S ribosomal protein L10 | 0.00e+00 | 7.92e-27 | 2.07e-15 | 0.832 |
| 1. PBF | Q87A30 | 50S ribosomal protein L10 | 0.00e+00 | 2.68e-25 | 2.52e-15 | 0.9375 |
| 1. PBF | B0U5X9 | 50S ribosomal protein L10 | 0.00e+00 | 8.67e-25 | 1.39e-15 | 0.9325 |
| 1. PBF | B0UHX8 | 50S ribosomal protein L10 | 0.00e+00 | 1.86e-24 | 2.98e-15 | 0.87 |
| 1. PBF | A3CMW1 | 50S ribosomal protein L10 | 0.00e+00 | 4.34e-38 | 2.63e-29 | 0.8841 |
| 1. PBF | Q8D235 | 50S ribosomal protein L10 | 0.00e+00 | 5.85e-28 | 1.92e-13 | 0.8478 |
| 1. PBF | Q8DD22 | 50S ribosomal protein L10 | 0.00e+00 | 1.74e-26 | 1.76e-13 | 0.8119 |
| 1. PBF | A1AX77 | 50S ribosomal protein L10 | 0.00e+00 | 9.75e-32 | 4.96e-15 | 0.9273 |
| 1. PBF | Q03E50 | 50S ribosomal protein L10 | 0.00e+00 | 1.38e-32 | 1.96e-30 | 0.9371 |
| 1. PBF | Q63HA1 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9342 |
| 1. PBF | Q8VVE3 | 50S ribosomal protein L10 | 1.11e-16 | 5.39e-28 | 2.33e-12 | 0.7871 |
| 1. PBF | A8A784 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8528 |
| 1. PBF | A4WVL8 | 50S ribosomal protein L10 | 0.00e+00 | 1.30e-24 | 2.52e-12 | 0.8322 |
| 1. PBF | B8D8J8 | 50S ribosomal protein L10 | 0.00e+00 | 1.53e-34 | 9.16e-05 | 0.8076 |
| 1. PBF | C3LR58 | 50S ribosomal protein L10 | 0.00e+00 | 1.26e-26 | 1.17e-13 | 0.8177 |
| 1. PBF | Q02YR7 | 50S ribosomal protein L10 | 0.00e+00 | 5.43e-40 | 2.94e-30 | 0.9201 |
| 1. PBF | Q822I9 | 50S ribosomal protein L10 | 0.00e+00 | 4.79e-25 | 4.63e-05 | 0.8889 |
| 1. PBF | B1VER8 | 50S ribosomal protein L10 | 1.11e-16 | 3.90e-25 | 4.54e-11 | 0.8013 |
| 1. PBF | Q1C1T9 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.11e-16 | 0.8346 |
| 1. PBF | B1XSP1 | 50S ribosomal protein L10 | 0.00e+00 | 8.89e-20 | 8.45e-25 | 0.9185 |
| 1. PBF | B2VG94 | 50S ribosomal protein L10 | 0.00e+00 | 1.24e-27 | 3.94e-15 | 0.8385 |
| 1. PBF | A5EX72 | 50S ribosomal protein L10 | 0.00e+00 | 2.83e-32 | 5.99e-16 | 0.8617 |
| 1. PBF | B0K5G6 | 50S ribosomal protein L10 | 0.00e+00 | 1.44e-29 | 3.52e-21 | 0.8456 |
| 1. PBF | Q661M7 | 50S ribosomal protein L10 | 0.00e+00 | 2.14e-36 | 9.59e-10 | 0.9098 |
| 1. PBF | A1T067 | 50S ribosomal protein L10 | 0.00e+00 | 2.85e-23 | 3.65e-18 | 0.8493 |
| 1. PBF | Q0HNU6 | 50S ribosomal protein L10 | 0.00e+00 | 3.59e-30 | 1.24e-15 | 0.828 |
| 1. PBF | C5C0K5 | 50S ribosomal protein L10 | 0.00e+00 | 5.83e-27 | 5.45e-15 | 0.7672 |
| 1. PBF | Q8CTT2 | 50S ribosomal protein L10 | 0.00e+00 | 1.06e-36 | 2.39e-32 | 0.9273 |
| 1. PBF | Q57H71 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8345 |
| 1. PBF | B0TM21 | 50S ribosomal protein L10 | 0.00e+00 | 1.45e-25 | 4.59e-16 | 0.8396 |
| 1. PBF | A5IHS3 | 50S ribosomal protein L10 | 0.00e+00 | 1.45e-20 | 5.93e-13 | 0.8732 |
| 1. PBF | B7NRR3 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8458 |
| 1. PBF | Q02T89 | 50S ribosomal protein L10 | 0.00e+00 | 9.65e-24 | 4.61e-14 | 0.8489 |
| 1. PBF | Q5HRL3 | 50S ribosomal protein L10 | 0.00e+00 | 1.06e-36 | 2.39e-32 | 0.9268 |
| 1. PBF | Q054E4 | 50S ribosomal protein L10 | 0.00e+00 | 2.27e-24 | 1.26e-19 | 0.8098 |
| 1. PBF | B5FC90 | 50S ribosomal protein L10 | 0.00e+00 | 1.92e-23 | 1.34e-14 | 0.7967 |
| 1. PBF | Q9PK78 | 50S ribosomal protein L10 | 0.00e+00 | 3.72e-25 | 1.14e-06 | 0.9108 |
| 1. PBF | C1AKY4 | 50S ribosomal protein L10 | 0.00e+00 | 1.36e-15 | 1.45e-17 | 0.8168 |
| 1. PBF | P41103 | 50S ribosomal protein L10 | 2.22e-16 | 2.88e-20 | 1.45e-14 | 0.7888 |
| 1. PBF | B8E0K1 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 2.31e-14 | 0.7647 |
| 1. PBF | B1VAM8 | 50S ribosomal protein L10 | 0.00e+00 | 1.08e-34 | 1.98e-25 | 0.9243 |
| 1. PBF | Q92QH9 | 50S ribosomal protein L10 | 0.00e+00 | 1.72e-25 | 2.31e-13 | 0.9198 |
| 1. PBF | A7GK10 | 50S ribosomal protein L10 | 0.00e+00 | 3.14e-34 | 1.87e-36 | 0.9334 |
| 1. PBF | A0QS62 | 50S ribosomal protein L10 | 0.00e+00 | 2.37e-18 | 4.04e-15 | 0.8203 |
| 1. PBF | A1WK53 | 50S ribosomal protein L10 | 0.00e+00 | 1.64e-27 | 1.40e-23 | 0.8949 |
| 1. PBF | B2IK53 | 50S ribosomal protein L10 | 0.00e+00 | 1.52e-18 | 1.62e-10 | 0.8903 |
| 1. PBF | Q5YPC7 | 50S ribosomal protein L10 | 0.00e+00 | 2.64e-19 | 1.27e-19 | 0.8543 |
| 1. PBF | A1S209 | 50S ribosomal protein L10 | 0.00e+00 | 1.51e-28 | 6.95e-16 | 0.8272 |
| 1. PBF | A9B5G7 | 50S ribosomal protein L10 | 0.00e+00 | 1.38e-25 | 1.78e-15 | 0.8095 |
| 1. PBF | A7Z0M6 | 50S ribosomal protein L10 | 0.00e+00 | 1.56e-34 | 5.04e-32 | 0.9356 |
| 1. PBF | A6TWJ2 | 50S ribosomal protein L10 | 0.00e+00 | 3.79e-35 | 3.69e-26 | 0.9444 |
| 1. PBF | Q6LLW0 | 50S ribosomal protein L10 | 0.00e+00 | 1.11e-24 | 5.83e-14 | 0.7932 |
| 1. PBF | C5D3Q6 | 50S ribosomal protein L10 | 0.00e+00 | 6.31e-34 | 2.12e-32 | 0.9065 |
| 1. PBF | Q21SF5 | 50S ribosomal protein L10 | 0.00e+00 | 8.03e-24 | 1.87e-20 | 0.8702 |
| 1. PBF | A5FQR0 | 50S ribosomal protein L10 | 0.00e+00 | 9.89e-28 | 3.84e-08 | 0.888 |
| 1. PBF | Q98QS1 | 50S ribosomal protein L10 | 0.00e+00 | 9.15e-42 | 8.76e-45 | 0.9191 |
| 1. PBF | A6TGN8 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8339 |
| 1. PBF | C5BQ37 | 50S ribosomal protein L10 | 0.00e+00 | 1.35e-23 | 3.02e-17 | 0.9406 |
| 1. PBF | A9MHF4 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8361 |
| 1. PBF | B0KCJ0 | 50S ribosomal protein L10 | 0.00e+00 | 4.27e-29 | 2.76e-21 | 0.8355 |
| 1. PBF | A5ELN9 | 50S ribosomal protein L10 | 0.00e+00 | 1.25e-22 | 1.20e-11 | 0.9248 |
| 1. PBF | Q11HB1 | 50S ribosomal protein L10 | 0.00e+00 | 1.54e-22 | 2.68e-13 | 0.8704 |
| 1. PBF | Q0SF99 | 50S ribosomal protein L10 | 1.11e-16 | 2.74e-13 | 2.77e-18 | 0.8309 |
| 1. PBF | B1XBY7 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8605 |
| 1. PBF | Q48TS4 | 50S ribosomal protein L10 | 0.00e+00 | 7.63e-38 | 1.05e-26 | 0.8832 |
| 1. PBF | A9NEL4 | 50S ribosomal protein L10 | 0.00e+00 | 1.20e-38 | 1.91e-31 | 0.8531 |
| 1. PBF | A5UHD1 | 50S ribosomal protein L10 | 0.00e+00 | 2.76e-29 | 4.63e-17 | 0.8088 |
| 1. PBF | Q18CE8 | 50S ribosomal protein L10 | 0.00e+00 | 5.67e-34 | 5.41e-27 | 0.9118 |
| 1. PBF | Q1QN46 | 50S ribosomal protein L10 | 0.00e+00 | 3.84e-24 | 1.28e-11 | 0.8766 |
| 1. PBF | Q82DQ7 | 50S ribosomal protein L10 | 0.00e+00 | 4.25e-22 | 1.05e-13 | 0.8087 |
| 1. PBF | Q0ANP1 | 50S ribosomal protein L10 | 0.00e+00 | 2.10e-27 | 1.23e-12 | 0.7478 |
| 1. PBF | B6I5J5 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8507 |
| 1. PBF | Q5L5I1 | 50S ribosomal protein L10 | 0.00e+00 | 6.97e-25 | 5.39e-06 | 0.8466 |
| 1. PBF | Q0I0V0 | 50S ribosomal protein L10 | 0.00e+00 | 5.87e-29 | 2.27e-17 | 0.8052 |
