Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54977.1

JCVISYN3A_0813

UDP-glucose 4-epimerase GalE.
M. mycoides homolog: Q6MS11.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 300
Unique PROST Go: 113
Unique BLAST Go: 16
Unique Foldseek Go: 44

Total Homologs: 1005
Unique PROST Homologs: 311
Unique BLAST Homologs: 8
Unique Foldseek Homologs: 177

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: galE; UDP-glucose 4-epimerase
Zhang et al. [4]: GO:0003978|UDP-glucose 4-epimerase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was P9WN66 (UDP-glucose 4-epimerase) with a FATCAT P-Value: 0 and RMSD of 1.78 angstrom. The sequence alignment identity is 27.9%.
Structural alignment shown in left. Query protein AVX54977.1 colored as red in alignment, homolog P9WN66 colored as blue. Query protein AVX54977.1 is also shown in right top, homolog P9WN66 showed in right bottom. They are colored based on secondary structures.

  AVX54977.1 MNYLLIGGAGYIGSHVAE-IINKTD-NKVIIYDNLSSGSS---DFIEQKS--TFIQGDILDFDKLNDVFSSNKIDVVIYLAGLIKVGESVQKP-LDYYQT 92
      P9WN66 MRALVTGAAGFIGSTLVDRLL--ADGHSVVGLDNFATGRATNLEHLADNSAHVFVEADIVTAD-LHAILEQHRPEVVFHLAAQIDVRRSVADPQFD-AAV 96

  AVX54977.1 NILGLVNTLKIMQIH---NVNYFVFSSS-AAVYGNNSRHNGFFY---EDDPKEPCSPY--GRTKYFGEEIIKDFAIANPNFHYTFLRYFNVAGASKSKRI 183
      P9WN66 NVIG---TVRLAEAARQTGVRKIVHTSSGGSIYGTPPE-----YPTPETAPTDPASPYAAG--KVAG-EI-----YLN-----TF-RH--LYGLDCS--- 169

  AVX54977.1 GYLTQNN-----NKPTH----LIPAISYFAFG-LTDK-FSIFGSDYNTNDGTCIRDYVYVCELAELHL-LTAQKMVKENRNLYYNIGSGKGFS--NLE-I 268
      P9WN66 -HIAPANVYGPRQDP-HGEAGVV-AI--FAQALLSGKPTRVFG------DGTNTRDYVFVDDVVDAFVRVSAD--V--GGGLRFNIGTGKETSDRQLHSA 254

  AVX54977.1 I---------KEFE--RQLG-YK---LDIDIAQRRSG-DPDILVASNTKLCQELNYEIKTNIKDIVESEIAFRKAHLKNK 332
      P9WN66 VAAAVGGPDDPEFHPPR-LGDLKRSCLDIGLAERVLGWRPQIELADGVR---------RT-----VEY---FRHKHTD-- 314

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0009244	lipopolysaccharide core region biosynthetic process
1. PBF	GO:0008207	C21-steroid hormone metabolic process
1. PBF	GO:0003974	UDP-N-acetylglucosamine 4-epimerase activity
1. PBF	GO:0042353	fucose biosynthetic process
1. PBF	GO:0050373	UDP-arabinose 4-epimerase activity
1. PBF	GO:0045226	extracellular polysaccharide biosynthetic process
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0021766	hippocampus development
1. PBF	GO:0019872	streptomycin biosynthetic process
1. PBF	GO:0000271	polysaccharide biosynthetic process
1. PBF	GO:0050573	dTDP-4-dehydro-6-deoxyglucose reductase activity
1. PBF	GO:0009243	O antigen biosynthetic process
1. PBF	GO:0006012	galactose metabolic process
1. PBF	GO:0009103	lipopolysaccharide biosynthetic process
1. PBF	GO:0008460	dTDP-glucose 4,6-dehydratase activity
1. PBF	GO:0103067	4alpha-carboxy-5alpha-cholesta-8-en-3beta-ol:NAD(P)+ 3-dehydrogenase (decarboxylating) activity
1. PBF	GO:0048040	UDP-glucuronate decarboxylase activity
1. PBF	GO:0019305	dTDP-rhamnose biosynthetic process
1. PBF	GO:0005975	carbohydrate metabolic process
1. PBF	GO:0005634	nucleus
1. PBF	GO:0008712	ADP-glyceromanno-heptose 6-epimerase activity
1. PBF	GO:0047024	5alpha-androstane-3beta,17beta-diol dehydrogenase activity
1. PBF	GO:0008446	GDP-mannose 4,6-dehydratase activity
1. PBF	GO:0103066	4alpha-carboxy-4beta-methyl-5alpha-cholesta-8-en-3beta-ol:NAD(P)+ 3-oxidoreductase (decarboxylating) activity
1. PBF	GO:0047012	sterol-4-alpha-carboxylate 3-dehydrogenase (decarboxylating) activity
1. PBF	GO:0004769	steroid delta-isomerase activity