| 1. PBF | Q1D7U5 | 50S ribosomal protein L10 | 0.00e+00 | 9.94e-21 | 5.53e-14 | 0.9331 |
| 1. PBF | A9GRA5 | 50S ribosomal protein L10 | 0.00e+00 | 8.94e-25 | 1.59e-14 | 0.8504 |
| 1. PBF | Q7V477 | 50S ribosomal protein L10 | 0.00e+00 | 1.21e-30 | 9.70e-15 | 0.8392 |
| 1. PBF | A8EXK6 | 50S ribosomal protein L10 | 0.00e+00 | 1.50e-23 | 5.75e-17 | 0.9019 |
| 1. PBF | B1Y7H5 | 50S ribosomal protein L10 | 0.00e+00 | 1.42e-19 | 3.65e-25 | 0.9005 |
| 1. PBF | B2I1Y9 | 50S ribosomal protein L10 | 0.00e+00 | 5.35e-35 | 8.86e-19 | 0.9105 |
| 1. PBF | A9BDG5 | 50S ribosomal protein L10 | 0.00e+00 | 1.85e-31 | 2.00e-13 | 0.8436 |
| 1. PBF | A4SHU7 | 50S ribosomal protein L10 | 0.00e+00 | 3.10e-27 | 2.09e-17 | 0.8294 |
| 1. PBF | B0TX08 | 50S ribosomal protein L10 | 0.00e+00 | 8.81e-30 | 4.68e-14 | 0.8635 |
| 1. PBF | Q6MRX8 | 50S ribosomal protein L10 | 0.00e+00 | 2.04e-72 | 5.35e-114 | 0.9104 |
| 1. PBF | B6IRP4 | 50S ribosomal protein L10 | 0.00e+00 | 1.39e-27 | 1.04e-09 | 0.8954 |
| 1. PBF | B0SAG3 | 50S ribosomal protein L10 | 0.00e+00 | 5.96e-25 | 9.68e-15 | 0.8531 |
| 1. PBF | P66042 | 50S ribosomal protein L10 | 0.00e+00 | 1.16e-36 | 3.25e-31 | 0.9433 |
| 1. PBF | B2JIH6 | 50S ribosomal protein L10 | 0.00e+00 | 6.03e-33 | 1.17e-30 | 0.922 |
| 1. PBF | B4U3I0 | 50S ribosomal protein L10 | 0.00e+00 | 1.65e-37 | 3.24e-26 | 0.8807 |
| 1. PBF | Q8ETZ1 | 50S ribosomal protein L10 | 0.00e+00 | 1.40e-36 | 4.57e-29 | 0.8737 |
| 1. PBF | A8MLD0 | 50S ribosomal protein L10 | 0.00e+00 | 3.59e-35 | 5.44e-27 | 0.9689 |
| 1. PBF | B9MH49 | 50S ribosomal protein L10 | 0.00e+00 | 1.70e-32 | 8.85e-22 | 0.878 |
| 1. PBF | C1F3Y1 | 50S ribosomal protein L10 | 0.00e+00 | 3.83e-22 | 2.01e-10 | 0.852 |
| 1. PBF | Q9PRD5 | 50S ribosomal protein L10 | 0.00e+00 | 1.65e-37 | 8.08e-22 | 0.8457 |
| 1. PBF | B1ICF5 | 50S ribosomal protein L10 | 0.00e+00 | 7.08e-38 | 1.10e-28 | 0.8929 |
| 1. PBF | Q4FLL0 | 50S ribosomal protein L10 | 0.00e+00 | 1.70e-30 | 1.75e-16 | 0.8553 |
| 1. PBF | Q8RTJ3 | 50S ribosomal protein L10 | 0.00e+00 | 5.64e-15 | 5.65e-15 | 0.9086 |
| 1. PBF | A6WHR9 | 50S ribosomal protein L10 | 0.00e+00 | 3.08e-30 | 6.74e-14 | 0.8282 |
| 1. PBF | Q8YLJ6 | 50S ribosomal protein L10 | 0.00e+00 | 2.27e-23 | 1.25e-10 | 0.808 |
| 1. PBF | A3Q973 | 50S ribosomal protein L10 | 0.00e+00 | 9.35e-29 | 1.36e-17 | 0.8392 |
| 1. PBF | P36263 | 50S ribosomal protein L10 | 0.00e+00 | 2.12e-33 | 2.70e-10 | 0.8251 |
| 1. PBF | B3EER0 | 50S ribosomal protein L10 | 0.00e+00 | 3.55e-29 | 2.34e-15 | 0.8506 |
| 1. PBF | Q73JJ5 | 50S ribosomal protein L10 | 0.00e+00 | 4.30e-07 | 1.06e-12 | 0.8516 |
| 1. PBF | B2A4C8 | 50S ribosomal protein L10 | 0.00e+00 | 2.53e-28 | 7.54e-20 | 0.9033 |
| 1. PBF | B5RFK3 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8333 |
| 1. PBF | Q6FZL7 | 50S ribosomal protein L10 | 0.00e+00 | 3.11e-22 | 7.74e-11 | 0.8947 |
| 1. PBF | B7V635 | 50S ribosomal protein L10 | 0.00e+00 | 9.65e-24 | 4.61e-14 | 0.88 |
| 1. PBF | B5Z8J7 | 50S ribosomal protein L10 | 0.00e+00 | 1.10e-35 | 6.64e-21 | 0.8953 |
| 1. PBF | B5Z081 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8546 |
| 1. PBF | B0RU91 | 50S ribosomal protein L10 | 0.00e+00 | 5.64e-15 | 5.65e-15 | 0.9189 |
| 1. PBF | A8G8E5 | 50S ribosomal protein L10 | 0.00e+00 | 6.79e-28 | 6.52e-16 | 0.8396 |
| 1. PBF | B9KYX5 | 50S ribosomal protein L10 | 0.00e+00 | 7.86e-17 | 6.86e-21 | 0.8797 |
| 1. PBF | B9KFG5 | 50S ribosomal protein L10 | 0.00e+00 | 6.79e-39 | 2.72e-12 | 0.8494 |
| 1. PBF | A9NAL2 | 50S ribosomal protein L10 | 0.00e+00 | 2.66e-28 | 1.63e-20 | 0.8947 |
| 1. PBF | Q2RFN7 | 50S ribosomal protein L10 | 0.00e+00 | 1.91e-30 | 5.31e-20 | 0.836 |
| 1. PBF | Q03ST7 | 50S ribosomal protein L10 | 0.00e+00 | 9.65e-36 | 3.96e-28 | 0.9276 |
| 1. PBF | C1C7V5 | 50S ribosomal protein L10 | 0.00e+00 | 1.30e-38 | 7.04e-29 | 0.8985 |
| 1. PBF | Q2GCD2 | 50S ribosomal protein L10 | 0.00e+00 | 8.59e-26 | 1.86e-07 | 0.9273 |
| 1. PBF | B0JTA6 | 50S ribosomal protein L10 | 2.22e-16 | 1.29e-22 | 3.78e-09 | 0.771 |
| 1. PBF | A1KRG4 | 50S ribosomal protein L10 | 0.00e+00 | 3.89e-31 | 1.90e-20 | 0.8893 |
| 1. PBF | Q7W2H1 | 50S ribosomal protein L10 | 0.00e+00 | 1.18e-24 | 2.05e-21 | 0.8295 |
| 1. PBF | Q5NID4 | 50S ribosomal protein L10 | 0.00e+00 | 5.58e-30 | 5.69e-15 | 0.8866 |
| 1. PBF | A1KGD1 | 50S ribosomal protein L10 | 0.00e+00 | 1.36e-15 | 1.45e-17 | 0.8081 |
| 1. PBF | C4LBV4 | 50S ribosomal protein L10 | 0.00e+00 | 6.79e-28 | 9.87e-17 | 0.8339 |
| 1. PBF | P66046 | 50S ribosomal protein L10 | 0.00e+00 | 3.89e-31 | 1.90e-20 | 0.8937 |
| 1. PBF | Q3J5T2 | 50S ribosomal protein L10 | 0.00e+00 | 3.24e-24 | 3.83e-12 | 0.8751 |
| 1. PBF | A0KQA7 | 50S ribosomal protein L10 | 0.00e+00 | 6.02e-27 | 1.16e-16 | 0.816 |
| 1. PBF | A8G2K9 | 50S ribosomal protein L10 | 0.00e+00 | 1.41e-30 | 1.55e-18 | 0.8088 |
| 1. PBF | A9BR96 | 50S ribosomal protein L10 | 0.00e+00 | 4.23e-23 | 7.03e-21 | 0.8836 |
| 1. PBF | Q9CG41 | 50S ribosomal protein L10 | 0.00e+00 | 6.71e-40 | 3.94e-30 | 0.9216 |
| 1. PBF | A4YBZ2 | 50S ribosomal protein L10 | 0.00e+00 | 3.08e-30 | 6.74e-14 | 0.8296 |
| 1. PBF | Q31IZ1 | 50S ribosomal protein L10 | 0.00e+00 | 1.89e-32 | 4.86e-18 | 0.9086 |
| 1. PBF | A4VHM1 | 50S ribosomal protein L10 | 0.00e+00 | 5.15e-24 | 1.71e-14 | 0.854 |
| 1. PBF | P66047 | 50S ribosomal protein L10 | 0.00e+00 | 3.89e-31 | 1.90e-20 | 0.9346 |
| 1. PBF | A1T4I7 | 50S ribosomal protein L10 | 0.00e+00 | 1.52e-18 | 1.15e-13 | 0.7701 |
| 1. PBF | P0A7J4 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8489 |
| 1. PBF | Q3MA17 | 50S ribosomal protein L10 | 0.00e+00 | 8.59e-23 | 1.91e-10 | 0.8116 |
| 1. PBF | P66043 | 50S ribosomal protein L10 | 0.00e+00 | 1.16e-36 | 3.25e-31 | 0.888 |
| 1. PBF | Q5GWS4 | 50S ribosomal protein L10 | 0.00e+00 | 3.58e-17 | 1.01e-15 | 0.9247 |
| 1. PBF | C0RJL3 | 50S ribosomal protein L10 | 0.00e+00 | 3.67e-22 | 3.15e-15 | 0.9008 |
| 1. PBF | Q1WST4 | 50S ribosomal protein L10 | 0.00e+00 | 1.42e-36 | 3.99e-28 | 0.9174 |
| 1. PBF | P0DD99 | 50S ribosomal protein L10 | 0.00e+00 | 7.63e-38 | 1.05e-26 | 0.8891 |
| 1. PBF | A5IQ93 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.93 |
| 1. PBF | A7HNY4 | 50S ribosomal protein L10 | 1.11e-16 | 2.78e-24 | 1.41e-10 | 0.7565 |
| 1. PBF | Q1IFX5 | 50S ribosomal protein L10 | 0.00e+00 | 3.45e-24 | 1.99e-13 | 0.8854 |
| 1. PBF | Q724G2 | 50S ribosomal protein L10 | 0.00e+00 | 6.22e-36 | 9.98e-32 | 0.886 |
| 1. PBF | Q0SNB6 | 50S ribosomal protein L10 | 0.00e+00 | 7.75e-36 | 5.47e-12 | 0.9164 |
| 1. PBF | Q0RRT3 | 50S ribosomal protein L10 | 3.33e-16 | 8.41e-09 | 7.97e-17 | 0.7655 |
| 1. PBF | B2FQ36 | 50S ribosomal protein L10 | 0.00e+00 | 2.98e-15 | 1.83e-16 | 0.9177 |
| 1. PBF | B6JER7 | 50S ribosomal protein L10 | 0.00e+00 | 2.24e-24 | 1.36e-11 | 0.9241 |
| 1. PBF | Q3SLQ8 | 50S ribosomal protein L10 | 0.00e+00 | 2.89e-23 | 1.99e-14 | 0.8749 |
| 1. PBF | A4SGK8 | 50S ribosomal protein L10 | 0.00e+00 | 6.25e-28 | 6.00e-13 | 0.8327 |
| 1. PBF | Q8YHP9 | 50S ribosomal protein L10 | 0.00e+00 | 3.67e-22 | 3.15e-15 | 0.8487 |
| 1. PBF | A1VYJ2 | 50S ribosomal protein L10 | 0.00e+00 | 1.61e-34 | 1.20e-18 | 0.8461 |
| 1. PBF | Q7N9A6 | 50S ribosomal protein L10 | 0.00e+00 | 1.34e-29 | 5.14e-19 | 0.8338 |
| 1. PBF | A4XZ99 | 50S ribosomal protein L10 | 0.00e+00 | 1.72e-23 | 1.52e-14 | 0.8914 |
| 1. PBF | Q6GJC9 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.9283 |
| 1. PBF | B2S689 | 50S ribosomal protein L10 | 0.00e+00 | 3.67e-22 | 3.15e-15 | 0.9083 |
| 1. PBF | B2SFD4 | 50S ribosomal protein L10 | 0.00e+00 | 4.62e-31 | 3.45e-14 | 0.896 |
| 1. PBF | Q12SW8 | 50S ribosomal protein L10 | 0.00e+00 | 1.39e-29 | 2.35e-14 | 0.8295 |
| 1. PBF | P66048 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.9199 |
| 1. PBF | B5RRJ9 | 50S ribosomal protein L10 | 0.00e+00 | 7.49e-38 | 1.39e-09 | 0.8979 |
| 1. PBF | B0BWA7 | 50S ribosomal protein L10 | 0.00e+00 | 4.64e-25 | 2.27e-13 | 0.851 |
| 1. PBF | A4YSH9 | 50S ribosomal protein L10 | 0.00e+00 | 1.25e-22 | 1.20e-11 | 0.8908 |
| 1. PBF | Q3A9Q4 | 50S ribosomal protein L10 | 0.00e+00 | 6.05e-28 | 2.43e-25 | 0.8536 |
| 1. PBF | P56036 | 50S ribosomal protein L10 | 0.00e+00 | 1.14e-34 | 3.03e-21 | 0.8911 |
| 1. PBF | Q72GS1 | 50S ribosomal protein L10 | 0.00e+00 | 5.39e-28 | 2.33e-12 | 0.8055 |
| 1. PBF | P66049 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.922 |
| 1. PBF | C1DKK3 | 50S ribosomal protein L10 | 0.00e+00 | 1.47e-22 | 5.96e-12 | 0.8847 |
| 1. PBF | Q7V383 | 50S ribosomal protein L10 | 0.00e+00 | 3.94e-32 | 1.40e-18 | 0.8065 |
| 1. PBF | Q6N4R7 | 50S ribosomal protein L10 | 0.00e+00 | 8.19e-26 | 6.98e-11 | 0.928 |
| 1. PBF | Q8KA68 | 50S ribosomal protein L10 | 0.00e+00 | 2.93e-36 | 0.001 | 0.8673 |
| 1. PBF | Q4A5Y9 | 50S ribosomal protein L10 | 0.00e+00 | 2.01e-42 | 6.71e-40 | 0.8788 |
| 1. PBF | Q7U3T8 | 50S ribosomal protein L10 | 0.00e+00 | 7.86e-31 | 4.45e-15 | 0.829 |
| 1. PBF | Q66FQ4 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.11e-16 | 0.8348 |
| 1. PBF | Q6AP80 | 50S ribosomal protein L10 | 0.00e+00 | 1.69e-20 | 6.25e-10 | 0.849 |
| 1. PBF | Q5N3N7 | 50S ribosomal protein L10 | 0.00e+00 | 6.95e-30 | 2.48e-14 | 0.8303 |
| 1. PBF | Q1GSF8 | 50S ribosomal protein L10 | 0.00e+00 | 1.91e-28 | 6.14e-13 | 0.8525 |
| 1. PBF | A1B013 | 50S ribosomal protein L10 | 0.00e+00 | 7.67e-24 | 3.11e-17 | 0.8524 |
| 1. PBF | Q1CS66 | 50S ribosomal protein L10 | 0.00e+00 | 1.39e-35 | 1.56e-21 | 0.8941 |
| 1. PBF | Q1MIF1 | 50S ribosomal protein L10 | 0.00e+00 | 2.36e-25 | 1.71e-09 | 0.9182 |
| 1. PBF | A6UZH9 | 50S ribosomal protein L10 | 0.00e+00 | 9.65e-24 | 4.61e-14 | 0.8824 |
| 1. PBF | B6JN39 | 50S ribosomal protein L10 | 0.00e+00 | 2.43e-36 | 4.00e-22 | 0.9056 |
| 1. PBF | Q889Y0 | 50S ribosomal protein L10 | 0.00e+00 | 2.07e-23 | 7.43e-15 | 0.8835 |
| 1. PBF | Q6KHB1 | 50S ribosomal protein L10 | 0.00e+00 | 5.57e-36 | 5.96e-19 | 0.8913 |
| 1. PBF | A5CW27 | 50S ribosomal protein L10 | 0.00e+00 | 2.39e-30 | 9.71e-15 | 0.9105 |
| 1. PBF | Q65W44 | 50S ribosomal protein L10 | 0.00e+00 | 1.82e-28 | 3.13e-18 | 0.8052 |
| 1. PBF | Q6YQW5 | 50S ribosomal protein L10 | 0.00e+00 | 8.42e-35 | 1.99e-25 | 0.9287 |
| 1. PBF | A4IJH8 | 50S ribosomal protein L10 | 0.00e+00 | 2.94e-37 | 1.77e-35 | 0.9303 |
| 1. PBF | B6J273 | 50S ribosomal protein L10 | 0.00e+00 | 2.66e-28 | 1.63e-20 | 0.894 |
| 1. PBF | B7H1K0 | 50S ribosomal protein L10 | 0.00e+00 | 5.35e-35 | 8.86e-19 | 0.9174 |
| 1. PBF | Q9CK89 | 50S ribosomal protein L10 | 1.11e-16 | 1.20e-28 | 1.08e-15 | 0.8055 |
| 1. PBF | A1ALT2 | 50S ribosomal protein L10 | 0.00e+00 | 5.96e-26 | 5.80e-16 | 0.9178 |
| 1. PBF | A9IJ29 | 50S ribosomal protein L10 | 0.00e+00 | 3.44e-25 | 2.92e-22 | 0.8634 |
| 1. PBF | A0AF49 | 50S ribosomal protein L10 | 0.00e+00 | 6.22e-36 | 9.98e-32 | 0.935 |
| 1. PBF | Q9Z9A2 | 50S ribosomal protein L10 | 0.00e+00 | 4.99e-24 | 2.59e-08 | 0.8503 |
| 1. PBF | A5UYI6 | 50S ribosomal protein L10 | 6.12e-12 | 1.80e-17 | 2.21e-12 | 0.6841 |
| 1. PBF | A1UBJ0 | 50S ribosomal protein L10 | 0.00e+00 | 1.63e-19 | 2.45e-14 | 0.8269 |
| 1. PBF | A6GYU2 | 50S ribosomal protein L10 | 1.11e-16 | 1.22e-25 | 3.04e-04 | 0.7606 |
| 1. PBF | P0A7J6 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8524 |
| 1. PBF | Q3K5X9 | 50S ribosomal protein L10 | 0.00e+00 | 4.77e-26 | 2.82e-13 | 0.8827 |
| 1. PBF | Q5L419 | 50S ribosomal protein L10 | 0.00e+00 | 3.81e-37 | 2.21e-35 | 0.9353 |
| 1. PBF | Q4QMS7 | 50S ribosomal protein L10 | 0.00e+00 | 5.49e-30 | 7.15e-17 | 0.8072 |
| 1. PBF | P36249 | 50S ribosomal protein L10 | 0.00e+00 | 1.72e-24 | 9.79e-09 | 0.773 |
| 1. PBF | Q0I6K9 | 50S ribosomal protein L10 | 0.00e+00 | 7.34e-31 | 4.17e-13 | 0.8461 |
| 1. PBF | Q0TA80 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8556 |
| 1. PBF | B7J1W3 | 50S ribosomal protein L10 | 0.00e+00 | 4.63e-36 | 8.37e-13 | 0.9085 |
| 1. PBF | B7GNG9 | 50S ribosomal protein L10 | 0.00e+00 | 5.00e-26 | 1.22e-17 | 0.8429 |
| 1. PBF | A2BNZ7 | 50S ribosomal protein L10 | 0.00e+00 | 1.01e-31 | 1.59e-18 | 0.8293 |
| 1. PBF | Q058E3 | 50S ribosomal protein L10 | 0.00e+00 | 3.43e-32 | 4.58e-06 | 0.8459 |
| 1. PBF | Q8G444 | 50S ribosomal protein L10 | 1.11e-16 | 5.00e-26 | 1.22e-17 | 0.7869 |
| 1. PBF | B8D0B4 | 50S ribosomal protein L10 | 0.00e+00 | 5.77e-29 | 6.19e-20 | 0.9239 |
| 1. PBF | A1KB36 | 50S ribosomal protein L10 | 0.00e+00 | 1.44e-29 | 1.23e-27 | 0.9418 |
| 1. PBF | A5CC95 | 50S ribosomal protein L10 | 3.00e-15 | 9.42e-28 | 8.62e-08 | 0.7982 |
| 1. PBF | B0CH43 | 50S ribosomal protein L10 | 0.00e+00 | 1.18e-22 | 6.06e-15 | 0.9005 |
| 1. PBF | C0Q2R5 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8364 |
| 1. PBF | P66050 | 50S ribosomal protein L10 | 0.00e+00 | 7.08e-38 | 1.10e-28 | 0.9089 |
| 1. PBF | Q6AH11 | 50S ribosomal protein L10 | 0.00e+00 | 1.73e-21 | 3.94e-11 | 0.7714 |
| 1. PBF | A9H3S7 | 50S ribosomal protein L10 | 0.00e+00 | 5.09e-34 | 2.50e-05 | 0.8954 |
| 1. PBF | A1BD21 | 50S ribosomal protein L10 | 0.00e+00 | 4.40e-30 | 2.14e-16 | 0.8806 |
| 1. PBF | A9WFP8 | 50S ribosomal protein L10 | 5.55e-16 | 2.93e-21 | 9.12e-11 | 0.751 |