1. PBF	GO:0070404	NADH binding
1. PBF	GO:0033499	galactose catabolic process via UDP-galactose
1. PBF	GO:0019306	GDP-D-rhamnose biosynthetic process
1. PBF	GO:0000252	C-3 sterol dehydrogenase (C-4 sterol decarboxylase) activity
1. PBF	GO:0050388	uronate dehydrogenase activity
1. PBF	GO:0033358	UDP-L-arabinose biosynthetic process
1. PBF	GO:0006694	steroid biosynthetic process
1. PBF	GO:0045232	S-layer organization
1. PBF	GO:0033320	UDP-D-xylose biosynthetic process
1. PBF	GO:0000253	3-keto sterol reductase activity
1. PBF	GO:0050378	UDP-glucuronate 4-epimerase activity
1. PBF	GO:0102175	3-beta-hydroxysteroid dehydrogenase/C4-decarboxylase activity
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0016853	isomerase activity
1. PBF	GO:0051412	response to corticosterone
1. PBF	GO:0017000	antibiotic biosynthetic process
1. PBF	GO:0003824	catalytic activity
1. PBF	GO:0047918	GDP-mannose 3,5-epimerase activity
1. PBF	GO:0102294	cholesterol dehydrogenase activity
1. PBF	GO:0050661	NADP binding
1. PBF	GO:0003978	UDP-glucose 4-epimerase activity
1. PBF	GO:0033705	GDP-4-dehydro-6-deoxy-D-mannose reductase activity
1. PBF	GO:0045227	capsule polysaccharide biosynthetic process
1. PBF	GO:0009225	nucleotide-sugar metabolic process
1. PBF	GO:0097171	ADP-L-glycero-beta-D-manno-heptose biosynthetic process
1. PBF	GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
1. PBF	GO:0003854	3-beta-hydroxy-delta5-steroid dehydrogenase activity
1. PBF	GO:0019673	GDP-mannose metabolic process
1. PBF	GO:0047733	CDP-glucose 4,6-dehydratase activity
1. PBF	GO:0047732	CDP-abequose epimerase activity
2. PF	GO:0019572	L-arabinose catabolic process
2. PF	GO:0016491	oxidoreductase activity
2. PF	GO:0019570	L-arabinose catabolic process to 2-oxoglutarate
2. PF	GO:0016646	oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
2. PF	GO:0048270	methionine adenosyltransferase regulator activity
2. PF	GO:0047787	delta4-3-oxosteroid 5beta-reductase activity
2. PF	GO:0008743	L-threonine 3-dehydrogenase activity
2. PF	GO:0047003	dTDP-6-deoxy-L-talose 4-dehydrogenase activity
2. PF	GO:0009807	lignan biosynthetic process
2. PF	GO:0016628	oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
2. PF	GO:0019518	L-threonine catabolic process to glycine
2. PF	GO:0046507	UDPsulfoquinovose synthase activity
2. PF	GO:0009699	phenylpropanoid biosynthetic process
2. PF	GO:0050577	GDP-L-fucose synthase activity
2. PF	GO:0008831	dTDP-4-dehydrorhamnose reductase activity
2. PF	GO:0031966	mitochondrial membrane
2. PF	GO:0005524	ATP binding
2. PF	GO:0046872	metal ion binding
2. PF	GO:0070401	NADP+ binding
2. PF	GO:0016621	cinnamoyl-CoA reductase activity
2. PF	GO:0006567	threonine catabolic process
2. PF	GO:0047890	flavanone 4-reductase activity
2. PF	GO:0050022	L-arabinose 1-dehydrogenase (NAD+) activity
2. PF	GO:0043693	monoterpene biosynthetic process
2. PF	GO:0044103	L-arabinose 1-dehydrogenase (NADP+) activity
2. PF	GO:0047916	GDP-6-deoxy-D-talose 4-dehydrogenase activity
2. PF	GO:0009813	flavonoid biosynthetic process
2. PF	GO:0048269	methionine adenosyltransferase complex
2. PF	GO:0035837	ergot alkaloid biosynthetic process
2. PF	GO:1901133	kanamycin biosynthetic process
2. PF	GO:0045552	dihydrokaempferol 4-reductase activity
2. PF	GO:0009718	anthocyanin-containing compound biosynthetic process
2. PF	GO:0006556	S-adenosylmethionine biosynthetic process
2. PF	GO:0033729	anthocyanidin reductase activity
2. PF	GO:0042351	'de novo' GDP-L-fucose biosynthetic process