| 1. PBF | Q255E8 | 50S ribosomal protein L10 | 0.00e+00 | 5.87e-25 | 1.47e-05 | 0.8804 |
| 1. PBF | Q4K524 | 50S ribosomal protein L10 | 0.00e+00 | 5.22e-23 | 5.54e-12 | 0.8854 |
| 1. PBF | Q14JT7 | 50S ribosomal protein L10 | 0.00e+00 | 5.58e-30 | 5.69e-15 | 0.8886 |
| 1. PBF | Q47UV7 | 50S ribosomal protein L10 | 1.11e-16 | 1.81e-27 | 5.70e-14 | 0.8094 |
| 1. PBF | Q3JMQ1 | 50S ribosomal protein L10 | 0.00e+00 | 1.12e-32 | 4.23e-26 | 0.8791 |
| 1. PBF | Q6DAN2 | 50S ribosomal protein L10 | 0.00e+00 | 1.59e-27 | 5.03e-15 | 0.8364 |
| 1. PBF | Q8E4M6 | 50S ribosomal protein L10 | 0.00e+00 | 2.48e-36 | 6.18e-29 | 0.8948 |
| 1. PBF | B9L7J4 | 50S ribosomal protein L10 | 0.00e+00 | 3.39e-36 | 5.75e-13 | 0.8157 |
| 1. PBF | Q4UKD2 | 50S ribosomal protein L10 | 0.00e+00 | 5.73e-21 | 8.07e-17 | 0.9085 |
| 1. PBF | A2S7G4 | 50S ribosomal protein L10 | 0.00e+00 | 1.12e-32 | 4.23e-26 | 0.8858 |
| 1. PBF | Q1RHC8 | 50S ribosomal protein L10 | 0.00e+00 | 1.79e-22 | 6.63e-20 | 0.9079 |
| 1. PBF | C4K1P1 | 50S ribosomal protein L10 | 0.00e+00 | 3.36e-26 | 1.05e-15 | 0.9219 |
| 1. PBF | B3R7T8 | 50S ribosomal protein L10 | 0.00e+00 | 3.34e-21 | 6.65e-26 | 0.9421 |
| 1. PBF | Q5HVZ1 | 50S ribosomal protein L10 | 0.00e+00 | 7.55e-35 | 4.05e-18 | 0.8423 |
| 1. PBF | Q1J0P2 | 50S ribosomal protein L10 | 0.00e+00 | 6.68e-28 | 3.19e-06 | 0.8082 |
| 1. PBF | Q04JZ3 | 50S ribosomal protein L10 | 0.00e+00 | 7.08e-38 | 1.10e-28 | 0.8897 |
| 1. PBF | Q81VU1 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9456 |
| 1. PBF | Q3AGT1 | 50S ribosomal protein L10 | 0.00e+00 | 3.22e-31 | 5.62e-14 | 0.7895 |
| 1. PBF | A4TS31 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.11e-16 | 0.8367 |
| 1. PBF | C6C177 | 50S ribosomal protein L10 | 0.00e+00 | 9.00e-26 | 1.43e-05 | 0.844 |
| 1. PBF | A8LC66 | 50S ribosomal protein L10 | 0.00e+00 | 1.71e-14 | 3.53e-17 | 0.7721 |
| 1. PBF | P66051 | 50S ribosomal protein L10 | 0.00e+00 | 7.08e-38 | 1.10e-28 | 0.8948 |
| 1. PBF | Q119S8 | 50S ribosomal protein L10 | 2.22e-16 | 7.26e-15 | 9.80e-11 | 0.7542 |
| 1. PBF | A1REA5 | 50S ribosomal protein L10 | 0.00e+00 | 3.08e-30 | 6.74e-14 | 0.828 |
| 1. PBF | P0A297 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8329 |
| 1. PBF | Q830Q7 | 50S ribosomal protein L10 | 0.00e+00 | 5.72e-39 | 5.79e-29 | 0.9021 |
| 1. PBF | Q6GBU8 | 50S ribosomal protein L10 | 0.00e+00 | 8.10e-34 | 3.03e-32 | 0.9147 |
| 1. PBF | Q38V10 | 50S ribosomal protein L10 | 0.00e+00 | 1.18e-35 | 7.23e-34 | 0.9062 |
| 1. PBF | A5FZX3 | 50S ribosomal protein L10 | 0.00e+00 | 2.55e-25 | 3.27e-10 | 0.8428 |
| 1. PBF | A5F3P3 | 50S ribosomal protein L10 | 0.00e+00 | 1.26e-26 | 1.17e-13 | 0.8135 |
| 1. PBF | B7J457 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.36e-21 | 0.8757 |
| 1. PBF | Q5FM13 | 50S ribosomal protein L10 | 0.00e+00 | 1.73e-35 | 4.06e-20 | 0.8726 |
| 1. PBF | B9LI31 | 50S ribosomal protein L10 | 6.66e-16 | 2.93e-21 | 9.12e-11 | 0.7484 |
| 1. PBF | B0B7N3 | 50S ribosomal protein L10 | 0.00e+00 | 1.20e-24 | 4.29e-06 | 0.8855 |
| 1. PBF | A5WH37 | 50S ribosomal protein L10 | 0.00e+00 | 2.76e-27 | 9.24e-13 | 0.8513 |
| 1. PBF | Q4L3K0 | 50S ribosomal protein L10 | 0.00e+00 | 1.90e-35 | 1.98e-32 | 0.9472 |
| 1. PBF | Q6HPR9 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9496 |
| 1. PBF | A1USC6 | 50S ribosomal protein L10 | 0.00e+00 | 8.72e-26 | 5.00e-10 | 0.9624 |
| 1. PBF | A8AKU1 | 50S ribosomal protein L10 | 0.00e+00 | 5.25e-26 | 1.01e-14 | 0.8363 |
| 1. PBF | B8HVL3 | 50S ribosomal protein L10 | 0.00e+00 | 8.90e-29 | 1.50e-11 | 0.8192 |
| 1. PBF | A3M1G1 | 50S ribosomal protein L10 | 0.00e+00 | 5.35e-35 | 8.86e-19 | 0.9239 |
| 1. PBF | B1IUR2 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8521 |
| 1. PBF | Q2IXS2 | 50S ribosomal protein L10 | 0.00e+00 | 1.95e-25 | 5.22e-11 | 0.8909 |
| 1. PBF | Q7VRP5 | 50S ribosomal protein L10 | 0.00e+00 | 1.47e-34 | 7.28e-12 | 0.8836 |
| 1. PBF | Q9KV32 | 50S ribosomal protein L10 | 0.00e+00 | 1.26e-26 | 1.17e-13 | 0.8154 |
| 1. PBF | B2IA70 | 50S ribosomal protein L10 | 0.00e+00 | 2.68e-25 | 2.52e-15 | 0.938 |
| 1. PBF | Q8XUZ6 | 50S ribosomal protein L10 | 0.00e+00 | 8.14e-25 | 4.96e-31 | 0.9266 |
| 1. PBF | Q890N3 | 50S ribosomal protein L10 | 0.00e+00 | 1.11e-38 | 6.67e-20 | 0.9388 |
| 1. PBF | Q82T73 | 50S ribosomal protein L10 | 0.00e+00 | 5.58e-29 | 2.35e-19 | 0.8398 |
| 1. PBF | Q1G904 | 50S ribosomal protein L10 | 0.00e+00 | 6.70e-33 | 4.64e-26 | 0.8841 |
| 1. PBF | A6LKC0 | 50S ribosomal protein L10 | 0.00e+00 | 9.29e-26 | 1.71e-06 | 0.8474 |
| 1. PBF | A8GV22 | 50S ribosomal protein L10 | 0.00e+00 | 1.79e-22 | 6.63e-20 | 0.9074 |
| 1. PBF | B8HD21 | 50S ribosomal protein L10 | 0.00e+00 | 6.56e-05 | 3.64e-15 | 0.8477 |
| 1. PBF | A9KD41 | 50S ribosomal protein L10 | 0.00e+00 | 2.66e-28 | 1.63e-20 | 0.8865 |
| 1. PBF | B5BJQ1 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8342 |
| 1. PBF | Q2II80 | 50S ribosomal protein L10 | 0.00e+00 | 2.68e-26 | 1.43e-16 | 0.9069 |
| 1. PBF | A4FPQ7 | 50S ribosomal protein L10 | 0.00e+00 | 3.25e-19 | 3.45e-15 | 0.8091 |
| 1. PBF | A8AXG9 | 50S ribosomal protein L10 | 0.00e+00 | 4.42e-38 | 3.37e-29 | 0.8845 |
| 1. PBF | Q04QI7 | 50S ribosomal protein L10 | 0.00e+00 | 2.27e-24 | 1.26e-19 | 0.8523 |
| 1. PBF | P29394 | 50S ribosomal protein L10 | 0.00e+00 | 6.68e-24 | 1.72e-11 | 0.8448 |
| 1. PBF | Q4A7A7 | 50S ribosomal protein L10 | 0.00e+00 | 2.11e-28 | 3.29e-26 | 0.9625 |
| 1. PBF | Q46HH1 | 50S ribosomal protein L10 | 0.00e+00 | 5.48e-31 | 1.33e-13 | 0.8331 |
| 1. PBF | Q4URD0 | 50S ribosomal protein L10 | 0.00e+00 | 5.64e-15 | 5.65e-15 | 0.9323 |
| 1. PBF | B7M732 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.851 |
| 1. PBF | Q60A08 | 50S ribosomal protein L10 | 0.00e+00 | 3.78e-25 | 1.38e-15 | 0.8882 |
| 1. PBF | A5VIA9 | 50S ribosomal protein L10 | 0.00e+00 | 7.79e-29 | 1.25e-29 | 0.9117 |
| 1. PBF | Q1LSX9 | 50S ribosomal protein L10 | 0.00e+00 | 8.40e-34 | 1.15e-15 | 0.7844 |
| 1. PBF | Q6FF92 | 50S ribosomal protein L10 | 0.00e+00 | 1.22e-33 | 7.28e-20 | 0.8732 |
| 1. PBF | Q6F0L3 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-58 | 2.02e-89 | 0.9219 |
| 1. PBF | Q1Q8P7 | 50S ribosomal protein L10 | 0.00e+00 | 1.86e-26 | 6.30e-15 | 0.8755 |
| 1. PBF | B3DPX3 | 50S ribosomal protein L10 | 0.00e+00 | 5.00e-26 | 1.22e-17 | 0.8021 |
| 1. PBF | Q62GJ5 | 50S ribosomal protein L10 | 0.00e+00 | 1.12e-32 | 4.23e-26 | 0.8849 |
| 1. PBF | A2C032 | 50S ribosomal protein L10 | 0.00e+00 | 2.32e-31 | 1.51e-13 | 0.8081 |
| 1. PBF | A3N318 | 50S ribosomal protein L10 | 0.00e+00 | 1.79e-29 | 3.22e-17 | 0.7997 |
| 1. PBF | Q30X08 | 50S ribosomal protein L10 | 0.00e+00 | 2.76e-27 | 1.79e-09 | 0.7977 |
| 1. PBF | B5QYD6 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8326 |
| 1. PBF | B4R8K3 | 50S ribosomal protein L10 | 0.00e+00 | 1.17e-29 | 1.36e-12 | 0.824 |
| 1. PBF | A7WYW2 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.9307 |
| 1. PBF | B0S064 | 50S ribosomal protein L10 | 0.00e+00 | 6.79e-20 | 3.85e-24 | 0.9722 |
| 1. PBF | B3GYU6 | 50S ribosomal protein L10 | 0.00e+00 | 1.79e-29 | 3.22e-17 | 0.8049 |
| 1. PBF | A5IJW5 | 50S ribosomal protein L10 | 4.33e-15 | 1.72e-24 | 1.59e-11 | 0.74 |
| 1. PBF | B5FQJ7 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8341 |
| 1. PBF | B3QQS4 | 50S ribosomal protein L10 | 0.00e+00 | 1.78e-25 | 4.43e-14 | 0.8306 |
| 1. PBF | Q39Y15 | 50S ribosomal protein L10 | 0.00e+00 | 2.18e-28 | 2.80e-15 | 0.9187 |
| 1. PBF | Q63Q01 | 50S ribosomal protein L10 | 0.00e+00 | 1.12e-32 | 4.23e-26 | 0.8904 |
| 1. PBF | A8FKR1 | 50S ribosomal protein L10 | 0.00e+00 | 1.25e-34 | 5.87e-19 | 0.8362 |
| 1. PBF | Q7NK77 | 50S ribosomal protein L10 | 2.36e-14 | 1.18e-12 | 4.02e-12 | 0.7369 |
| 1. PBF | Q1CN80 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.11e-16 | 0.8351 |
| 1. PBF | A4T1N5 | 50S ribosomal protein L10 | 0.00e+00 | 2.38e-16 | 1.71e-13 | 0.7698 |
| 1. PBF | Q3ILQ2 | 50S ribosomal protein L10 | 0.00e+00 | 3.39e-24 | 5.42e-13 | 0.8016 |
| 1. PBF | A8YTF1 | 50S ribosomal protein L10 | 0.00e+00 | 7.83e-35 | 1.17e-19 | 0.8781 |
| 1. PBF | B1JJJ6 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.11e-16 | 0.8369 |
| 1. PBF | Q1GK51 | 50S ribosomal protein L10 | 0.00e+00 | 1.90e-18 | 7.75e-17 | 0.8023 |
| 1. PBF | Q1MPU2 | 50S ribosomal protein L10 | 0.00e+00 | 5.77e-25 | 1.42e-08 | 0.8547 |
| 1. PBF | B0SSI6 | 50S ribosomal protein L10 | 0.00e+00 | 5.96e-25 | 9.68e-15 | 0.8607 |
| 1. PBF | B6ENR5 | 50S ribosomal protein L10 | 0.00e+00 | 1.83e-25 | 7.52e-15 | 0.7941 |
| 1. PBF | B3QC02 | 50S ribosomal protein L10 | 0.00e+00 | 2.20e-23 | 5.67e-11 | 0.9218 |
| 1. PBF | Q49V49 | 50S ribosomal protein L10 | 0.00e+00 | 7.60e-31 | 2.30e-29 | 0.9217 |
| 1. PBF | C6DHR3 | 50S ribosomal protein L10 | 0.00e+00 | 1.22e-27 | 1.05e-14 | 0.836 |
| 1. PBF | C1CEU4 | 50S ribosomal protein L10 | 0.00e+00 | 7.08e-38 | 1.10e-28 | 0.8966 |
| 1. PBF | Q89B18 | 50S ribosomal protein L10 | 0.00e+00 | 4.48e-30 | 1.14e-10 | 0.8165 |
| 1. PBF | C3P9P4 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9352 |
| 1. PBF | Q9ZE22 | 50S ribosomal protein L10 | 0.00e+00 | 3.74e-29 | 1.21e-16 | 0.8842 |
| 1. PBF | Q81J51 | 50S ribosomal protein L10 | 0.00e+00 | 6.70e-33 | 1.15e-36 | 0.9124 |
| 1. PBF | Q0BKC2 | 50S ribosomal protein L10 | 0.00e+00 | 3.49e-29 | 5.75e-15 | 0.8903 |
| 1. PBF | O67760 | 50S ribosomal protein L10 | 0.00e+00 | 4.57e-25 | 1.06e-06 | 0.8598 |
| 1. PBF | A5UE96 | 50S ribosomal protein L10 | 0.00e+00 | 1.37e-29 | 4.48e-17 | 0.8085 |
| 1. PBF | B6J5C0 | 50S ribosomal protein L10 | 0.00e+00 | 2.66e-28 | 1.63e-20 | 0.8774 |
| 1. PBF | Q035V5 | 50S ribosomal protein L10 | 0.00e+00 | 1.05e-31 | 2.65e-25 | 0.9225 |
| 1. PBF | Q2S1Q3 | 50S ribosomal protein L10 | 0.00e+00 | 1.41e-21 | 8.45e-08 | 0.8028 |
| 1. PBF | Q31CX9 | 50S ribosomal protein L10 | 0.00e+00 | 6.86e-31 | 6.09e-19 | 0.8078 |
| 1. PBF | Q8DM26 | 50S ribosomal protein L10 | 1.14e-12 | 2.51e-27 | 2.38e-15 | 0.7615 |
| 1. PBF | A6QEJ1 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.9197 |
| 1. PBF | A5GAX9 | 50S ribosomal protein L10 | 0.00e+00 | 2.15e-29 | 1.58e-17 | 0.8701 |
| 1. PBF | B8DF05 | 50S ribosomal protein L10 | 0.00e+00 | 6.22e-36 | 9.98e-32 | 0.8927 |
| 1. PBF | B8GV67 | 50S ribosomal protein L10 | 0.00e+00 | 4.08e-27 | 1.39e-17 | 0.9124 |
| 1. PBF | Q160X5 | 50S ribosomal protein L10 | 0.00e+00 | 1.60e-20 | 9.97e-18 | 0.8599 |
| 1. PBF | A6X0A7 | 50S ribosomal protein L10 | 0.00e+00 | 1.15e-21 | 1.65e-14 | 0.8994 |
| 1. PBF | B4S495 | 50S ribosomal protein L10 | 0.00e+00 | 5.85e-28 | 2.33e-14 | 0.8453 |
| 1. PBF | Q5P341 | 50S ribosomal protein L10 | 0.00e+00 | 1.91e-28 | 3.05e-27 | 0.9269 |
| 1. PBF | Q5WLS3 | 50S ribosomal protein L10 | 0.00e+00 | 7.87e-37 | 2.20e-31 | 0.9099 |
| 1. PBF | Q8G067 | 50S ribosomal protein L10 | 0.00e+00 | 4.79e-22 | 3.35e-15 | 0.9072 |
| 1. PBF | A8GQW2 | 50S ribosomal protein L10 | 0.00e+00 | 4.64e-25 | 2.27e-13 | 0.846 |
| 1. PBF | Q31QK5 | 50S ribosomal protein L10 | 0.00e+00 | 6.95e-30 | 2.48e-14 | 0.8003 |
| 1. PBF | Q8R7U4 | 50S ribosomal protein L10 | 0.00e+00 | 4.62e-26 | 1.11e-21 | 0.841 |
| 1. PBF | A1WVD1 | 50S ribosomal protein L10 | 0.00e+00 | 4.74e-21 | 1.68e-16 | 0.9028 |
| 1. PBF | P68900 | 50S ribosomal protein L10 | 0.00e+00 | 1.57e-38 | 5.77e-27 | 0.8825 |
| 1. PBF | P41191 | 50S ribosomal protein L10 | 0.00e+00 | 1.40e-25 | 5.51e-12 | 0.9267 |
| 1. PBF | Q7NBW4 | 50S ribosomal protein L10 | 0.00e+00 | 9.53e-41 | 1.09e-17 | 0.8761 |
| 1. PBF | Q3B1H5 | 50S ribosomal protein L10 | 0.00e+00 | 2.93e-30 | 8.76e-16 | 0.8319 |
| 1. PBF | C3PKM7 | 50S ribosomal protein L10 | 0.00e+00 | 7.67e-24 | 2.87e-13 | 0.8332 |
| 1. PBF | Q5XCB5 | 50S ribosomal protein L10 | 0.00e+00 | 7.63e-38 | 1.05e-26 | 0.8755 |
| 1. PBF | A2RKI8 | 50S ribosomal protein L10 | 0.00e+00 | 5.43e-40 | 2.94e-30 | 0.914 |
| 1. PBF | B3QZG8 | 50S ribosomal protein L10 | 0.00e+00 | 2.61e-38 | 1.66e-25 | 0.9322 |
| 1. PBF | B8D6V2 | 50S ribosomal protein L10 | 0.00e+00 | 1.53e-34 | 9.16e-05 | 0.8101 |
| 1. PBF | Q9CBK7 | 50S ribosomal protein L10 | 0.00e+00 | 6.44e-22 | 8.80e-18 | 0.8102 |
| 1. PBF | B5ELX0 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.36e-21 | 0.843 |
| 1. PBF | Q7VJ80 | 50S ribosomal protein L10 | 0.00e+00 | 1.74e-33 | 1.96e-16 | 0.9016 |
| 1. PBF | A7HCH9 | 50S ribosomal protein L10 | 0.00e+00 | 4.36e-25 | 2.85e-16 | 0.8886 |
| 1. PBF | B8ZKK4 | 50S ribosomal protein L10 | 0.00e+00 | 7.08e-38 | 1.10e-28 | 0.8957 |
| 1. PBF | A8F0P5 | 50S ribosomal protein L10 | 0.00e+00 | 4.47e-21 | 3.92e-16 | 0.9172 |
| 1. PBF | Q2JM49 | 50S ribosomal protein L10 | 6.66e-16 | 1.37e-21 | 2.38e-16 | 0.7922 |
| 1. PBF | Q07KK5 | 50S ribosomal protein L10 | 0.00e+00 | 7.07e-27 | 2.98e-11 | 0.9404 |
| 1. PBF | P29343 | 50S ribosomal protein L10 | 0.00e+00 | 4.93e-22 | 5.31e-15 | 0.8117 |
| 1. PBF | B9DKX2 | 50S ribosomal protein L10 | 0.00e+00 | 1.75e-36 | 1.42e-32 | 0.9216 |
| 1. PBF | Q5PK95 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8321 |