2. PF	GO:0101016	FMN-binding domain binding
3. BF	GO:0099618	UDP-glucuronic acid dehydrogenase activity
3. BF	GO:0009245	lipid A biosynthetic process
3. BF	GO:0016829	lyase activity
3. BF	GO:0099619	UDP-4-amino-4-deoxy-L-arabinose formyltransferase activity
3. BF	GO:0046677	response to antibiotic
3. BF	GO:0004034	aldose 1-epimerase activity
4. PB	GO:0019567	arabinose biosynthetic process
4. PB	GO:0052574	UDP-galactose biosynthetic process
4. PB	GO:0032580	Golgi cisterna membrane
4. PB	GO:0005829	cytosol
4. PB	GO:0009832	plant-type cell wall biogenesis
4. PB	GO:0019388	galactose catabolic process
4. PB	GO:0042546	cell wall biogenesis
4. PB	GO:0006707	cholesterol catabolic process
4. PB	GO:0010490	UDP-4-keto-rhamnose-4-keto-reductase activity
4. PB	GO:0010489	UDP-4-keto-6-deoxy-glucose-3,5-epimerase activity
4. PB	GO:0045171	intercellular bridge
4. PB	GO:0016857	racemase and epimerase activity, acting on carbohydrates and derivatives
4. PB	GO:1900102	negative regulation of endoplasmic reticulum unfolded protein response
4. PB	GO:0015012	heparan sulfate proteoglycan biosynthetic process
4. PB	GO:0061623	glycolytic process from galactose
4. PB	GO:0042732	D-xylose metabolic process
4. PB	GO:0030206	chondroitin sulfate biosynthetic process
4. PB	GO:0009226	nucleotide-sugar biosynthetic process
4. PB	GO:1902494	catalytic complex
4. PB	GO:1903354	regulation of distal tip cell migration
4. PB	GO:0033481	galacturonate biosynthetic process
4. PB	GO:0035754	B cell chemotaxis
4. PB	GO:0010253	UDP-rhamnose biosynthetic process
4. PB	GO:0006702	androgen biosynthetic process
4. PB	GO:0019853	L-ascorbic acid biosynthetic process
4. PB	GO:0047016	cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase activity
4. PB	GO:0000138	Golgi trans cisterna
4. PB	GO:0009242	colanic acid biosynthetic process
4. PB	GO:0070403	NAD+ binding
5. P	GO:1902125	(+)-pinoresinol catabolic process
5. P	GO:0003677	DNA binding
5. P	GO:0001081	nitrogen catabolite repression of transcription from RNA polymerase II promoter
5. P	GO:0032544	plastid translation
5. P	GO:0004090	carbonyl reductase (NADPH) activity
5. P	GO:0035336	long-chain fatty-acyl-CoA metabolic process
5. P	GO:1904906	positive regulation of endothelial cell-matrix adhesion via fibronectin
5. P	GO:0009088	threonine biosynthetic process
5. P	GO:0080019	fatty-acyl-CoA reductase (alcohol-forming) activity
5. P	GO:0006108	malate metabolic process
5. P	GO:1901426	response to furfural
5. P	GO:0010288	response to lead ion
5. P	GO:0071406	cellular response to methylmercury
5. P	GO:0034757	negative regulation of iron ion transport
5. P	GO:1902135	(+)-secoisolariciresinol biosynthetic process
5. P	GO:0043231	intracellular membrane-bounded organelle
5. P	GO:0047526	2'-hydroxyisoflavone reductase activity
5. P	GO:0032981	mitochondrial respiratory chain complex I assembly
5. P	GO:0046983	protein dimerization activity
5. P	GO:0016099	monoterpenoid biosynthetic process
5. P	GO:0042802	identical protein binding
5. P	GO:0043892	methylglyoxal reductase (NADPH-dependent) activity
5. P	GO:0046686	response to cadmium ion
5. P	GO:0042356	GDP-4-dehydro-D-rhamnose reductase activity
5. P	GO:0006721	terpenoid metabolic process
5. P	GO:0005576	extracellular region
5. P	GO:0001913	T cell mediated cytotoxicity
5. P	GO:0042855	eugenol biosynthetic process
5. P	GO:0140041	cellular detoxification of methylglyoxal
5. P	GO:0032442	phenylcoumaran benzylic ether reductase activity