| 1. PBF | A0K3L5 | 50S ribosomal protein L10 | 0.00e+00 | 3.25e-33 | 1.48e-28 | 0.8836 |
| 1. PBF | C3LJ71 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9325 |
| 1. PBF | Q2YB07 | 50S ribosomal protein L10 | 0.00e+00 | 1.61e-24 | 2.65e-21 | 0.8525 |
| 1. PBF | Q492B7 | 50S ribosomal protein L10 | 0.00e+00 | 1.35e-32 | 3.72e-13 | 0.8721 |
| 1. PBF | Q3ATP7 | 50S ribosomal protein L10 | 0.00e+00 | 8.19e-29 | 5.10e-18 | 0.815 |
| 1. PBF | A5VC07 | 50S ribosomal protein L10 | 0.00e+00 | 7.91e-24 | 1.96e-12 | 0.9293 |
| 1. PBF | B0UUZ6 | 50S ribosomal protein L10 | 0.00e+00 | 8.46e-29 | 3.78e-17 | 0.8069 |
| 1. PBF | Q8EK76 | 50S ribosomal protein L10 | 0.00e+00 | 3.59e-30 | 1.24e-15 | 0.8291 |
| 1. PBF | P0DD98 | 50S ribosomal protein L10 | 0.00e+00 | 7.63e-38 | 1.05e-26 | 0.8814 |
| 1. PBF | B8EMR9 | 50S ribosomal protein L10 | 0.00e+00 | 2.04e-23 | 7.46e-04 | 0.8799 |
| 1. PBF | P58060 | 50S ribosomal protein L10 | 0.00e+00 | 2.41e-28 | 1.10e-16 | 0.89 |
| 1. PBF | Q7MGR6 | 50S ribosomal protein L10 | 0.00e+00 | 1.74e-26 | 1.76e-13 | 0.813 |
| 1. PBF | Q3ZXX9 | 50S ribosomal protein L10 | 0.00e+00 | 9.89e-28 | 3.84e-08 | 0.8869 |
| 1. PBF | Q28UX9 | 50S ribosomal protein L10 | 0.00e+00 | 3.52e-23 | 2.18e-12 | 0.8632 |
| 1. PBF | Q727C9 | 50S ribosomal protein L10 | 0.00e+00 | 1.04e-27 | 1.97e-08 | 0.8421 |
| 1. PBF | B9IZI3 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9372 |
| 1. PBF | B5RLV1 | 50S ribosomal protein L10 | 0.00e+00 | 9.83e-37 | 3.12e-09 | 0.8989 |
| 1. PBF | B2K110 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.11e-16 | 0.8368 |
| 1. PBF | B0BBU8 | 50S ribosomal protein L10 | 0.00e+00 | 1.20e-24 | 4.29e-06 | 0.9243 |
| 1. PBF | B9DU77 | 50S ribosomal protein L10 | 0.00e+00 | 3.52e-36 | 6.81e-30 | 0.8742 |
| 1. PBF | Q83FL0 | 50S ribosomal protein L10 | 0.00e+00 | 3.44e-21 | 4.22e-12 | 0.8346 |
| 1. PBF | Q1R0I4 | 50S ribosomal protein L10 | 0.00e+00 | 1.35e-27 | 5.19e-15 | 0.8392 |
| 1. PBF | A2REM5 | 50S ribosomal protein L10 | 0.00e+00 | 7.63e-38 | 1.05e-26 | 0.8845 |
| 1. PBF | A4IW97 | 50S ribosomal protein L10 | 0.00e+00 | 5.58e-30 | 5.69e-15 | 0.8677 |
| 1. PBF | Q8DZ20 | 50S ribosomal protein L10 | 0.00e+00 | 6.66e-37 | 2.44e-29 | 0.8981 |
| 1. PBF | B1MH70 | 50S ribosomal protein L10 | 0.00e+00 | 1.88e-17 | 3.89e-14 | 0.8049 |
| 1. PBF | B0VLZ8 | 50S ribosomal protein L10 | 0.00e+00 | 5.35e-35 | 8.86e-19 | 0.8972 |
| 1. PBF | A9BF35 | 50S ribosomal protein L10 | 0.00e+00 | 1.17e-24 | 2.94e-11 | 0.7954 |
| 1. PBF | Q0ABI4 | 50S ribosomal protein L10 | 0.00e+00 | 7.44e-24 | 2.62e-16 | 0.8724 |
| 1. PBF | Q97EG7 | 50S ribosomal protein L10 | 0.00e+00 | 3.93e-35 | 5.72e-18 | 0.9458 |
| 1. PBF | B1XJH0 | 50S ribosomal protein L10 | 0.00e+00 | 1.93e-27 | 3.98e-14 | 0.7946 |
| 1. PBF | B3CV57 | 50S ribosomal protein L10 | 1.14e-13 | 8.72e-27 | 1.50e-07 | 0.792 |
| 1. PBF | C1AYX3 | 50S ribosomal protein L10 | 1.11e-16 | 2.74e-13 | 2.77e-18 | 0.8285 |
| 1. PBF | A2CDE9 | 50S ribosomal protein L10 | 0.00e+00 | 1.21e-30 | 9.70e-15 | 0.8243 |
| 1. PBF | B9E8Q8 | 50S ribosomal protein L10 | 0.00e+00 | 5.48e-31 | 4.60e-35 | 0.896 |
| 1. PBF | C1CR00 | 50S ribosomal protein L10 | 0.00e+00 | 7.08e-38 | 1.10e-28 | 0.9022 |
| 1. PBF | Q9ZK22 | 50S ribosomal protein L10 | 0.00e+00 | 1.62e-36 | 1.34e-22 | 0.885 |
| 1. PBF | C5CGE1 | 50S ribosomal protein L10 | 0.00e+00 | 1.06e-23 | 9.88e-09 | 0.8363 |
| 1. PBF | Q4A967 | 50S ribosomal protein L10 | 0.00e+00 | 8.05e-29 | 1.32e-25 | 0.9203 |
| 1. PBF | Q67JT1 | 50S ribosomal protein L10 | 0.00e+00 | 1.62e-25 | 5.55e-25 | 0.8198 |
| 1. PBF | B4T0Y7 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8355 |
| 1. PBF | Q4ZMN5 | 50S ribosomal protein L10 | 0.00e+00 | 2.49e-23 | 3.09e-15 | 0.8859 |
| 1. PBF | B1ZGR8 | 50S ribosomal protein L10 | 0.00e+00 | 8.72e-26 | 1.67e-14 | 0.9113 |
| 1. PBF | B1W444 | 50S ribosomal protein L10 | 1.11e-16 | 6.31e-14 | 2.15e-16 | 0.8227 |
| 1. PBF | A5U036 | 50S ribosomal protein L10 | 0.00e+00 | 1.36e-15 | 1.45e-17 | 0.8104 |
| 1. PBF | A7HWQ2 | 50S ribosomal protein L10 | 0.00e+00 | 5.55e-22 | 7.28e-11 | 0.8767 |
| 1. PBF | Q3J8Q5 | 50S ribosomal protein L10 | 0.00e+00 | 3.25e-32 | 3.68e-16 | 0.7516 |
| 1. PBF | A6W3A1 | 50S ribosomal protein L10 | 0.00e+00 | 4.35e-28 | 1.19e-15 | 0.8727 |
| 1. PBF | B8EBL4 | 50S ribosomal protein L10 | 0.00e+00 | 3.08e-30 | 6.74e-14 | 0.8281 |
| 1. PBF | Q5HID6 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.9342 |
| 1. PBF | A1WCN1 | 50S ribosomal protein L10 | 0.00e+00 | 1.70e-32 | 8.85e-22 | 0.8826 |
| 1. PBF | B7ICR5 | 50S ribosomal protein L10 | 1.11e-16 | 1.70e-25 | 1.37e-08 | 0.8205 |
| 1. PBF | Q48D27 | 50S ribosomal protein L10 | 0.00e+00 | 2.49e-23 | 3.09e-15 | 0.8862 |
| 1. PBF | Q8F0S0 | 50S ribosomal protein L10 | 0.00e+00 | 2.90e-25 | 1.62e-18 | 0.8454 |
| 1. PBF | Q7MA58 | 50S ribosomal protein L10 | 0.00e+00 | 1.22e-38 | 2.07e-18 | 0.8777 |
| 1. PBF | Q03LT2 | 50S ribosomal protein L10 | 0.00e+00 | 4.81e-36 | 1.17e-30 | 0.8962 |
| 1. PBF | A7ZCN5 | 50S ribosomal protein L10 | 0.00e+00 | 4.55e-35 | 5.04e-16 | 0.8376 |
| 1. PBF | Q9PI33 | 50S ribosomal protein L10 | 0.00e+00 | 1.61e-34 | 1.20e-18 | 0.8456 |
| 1. PBF | Q1AU20 | 50S ribosomal protein L10 | 0.00e+00 | 2.97e-21 | 4.05e-20 | 0.8767 |
| 1. PBF | B9KBJ7 | 50S ribosomal protein L10 | 1.89e-15 | 3.36e-27 | 5.09e-13 | 0.7725 |
| 1. PBF | C3PMH5 | 50S ribosomal protein L10 | 0.00e+00 | 1.23e-21 | 5.57e-17 | 0.9275 |
| 1. PBF | Q15YB3 | 50S ribosomal protein L10 | 0.00e+00 | 3.33e-31 | 8.91e-19 | 0.8894 |
| 1. PBF | Q3KM45 | 50S ribosomal protein L10 | 0.00e+00 | 2.99e-25 | 5.30e-06 | 0.9181 |
| 1. PBF | A9N0J1 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.8329 |
| 1. PBF | Q7WRE1 | 50S ribosomal protein L10 | 0.00e+00 | 1.18e-24 | 2.05e-21 | 0.857 |
| 1. PBF | Q0VSM4 | 50S ribosomal protein L10 | 0.00e+00 | 2.15e-26 | 9.89e-17 | 0.9107 |
| 1. PBF | C0ZV33 | 50S ribosomal protein L10 | 1.11e-16 | 3.47e-09 | 1.34e-17 | 0.8031 |
| 1. PBF | Q8KG17 | 50S ribosomal protein L10 | 0.00e+00 | 1.15e-27 | 2.00e-15 | 0.8511 |
| 1. PBF | Q748Y4 | 50S ribosomal protein L10 | 0.00e+00 | 1.89e-26 | 2.64e-14 | 0.9237 |
| 1. PBF | Q1BDF3 | 50S ribosomal protein L10 | 0.00e+00 | 1.63e-19 | 2.45e-14 | 0.8227 |
| 1. PBF | B7KIR6 | 50S ribosomal protein L10 | 6.18e-12 | 1.95e-24 | 1.24e-10 | 0.726 |
| 1. PBF | P9WHE6 | 50S ribosomal protein L10 | 0.00e+00 | 1.36e-15 | 1.45e-17 | 0.8136 |
| 1. PBF | Q6MDM3 | 50S ribosomal protein L10 | 0.00e+00 | 3.90e-15 | 1.39e-12 | 0.9237 |
| 1. PBF | B5ZAI3 | 50S ribosomal protein L10 | 0.00e+00 | 1.89e-38 | 8.34e-22 | 0.8469 |