5. P	GO:1902132	(+)-lariciresinol biosynthetic process
5. P	GO:0018970	toluene metabolic process
5. P	GO:0007224	smoothened signaling pathway
5. P	GO:0005811	lipid droplet
5. P	GO:0010297	heteropolysaccharide binding
5. P	GO:0016131	brassinosteroid metabolic process
5. P	GO:0005759	mitochondrial matrix
5. P	GO:0042350	GDP-L-fucose biosynthetic process
5. P	GO:0010422	regulation of brassinosteroid biosynthetic process
5. P	GO:0035671	enone reductase activity
5. P	GO:0035835	indole alkaloid biosynthetic process
5. P	GO:0030283	testosterone dehydrogenase [NAD(P)] activity
5. P	GO:0035634	response to stilbenoid
5. P	GO:0005996	monosaccharide metabolic process
5. P	GO:0019877	diaminopimelate biosynthetic process
5. P	GO:0009964	negative regulation of flavonoid biosynthetic process
5. P	GO:0051287	NAD binding
5. P	GO:0052675	3-methylbutanol:NADP oxidoreductase activity
5. P	GO:0102965	alcohol-forming fatty acyl-CoA reductase activity
5. P	GO:1902128	(-)-lariciresinol catabolic process
5. P	GO:0019752	carboxylic acid metabolic process
5. P	GO:0060716	labyrinthine layer blood vessel development
5. P	GO:0004073	aspartate-semialdehyde dehydrogenase activity
5. P	GO:0008202	steroid metabolic process
5. P	GO:0006701	progesterone biosynthetic process
5. P	GO:0005758	mitochondrial intermembrane space
5. P	GO:0033788	leucoanthocyanidin reductase activity
5. P	GO:0006005	L-fucose biosynthetic process
5. P	GO:0044550	secondary metabolite biosynthetic process
5. P	GO:0071266	'de novo' L-methionine biosynthetic process
5. P	GO:0008204	ergosterol metabolic process
5. P	GO:0044877	protein-containing complex binding
5. P	GO:0006695	cholesterol biosynthetic process
5. P	GO:1902138	(-)-secoisolariciresinol biosynthetic process
5. P	GO:0010284	lariciresinol reductase activity
5. P	GO:0009089	lysine biosynthetic process via diaminopimelate
5. P	GO:0008203	cholesterol metabolic process
5. P	GO:0050031	L-pipecolate oxidase activity
5. P	GO:0090295	nitrogen catabolite repression of transcription
5. P	GO:1902123	(-)-pinoresinol catabolic process
5. P	GO:0005747	mitochondrial respiratory chain complex I
5. P	GO:0001942	hair follicle development
5. P	GO:0009809	lignin biosynthetic process
5. P	GO:0050664	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
5. P	GO:0016615	malate dehydrogenase activity
5. P	GO:0010319	stromule
5. P	GO:0030868	smooth endoplasmic reticulum membrane
5. P	GO:0033327	Leydig cell differentiation
5. P	GO:0008270	zinc ion binding
5. P	GO:0003954	NADH dehydrogenase activity
5. P	GO:0017143	insecticide metabolic process
5. P	GO:0010595	positive regulation of endothelial cell migration
5. P	GO:0052676	3-methylbutanol:NAD oxidoreductase activity
5. P	GO:0000166	nucleotide binding
5. P	GO:0000427	plastid-encoded plastid RNA polymerase complex
5. P	GO:0010025	wax biosynthetic process
5. P	GO:0010283	pinoresinol reductase activity
5. P	GO:0010023	proanthocyanidin biosynthetic process
5. P	GO:0007623	circadian rhythm
5. P	GO:0046554	malate dehydrogenase (NADP+) activity
5. P	GO:0102191	4alpha-carboxy-5alpha-cholesta-7,24-dien-3beta-ol dehydrogenase/C4-decarboxylase activity
5. P	GO:0010584	pollen exine formation
5. P	GO:0005840	ribosome
5. P	GO:0005496	steroid binding
5. P	GO:0009820	alkaloid metabolic process
5. P	GO:0046506	sulfolipid biosynthetic process
5. P	GO:0003942	N-acetyl-gamma-glutamyl-phosphate reductase activity
5. P	GO:1902129	(-)-lariciresinol biosynthetic process
5. P	GO:0009097	isoleucine biosynthetic process
5. P	GO:0061727	methylglyoxal catabolic process to lactate
5. P	GO:0080110	sporopollenin biosynthetic process
5. P	GO:0031073	cholesterol 26-hydroxylase activity
5. P	GO:0000287	magnesium ion binding
5. P	GO:0006735	NADH regeneration
5. P	GO:0006099	tricarboxylic acid cycle
5. P	GO:0005789	endoplasmic reticulum membrane
5. P	GO:0102443	L-2-hydroxycarboxylate dehydrogenase (NAD+) activity
5. P	GO:1902131	(+)-lariciresinol catabolic process
5. P	GO:0009438	methylglyoxal metabolic process
5. P	GO:1901006	ubiquinone-6 biosynthetic process
5. P	GO:0046568	3-methylbutanol:NAD(P) oxidoreductase activity
5. P	GO:0030060	L-malate dehydrogenase activity
5. P	GO:0019843	rRNA binding
6. F	GO:0004753	saccharopine dehydrogenase activity
6. F	GO:0043815	phosphoribosylglycinamide formyltransferase 2 activity
6. F	GO:0047131	saccharopine dehydrogenase (NAD+, L-glutamate-forming) activity
6. F	GO:0006189	'de novo' IMP biosynthetic process
6. F	GO:0102131	obsolete 3-oxo-glutaryl-[acp] methyl ester reductase activity
6. F	GO:0010597	green leaf volatile biosynthetic process
6. F	GO:0009821	alkaloid biosynthetic process
6. F	GO:0008650	rRNA (uridine-2'-O-)-methyltransferase activity
6. F	GO:0019290	siderophore biosynthetic process
6. F	GO:0003858	3-hydroxybutyrate dehydrogenase activity
6. F	GO:0018454	acetoacetyl-CoA reductase activity
6. F	GO:0019748	secondary metabolic process
6. F	GO:0019380	3-phenylpropionate catabolic process
6. F	GO:0016114	terpenoid biosynthetic process
6. F	GO:0030497	fatty acid elongation
6. F	GO:0016854	racemase and epimerase activity
6. F	GO:0019429	fluorene catabolic process
6. F	GO:0051170	import into nucleus
6. F	GO:0018461	fluoren-9-ol dehydrogenase activity
6. F	GO:0106277	biliverdin reductase (NADP+) activity
6. F	GO:0006666	3-keto-sphinganine metabolic process
6. F	GO:0016994	precorrin-6A reductase activity
6. F	GO:0004757	sepiapterin reductase activity
6. F	GO:0004155	6,7-dihydropteridine reductase activity
6. F	GO:1901771	daunorubicin biosynthetic process
6. F	GO:0042168	heme metabolic process
6. F	GO:0004644	phosphoribosylglycinamide formyltransferase activity
6. F	GO:1900192	positive regulation of single-species biofilm formation
6. F	GO:0047130	saccharopine dehydrogenase (NADP+, L-lysine-forming) activity
6. F	GO:0018509	cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase activity
6. F	GO:0102306	benzil reductase [(S)-benzoin-forming] activity
6. F	GO:0004316	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
6. F	GO:0102132	obsolete 3-oxo-pimeloyl-[acp] methyl ester reductase activity
6. F	GO:0018498	2,3-dihydroxy-2,3-dihydro-phenylpropionate dehydrogenase activity
6. F	GO:0106276	biliberdin reductase NAD+ activity
6. F	GO:0035527	3-hydroxypropionate dehydrogenase (NADP+) activity
6. F	GO:0047560	3-dehydrosphinganine reductase activity
6. F	GO:0016772	transferase activity, transferring phosphorus-containing groups
6. F	GO:0102911	(-)-secoisolariciresinol dehydrogenase activity
6. F	GO:0004074	biliverdin reductase (NAD(P)+) activity
6. F	GO:0000140	acylglycerone-phosphate reductase activity
6. F	GO:0043642	novobiocin biosynthetic process
6. F	GO:0005741	mitochondrial outer membrane
6. F	GO:0055072	iron ion homeostasis
7. B	GO:0006696	ergosterol biosynthetic process
7. B	GO:0010214	seed coat development
7. B	GO:0050377	UDP-glucose 4,6-dehydratase activity
7. B	GO:0051555	flavonol biosynthetic process
7. B	GO:0010192	mucilage biosynthetic process
7. B	GO:0010315	auxin efflux