| 1. PBF | B8ZSD0 | 50S ribosomal protein L10 | 0.00e+00 | 6.44e-22 | 8.80e-18 | 0.8094 |
| 1. PBF | Q9XDM0 | 50S ribosomal protein L10 | 1.11e-16 | 2.85e-25 | 7.27e-07 | 0.8251 |
| 1. PBF | B8GZW1 | 50S ribosomal protein L10 | 0.00e+00 | 2.41e-28 | 1.10e-16 | 0.8514 |
| 1. PBF | Q2N5R4 | 50S ribosomal protein L10 | 0.00e+00 | 1.49e-24 | 3.20e-06 | 0.875 |
| 1. PBF | Q83ET2 | 50S ribosomal protein L10 | 0.00e+00 | 2.66e-28 | 1.63e-20 | 0.8767 |
| 1. PBF | P36257 | 50S ribosomal protein L10 | 1.11e-16 | 6.31e-14 | 2.15e-16 | 0.8279 |
| 1. PBF | B2UUW2 | 50S ribosomal protein L10 | 0.00e+00 | 1.83e-35 | 1.21e-20 | 0.874 |
| 1. PBF | B5ZYS5 | 50S ribosomal protein L10 | 0.00e+00 | 1.14e-25 | 1.57e-10 | 0.9484 |
| 1. PBF | C1ET28 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9477 |
| 1. PBF | B7I358 | 50S ribosomal protein L10 | 0.00e+00 | 5.35e-35 | 8.86e-19 | 0.9154 |
| 1. PBF | B2S094 | 50S ribosomal protein L10 | 0.00e+00 | 1.17e-34 | 2.71e-13 | 0.8626 |
| 1. PBF | B3WA02 | 50S ribosomal protein L10 | 0.00e+00 | 1.05e-31 | 2.65e-25 | 0.8977 |
| 1. PBF | B2S2I6 | 50S ribosomal protein L10 | 0.00e+00 | 8.97e-28 | 5.55e-08 | 0.89 |
| 1. PBF | A0RQI7 | 50S ribosomal protein L10 | 0.00e+00 | 2.82e-33 | 2.55e-15 | 0.8725 |
| 1. PBF | B1X074 | 50S ribosomal protein L10 | 1.33e-15 | 4.87e-17 | 6.16e-11 | 0.7327 |
| 1. PBF | B0VDG4 | 50S ribosomal protein L10 | 0.00e+00 | 5.35e-35 | 8.86e-19 | 0.8801 |
| 1. PBF | Q04E44 | 50S ribosomal protein L10 | 0.00e+00 | 5.32e-08 | 2.51e-24 | 0.9543 |
| 1. PBF | Q5M5F2 | 50S ribosomal protein L10 | 0.00e+00 | 4.81e-36 | 1.17e-30 | 0.8986 |
| 1. PBF | Q47JB2 | 50S ribosomal protein L10 | 0.00e+00 | 1.12e-33 | 3.34e-26 | 0.9225 |
| 1. PBF | Q5ZYQ2 | 50S ribosomal protein L10 | 0.00e+00 | 2.29e-19 | 7.15e-13 | 0.9041 |
| 1. PBF | B2GAC5 | 50S ribosomal protein L10 | 0.00e+00 | 1.11e-27 | 2.37e-29 | 0.9391 |
| 1. PBF | A1QZH9 | 50S ribosomal protein L10 | 0.00e+00 | 2.57e-36 | 1.03e-11 | 0.8824 |
| 1. PBF | Q2JTQ3 | 50S ribosomal protein L10 | 3.33e-16 | 9.68e-20 | 2.62e-16 | 0.789 |
| 1. PBF | A8F972 | 50S ribosomal protein L10 | 0.00e+00 | 1.16e-32 | 1.04e-34 | 0.905 |
| 1. PBF | Q2A1M5 | 50S ribosomal protein L10 | 0.00e+00 | 3.49e-29 | 5.75e-15 | 0.8783 |
| 1. PBF | B1HMZ9 | 50S ribosomal protein L10 | 0.00e+00 | 3.62e-34 | 4.09e-34 | 0.9279 |
| 1. PBF | A7ZUJ8 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8505 |
| 1. PBF | A6Q6I0 | 50S ribosomal protein L10 | 0.00e+00 | 1.18e-28 | 5.13e-11 | 0.823 |
| 1. PBF | C5CC73 | 50S ribosomal protein L10 | 0.00e+00 | 1.18e-22 | 2.65e-16 | 0.7778 |
| 1. PBF | B2UEN8 | 50S ribosomal protein L10 | 0.00e+00 | 4.47e-26 | 1.01e-27 | 0.9312 |
| 1. PBF | C1DAQ8 | 50S ribosomal protein L10 | 0.00e+00 | 5.29e-27 | 6.18e-26 | 0.9245 |
| 1. PBF | A8GMA5 | 50S ribosomal protein L10 | 0.00e+00 | 4.24e-20 | 1.06e-15 | 0.9457 |
| 1. PBF | P48953 | 50S ribosomal protein L10 | 2.22e-16 | 2.40e-13 | 5.66e-14 | 0.8232 |
| 1. PBF | A7GZK1 | 50S ribosomal protein L10 | 0.00e+00 | 2.28e-35 | 3.03e-14 | 0.8206 |
| 1. PBF | A9R0H6 | 50S ribosomal protein L10 | 0.00e+00 | 1.67e-28 | 6.11e-16 | 0.8356 |
| 1. PBF | Q1BRT8 | 50S ribosomal protein L10 | 0.00e+00 | 3.25e-33 | 1.48e-28 | 0.8898 |
| 1. PBF | B7JKA7 | 50S ribosomal protein L10 | 0.00e+00 | 3.00e-31 | 1.31e-36 | 0.9544 |
| 1. PBF | Q74L09 | 50S ribosomal protein L10 | 0.00e+00 | 4.59e-38 | 9.50e-21 | 0.8665 |
| 1. PBF | A1TVT2 | 50S ribosomal protein L10 | 0.00e+00 | 4.01e-32 | 8.12e-22 | 0.877 |
| 1. PBF | B3E7S6 | 50S ribosomal protein L10 | 0.00e+00 | 4.40e-26 | 1.93e-16 | 0.9116 |
| 1. PBF | Q6NJG6 | 50S ribosomal protein L10 | 0.00e+00 | 8.94e-24 | 2.03e-16 | 0.8203 |
| 1. PBF | Q2LQ89 | 50S ribosomal protein L10 | 0.00e+00 | 1.15e-21 | 2.51e-14 | 0.8577 |
| 1. PBF | B0KK58 | 50S ribosomal protein L10 | 0.00e+00 | 1.33e-27 | 5.64e-13 | 0.8851 |
| 1. PBF | Q03ZH4 | 50S ribosomal protein L10 | 0.00e+00 | 3.19e-20 | 4.70e-24 | 0.9141 |
| 1. PBF | A8EVZ6 | 50S ribosomal protein L10 | 0.00e+00 | 6.79e-37 | 3.86e-21 | 0.8529 |
| 1. PBF | Q4JT29 | 50S ribosomal protein L10 | 0.00e+00 | 1.15e-26 | 1.27e-14 | 0.7834 |
| 1. PBF | Q5WZM1 | 50S ribosomal protein L10 | 0.00e+00 | 2.29e-19 | 7.15e-13 | 0.7467 |
| 1. PBF | Q6MJ05 | 50S ribosomal protein L10 | 0.00e+00 | 3.29e-24 | 9.87e-14 | 0.8555 |
| 1. PBF | B4TCS2 | 50S ribosomal protein L10 | 0.00e+00 | 1.09e-25 | 9.45e-14 | 0.833 |
| 1. PBF | Q5QWA7 | 50S ribosomal protein L10 | 0.00e+00 | 3.46e-28 | 2.15e-14 | 0.8587 |
| 1. PBF | A5D5H8 | 50S ribosomal protein L10 | 0.00e+00 | 9.26e-30 | 6.60e-18 | 0.8214 |
| 1. PBF | Q5ZZR9 | 50S ribosomal protein L10 | 0.00e+00 | 8.05e-29 | 1.32e-25 | 0.9287 |
| 1. PBF | Q3YUZ9 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8529 |
| 1. PBF | A7NEC2 | 50S ribosomal protein L10 | 0.00e+00 | 3.49e-29 | 5.75e-15 | 0.8769 |
| 1. PBF | Q2FJA1 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | 0.9323 |
| 1. PBF | B8FEU3 | 50S ribosomal protein L10 | 0.00e+00 | 6.77e-26 | 2.46e-10 | 0.798 |
| 1. PBF | B9JVM6 | 50S ribosomal protein L10 | 0.00e+00 | 2.91e-24 | 2.05e-11 | 0.9467 |
| 1. PBF | A7MQP7 | 50S ribosomal protein L10 | 0.00e+00 | 2.11e-28 | 4.11e-15 | 0.8379 |
| 1. PBF | Q089R3 | 50S ribosomal protein L10 | 0.00e+00 | 9.99e-29 | 2.53e-15 | 0.8281 |
| 1. PBF | P44350 | 50S ribosomal protein L10 | 0.00e+00 | 7.66e-29 | 3.23e-16 | 0.8077 |
| 1. PBF | A6VKC7 | 50S ribosomal protein L10 | 0.00e+00 | 1.54e-28 | 2.74e-19 | 0.8083 |
| 1. PBF | A1AIF7 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | 0.8587 |
| 1. PBF | Q8FSA1 | 50S ribosomal protein L10 | 0.00e+00 | 2.21e-22 | 3.48e-13 | 0.8288 |
| 1. PBF | B1LY45 | 50S ribosomal protein L10 | 0.00e+00 | 2.10e-24 | 3.02e-15 | 0.9345 |
| 1. PBF | B5XLE2 | 50S ribosomal protein L10 | 0.00e+00 | 7.63e-38 | 1.05e-26 | 0.8799 |
| 2. PF | Q6FJ04 | Ribosome assembly factor mrt4 | 1.61e-04 | 1.72e-02 | NA | 0.6974 |
| 2. PF | B3ETZ2 | 50S ribosomal protein L10 | 9.21e-15 | 3.67e-16 | NA | 0.7065 |
| 2. PF | A0M3Z1 | 50S ribosomal protein L10 | 8.88e-16 | 3.85e-19 | NA | 0.7887 |
| 2. PF | A5FIJ1 | 50S ribosomal protein L10 | 0.00e+00 | 1.21e-22 | NA | 0.7592 |
| 2. PF | Q75DK9 | Ribosome assembly factor mrt4 | 1.86e-04 | 2.95e-04 | NA | 0.6825 |
| 3. BF | P96039 | 50S ribosomal protein L10 | 4.83e-04 | NA | 0.023 | 0.5713 |
| 3. BF | C4KIJ9 | 50S ribosomal protein L10 | 4.69e-04 | NA | 0.050 | 0.5724 |
| 3. BF | Q29NV5 | 39S ribosomal protein L10, mitochondrial | 4.91e-13 | NA | 0.017 | 0.7569 |