7. B	GO:0042125	protein galactosylation
7. B	GO:2001315	UDP-4-deoxy-4-formamido-beta-L-arabinopyranose biosynthetic process
7. B	GO:0009969	xyloglucan biosynthetic process
7. B	GO:0010053	root epidermal cell differentiation
7. B	GO:0006364	rRNA processing
7. B	GO:0035167	larval lymph gland hemopoiesis
7. B	GO:0005802	trans-Golgi network
7. B	GO:0010280	UDP-L-rhamnose synthase activity
7. B	GO:0001558	regulation of cell growth
7. B	GO:0048868	pollen tube development

Uniprot GO Annotations

GO	Description
GO:0016853	isomerase activity
GO:0006012	galactose metabolic process
GO:0005975	carbohydrate metabolic process
GO:0003978	UDP-glucose 4-epimerase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q2NQV7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.40e-41	5.61e-07	0.7831
1. PBF	P95780	dTDP-glucose 4,6-dehydratase	0.00e+00	6.63e-26	1.35e-04	0.8107
1. PBF	B4TZW1	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.82e-39	2.99e-06	0.7692
1. PBF	B3GYT6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.19e-40	1.90e-07	0.803
1. PBF	P13226	UDP-glucose 4-epimerase	0.00e+00	3.50e-47	4.83e-59	0.9221
1. PBF	Q07W60	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.10e-44	2.68e-05	0.7766
1. PBF	Q57301	UDP-glucose 4-epimerase	0.00e+00	6.96e-52	1.02e-72	0.9346
1. PBF	P9WN66	UDP-glucose 4-epimerase	0.00e+00	2.88e-34	1.02e-10	0.8906
1. PBF	P56985	UDP-glucose 4-epimerase	0.00e+00	8.70e-50	1.45e-61	0.9464
1. PBF	Q02QH1	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.32e-39	1.70e-05	0.6653
1. PBF	Q0KDH0	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.79e-40	0.005	0.7284
1. PBF	Q5R8D0	UDP-glucose 4-epimerase	0.00e+00	7.41e-39	3.03e-63	0.936
1. PBF	O84903	UDP-glucose 4-epimerase	0.00e+00	3.90e-54	1.42e-66	0.9597
1. PBF	A0K5M9	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.23e-42	9.57e-07	0.7274
1. PBF	Q9L9E8	dTDP-glucose 4,6-dehydratase	0.00e+00	5.67e-27	1.89e-06	0.836
1. PBF	B8CVJ3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	8.27e-44	2.26e-06	0.792
1. PBF	P14169	CDP-paratose 2-epimerase	0.00e+00	6.38e-41	6.73e-10	0.8229
1. PBF	Q5PC05	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.82e-39	2.99e-06	0.7748
1. PBF	Q1BY20	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.23e-42	9.57e-07	0.7275
1. PBF	A1VGB0	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.93e-38	1.65e-04	0.7681
1. PBF	C0Q1V2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.06e-38	3.88e-06	0.7701
1. PBF	B2U5D7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7748
1. PBF	P26503	UDP-glucose 4-epimerase	0.00e+00	5.66e-52	3.03e-64	0.9542
1. PBF	Q2SYH7	dTDP-L-rhamnose 4-epimerase	0.00e+00	5.05e-30	4.13e-10	0.8073
1. PBF	Q05026	UDP-glucose 4-epimerase	0.00e+00	6.61e-52	5.13e-60	0.9541
1. PBF	P24325	UDP-glucose 4-epimerase	0.00e+00	2.80e-47	8.41e-68	0.9537
1. PBF	Q39IF3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.47e-43	1.03e-06	0.7265
1. PBF	A7ZTH2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.7766
1. PBF	Q8RIA5	ADP-L-glycero-D-manno-heptose-6-epimerase	2.22e-16	5.40e-43	5.92e-06	0.7378
1. PBF	O35296	NADPH-dependent 3-keto-steroid reductase HSD3B3	6.66e-16	1.64e-23	0.023	0.7065
1. PBF	P22715	UDP-glucose 4-epimerase	0.00e+00	1.67e-51	4.68e-65	0.9519
1. PBF	B1XVP6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.17e-37	0.006	0.741
1. PBF	B4T9A3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.82e-39	2.99e-06	0.7718
1. PBF	B1JQW4	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.46e-42	6.93e-06	0.7747
1. PBF	B1IZH2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.38e-37	2.03e-05	0.7745
1. PBF	Q13VD0	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.20e-41	4.81e-07	0.7369
1. PBF	A8GWP0	UDP-glucose 4-epimerase	8.32e-12	1.79e-06	0.026	0.6531
1. PBF	P35673	UDP-glucose 4-epimerase	0.00e+00	1.71e-51	1.17e-74	0.9522
1. PBF	F8C4X8	UDP-glucuronate 4-epimerase	0.00e+00	2.61e-38	1.51e-19	0.8734
1. PBF	Q9JQX8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	5.42e-42	5.85e-07	0.7329
1. PBF	Q5R885	UDP-glucuronic acid decarboxylase 1	0.00e+00	2.29e-06	8.62e-05	0.8183
1. PBF	Q04973	Vi polysaccharide biosynthesis protein VipB/TviC	0.00e+00	1.01e-40	5.81e-17	0.8519
1. PBF	A6TFL4	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	5.18e-40	2.93e-06	0.7688
1. PBF	C5BB97	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	8.62e-41	8.81e-04	0.7891
1. PBF	C4K8I6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.60e-40	1.17e-04	0.7967
1. PBF	Q0IH73	Short-chain dehydrogenase/reductase family 42E member 1	2.22e-16	8.78e-22	0.017	0.7579
1. PBF	Q9HTB6	GDP-6-deoxy-D-mannose reductase	0.00e+00	2.64e-28	1.43e-07	0.8491
1. PBF	A1AHF5	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.775
1. PBF	P29782	dTDP-glucose 4,6-dehydratase	0.00e+00	1.36e-27	7.92e-11	0.8425
1. PBF	Q2SY18	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	7.64e-40	5.56e-07	0.7299
1. PBF	B3R3C0	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.58e-38	0.005	0.7367
1. PBF	P55294	dTDP-glucose 4,6-dehydratase	0.00e+00	3.33e-25	1.08e-15	0.8099
1. PBF	Q59745	UDP-glucose 4-epimerase	0.00e+00	2.54e-52	3.60e-61	0.955
1. PBF	B1LK58	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.84e-39	1.47e-04	0.7764
1. PBF	A9ADU8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.45e-39	8.98e-07	0.7421
1. PBF	Q1RIM4	UDP-glucose 4-epimerase	8.54e-12	9.37e-07	0.025	0.6224
1. PBF	B0M3E8	Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1	0.00e+00	6.12e-38	8.46e-64	0.9482
1. PBF	Q5QKR8	UDP-N-acetylglucosamine 4,6-dehydratase (inverting)	1.44e-15	9.33e-14	0.005	0.6715
1. PBF	Q59678	UDP-glucose 4-epimerase	0.00e+00	4.37e-52	7.47e-60	0.9459
1. PBF	A3NXW3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.17e-40	3.16e-06	0.7241
1. PBF	A4TSC8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.46e-42	6.93e-06	0.7747
1. PBF	A9R683	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.46e-42	6.93e-06	0.7718
1. PBF	P44914	dTDP-glucose 4,6-dehydratase	0.00e+00	5.81e-23	2.06e-14	0.8228
1. PBF	Q4R7R1	Short-chain dehydrogenase/reductase family 42E member 1	0.00e+00	1.21e-22	4.84e-07	0.7736
1. PBF	B7L745	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.7765
1. PBF	B9J8R3	UDP-glucuronate 4-epimerase	0.00e+00	1.51e-41	2.31e-10	0.8364
1. PBF	Q1C276	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.46e-42	6.93e-06	0.7747
1. PBF	B5XTI2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.38e-39	2.99e-06	0.7743
1. PBF	Q6DAT7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.55e-39	2.32e-04	0.774
1. PBF	B5YWC0	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.777
1. PBF	P26397	CDP-glucose 4,6-dehydratase	0.00e+00	8.04e-28	1.88e-06	0.8361
1. PBF	P37761	dTDP-glucose 4,6-dehydratase	0.00e+00	5.86e-22	4.04e-14	0.8247
1. PBF	Q3J7X9	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.09e-42	3.95e-05	0.7636
1. PBF	Q49VA1	Uncharacterized epimerase/dehydratase SSP2164	0.00e+00	2.17e-32	0.020	0.7827