| 3. BF | Q971J2 | 50S ribosomal protein L10 | 3.60e-04 | NA | 0.003 | 0.6213 |
| 3. BF | P41192 | 50S ribosomal protein L10 (Fragment) | 2.11e-10 | NA | 0.008 | 0.9151 |
| 3. BF | C3NG93 | 50S ribosomal protein L10 | 4.78e-04 | NA | 0.037 | 0.5688 |
| 3. BF | C3MR85 | 50S ribosomal protein L10 | 4.85e-04 | NA | 0.037 | 0.5729 |
| 3. BF | C3N7E1 | 50S ribosomal protein L10 | 4.92e-04 | NA | 0.037 | 0.5796 |
| 3. BF | P82139 | 50S ribosomal protein L10, chloroplastic | 1.21e-13 | NA | 2.86e-08 | 0.7202 |
| 3. BF | C3MXH4 | 50S ribosomal protein L10 | 4.99e-04 | NA | 0.050 | 0.5618 |
| 3. BF | O80362 | 50S ribosomal protein L10, chloroplastic | 2.69e-13 | NA | 5.77e-09 | 0.7174 |
| 3. BF | P35023 | 50S ribosomal protein L10 | 3.42e-04 | NA | 0.015 | 0.6156 |
| 4. PB | Q2G0N9 | 50S ribosomal protein L10 | 0.00e+00 | 1.81e-33 | 3.10e-32 | NA |
| 4. PB | Q9FY50 | 50S ribosomal protein L10, chloroplastic | 1.48e-13 | 1.78e-02 | 9.60e-07 | NA |
| 4. PB | P0A7J3 | 50S ribosomal protein L10 | 0.00e+00 | 2.25e-26 | 3.90e-15 | NA |
| 4. PB | P9WHE7 | 50S ribosomal protein L10 | 0.00e+00 | 1.36e-15 | 1.45e-17 | NA |
| 4. PB | Q9L5W5 | 50S ribosomal protein L10 | NA | 2.30e-23 | 3.51e-09 | NA |
| 4. PB | B5E5F1 | 50S ribosomal protein L10 | NA | 5.04e-37 | 1.05e-28 | NA |
| 5. P | Q23885 | Uncharacterized mitochondrial protein 21 | 4.75e-09 | 5.17e-18 | NA | NA |
| 5. P | Q86HD3 | Ribosome assembly factor mrt4 | 3.84e-04 | 6.80e-03 | NA | NA |
| 5. P | P36521 | 54S ribosomal protein L11, mitochondrial | 1.32e-09 | 5.73e-04 | NA | NA |
| 5. P | P33201 | Ribosome assembly factor MRT4 | 2.02e-04 | 4.01e-02 | NA | NA |
| 5. P | Q09724 | 54S ribosomal protein L11, mitochondrial | 1.28e-09 | 1.61e-11 | NA | NA |
| 5. P | P38450 | Uncharacterized mitochondrial protein ymf1 | 3.90e-05 | 2.10e-19 | NA | NA |
| 6. F | Q12UP8 | 50S ribosomal protein L10 | 1.80e-04 | NA | NA | 0.6165 |
| 6. F | Q8TZJ8 | 50S ribosomal protein L10 | 9.61e-05 | NA | NA | 0.5721 |
| 6. F | Q46EU9 | 50S ribosomal protein L10 | 1.37e-04 | NA | NA | 0.6283 |
| 6. F | Q9Y8J3 | 50S ribosomal protein L10 (Fragment) | 1.25e-04 | NA | NA | 0.5945 |
| 6. F | Q29214 | 60S acidic ribosomal protein P0 | 9.92e-05 | NA | NA | 0.5822 |
| 6. F | Q90YX1 | 60S acidic ribosomal protein P0 | 9.68e-05 | NA | NA | 0.579 |
| 6. F | P15826 | 50S ribosomal protein L10 | 1.87e-04 | NA | NA | 0.5895 |
| 6. F | P29764 | 60S acidic ribosomal protein P0 | 1.64e-04 | NA | NA | 0.5749 |
| 6. F | Q94660 | 60S acidic ribosomal protein P0 | 1.41e-04 | NA | NA | 0.5564 |
| 6. F | Q9DG68 | 60S acidic ribosomal protein P0 | 9.22e-05 | NA | NA | 0.5814 |
| 6. F | A8ABQ7 | 50S ribosomal protein L10 | 7.24e-04 | NA | NA | 0.5851 |
| 6. F | Q9UXS5 | 50S ribosomal protein L10 | 1.51e-04 | NA | NA | 0.5737 |
| 6. F | A3DNI2 | 50S ribosomal protein L10 | 1.97e-04 | NA | NA | 0.6308 |
| 6. F | Q9Y9W8 | 50S ribosomal protein L10 | 4.57e-04 | NA | NA | 0.5832 |
| 6. F | Q9U3U0 | 60S acidic ribosomal protein P0 | 1.39e-04 | NA | NA | 0.587 |
| 6. F | A5UKU8 | 50S ribosomal protein L10 | 1.90e-04 | NA | NA | 0.5975 |
| 6. F | C6A1F5 | 50S ribosomal protein L10 | 1.70e-04 | NA | NA | 0.5696 |
| 6. F | C3MZC0 | 50S ribosomal protein L10 | 5.05e-04 | NA | NA | 0.5729 |
| 6. F | A6UTF8 | 50S ribosomal protein L10 | 2.85e-04 | NA | NA | 0.6116 |
| 6. F | G0S616 | Ribosome assembly factor mrt4 | 6.05e-04 | NA | NA | 0.6531 |
| 6. F | P26796 | 60S acidic ribosomal protein P0 | 2.09e-04 | NA | NA | 0.5648 |
| 6. F | Q8TI80 | 50S ribosomal protein L10 | 2.19e-04 | NA | NA | 0.6227 |
| 6. F | B6YSX9 | 50S ribosomal protein L10 | 2.60e-04 | NA | NA | 0.5841 |
| 6. F | P15825 | 50S ribosomal protein L10 | 2.02e-04 | NA | NA | 0.6178 |
| 6. F | P13553 | 50S ribosomal protein L10 | 4.04e-04 | NA | NA | 0.6024 |
| 6. F | A9A838 | 50S ribosomal protein L10 | 2.41e-04 | NA | NA | 0.5935 |
| 6. F | Q97BN3 | 50S ribosomal protein L10 | 4.91e-05 | NA | NA | 0.6245 |
| 6. F | Q8PY51 | 50S ribosomal protein L10 | 2.40e-04 | NA | NA | 0.6239 |
| 6. F | P57692 | 50S ribosomal protein L10 | 1.27e-04 | NA | NA | 0.6188 |
| 6. F | C5A428 | 50S ribosomal protein L10 | 4.58e-04 | NA | NA | 0.5826 |
| 6. F | Q8SRJ7 | 60S acidic ribosomal protein P0 | 7.49e-05 | NA | NA | 0.5699 |
| 6. F | Q6M0L1 | 50S ribosomal protein L10 | 1.94e-04 | NA | NA | 0.6054 |
| 6. F | Q8TX50 | 50S ribosomal protein L10 | 2.46e-04 | NA | NA | 0.626 |
| 6. F | Q3INI7 | 50S ribosomal protein L10 | 2.06e-04 | NA | NA | 0.6041 |
| 6. F | Q9C3Z6 | 60S acidic ribosomal protein P0 | 4.02e-05 | NA | NA | 0.5804 |
| 6. F | P50345 | 60S acidic ribosomal protein P0 | 2.27e-04 | NA | NA | 0.5633 |
| 6. F | Q5JH36 | 50S ribosomal protein L10 | 4.57e-04 | NA | NA | 0.5837 |
| 6. F | Q6L1X8 | 50S ribosomal protein L10 | 1.17e-04 | NA | NA | 0.6236 |
| 6. F | O74109 | 50S ribosomal protein L10 | 1.33e-04 | NA | NA | 0.5742 |
| 6. F | Q8ZTT3 | 50S ribosomal protein L10 | 6.58e-04 | NA | NA | 0.5673 |
| 6. F | Q967Y7 | 60S acidic ribosomal protein P0 | 1.93e-04 | NA | NA | 0.5661 |
| 6. F | P39096 | 60S acidic ribosomal protein P0 | 1.45e-04 | NA | NA | 0.5625 |
| 6. F | P39097 | 60S acidic ribosomal protein P0 | 2.86e-04 | NA | NA | 0.4764 |
| 6. F | Q3MHY7 | 39S ribosomal protein L10, mitochondrial | 2.87e-12 | NA | NA | 0.7691 |
| 6. F | B0R4W1 | 50S ribosomal protein L10 | 3.90e-04 | NA | NA | 0.6151 |
| 6. F | O52705 | 50S ribosomal protein L10 | 3.07e-04 | NA | NA | 0.5868 |
| 6. F | Q95140 | 60S acidic ribosomal protein P0 | 1.04e-04 | NA | NA | 0.5816 |
| 6. F | P47826 | 60S acidic ribosomal protein P0 | 8.27e-05 | NA | NA | 0.5771 |
| 6. F | A4FZS8 | 50S ribosomal protein L10 | 1.90e-04 | NA | NA | 0.5966 |
| 6. F | Q2NEW2 | 50S ribosomal protein L10 | 2.13e-04 | NA | NA | 0.5781 |
| 6. F | O28781 | 50S ribosomal protein L10 | 1.10e-05 | NA | NA | 0.6289 |
| 6. F | P41198 | 50S ribosomal protein L10 | 2.30e-04 | NA | NA | 0.5864 |
| 6. F | A6VIP9 | 50S ribosomal protein L10 | 2.17e-04 | NA | NA | 0.5963 |
| 6. F | Q96TJ5 | 60S acidic ribosomal protein P0 | 5.98e-05 | NA | NA | 0.5928 |
| 6. F | Q7S302 | Ribosome assembly factor mrt4 | 5.07e-04 | NA | NA | 0.6587 |
| 6. F | O27717 | 50S ribosomal protein L10 | 2.18e-04 | NA | NA | 0.6087 |
| 6. F | A4FV84 | mRNA turnover protein 4 homolog | 6.84e-04 | NA | NA | 0.6448 |
| 7. B | Q3TBW2 | 39S ribosomal protein L10, mitochondrial | 1.04e-12 | NA | 0.004 | NA |
| 7. B | Q9VPL3 | 39S ribosomal protein L10, mitochondrial | 6.23e-13 | NA | 0.044 | NA |
| 7. B | P0C2C4 | 39S ribosomal protein L10, mitochondrial | 1.02e-12 | NA | 0.026 | NA |