1. PBF	B2JYP2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.46e-42	6.93e-06	0.7748
1. PBF	O06485	Putative sugar dehydratase/epimerase YfnG	0.00e+00	6.13e-31	4.18e-07	0.877
1. PBF	B5EXC5	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.82e-39	2.99e-06	0.769
1. PBF	Q45291	UDP-glucose 4-epimerase	0.00e+00	1.28e-48	4.44e-63	0.9269
1. PBF	C6DIA9	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.51e-40	5.59e-05	0.7741
1. PBF	Q62M34	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.17e-40	3.16e-06	0.7167
1. PBF	P0DMK5	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.18e-41	3.30e-06	0.7169
1. PBF	B8F727	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.71e-42	1.23e-05	0.8048
1. PBF	Q0I569	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	8.19e-38	6.43e-05	0.7922
1. PBF	B7NPC7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7731
1. PBF	P21977	UDP-glucose 4-epimerase	0.00e+00	1.01e-55	3.42e-73	0.9336
1. PBF	Q66GC7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.46e-42	6.93e-06	0.7745
1. PBF	Q47GJ3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.39e-42	3.20e-09	0.7244
1. PBF	Q04871	Uncharacterized 37.6 kDa protein in cld 5'region	0.00e+00	1.26e-42	1.83e-14	0.8274
1. PBF	Q7W609	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.50e-39	0.029	0.7296
1. PBF	B5FLI8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.21e-39	2.83e-06	0.7672
1. PBF	Q6E7F4	dTDP-glucose 4,6-dehydratase	0.00e+00	1.97e-23	1.53e-07	0.8102
1. PBF	P47364	UDP-glucose 4-epimerase	0.00e+00	1.91e-55	4.14e-45	0.8998
1. PBF	P37777	dTDP-glucose 4,6-dehydratase	0.00e+00	3.37e-24	3.81e-10	0.8202
1. PBF	Q9RR28	dTDP-glucose 4,6-dehydratase	0.00e+00	2.47e-26	4.27e-11	0.817
1. PBF	Q98I52	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.47e-45	1.17e-04	0.8128
1. PBF	B7M4A5	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.7758
1. PBF	Q9ZAE8	dTDP-glucose 4,6-dehydratase	0.00e+00	1.35e-22	5.71e-11	0.8487
1. PBF	Q57IC3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.06e-38	3.88e-06	0.7693
1. PBF	P39630	dTDP-glucose 4,6-dehydratase	0.00e+00	4.19e-22	2.18e-09	0.8719
1. PBF	P55293	dTDP-glucose 4,6-dehydratase	0.00e+00	7.60e-23	2.91e-08	0.8205
1. PBF	A7FCU3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.46e-42	6.93e-06	0.7725
1. PBF	A6V291	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.22e-37	3.99e-06	0.7224
1. PBF	A2Z7B3	GDP-mannose 3,5-epimerase 1	0.00e+00	4.65e-30	4.41e-04	0.8221
1. PBF	Q7NTL6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.43e-40	0.011	0.7165
1. PBF	B0RVL0	dTDP-glucose 4,6-dehydratase	0.00e+00	7.53e-24	1.91e-11	0.8063
1. PBF	A6QLW2	dTDP-D-glucose 4,6-dehydratase	0.00e+00	9.25e-22	8.81e-12	0.836
1. PBF	A1JHX6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.68e-40	3.19e-05	0.7594
1. PBF	Q3T105	UDP-glucose 4-epimerase	0.00e+00	9.75e-43	1.17e-63	0.9347
1. PBF	Q6E7F2	dTDP-4-dehydro-6-deoxyglucose reductase	0.00e+00	2.09e-38	0.018	0.8494
1. PBF	A3QJB2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.82e-42	4.03e-05	0.7625
1. PBF	B4SXC1	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	5.78e-39	3.10e-06	0.776
1. PBF	A2S4R1	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.17e-40	3.16e-06	0.7171
1. PBF	A8ARK8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.14e-38	2.28e-04	0.7721
1. PBF	Q3JPY8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.17e-40	3.16e-06	0.7165
1. PBF	Q72ET7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.38e-40	1.67e-04	0.7655
1. PBF	Q7VKK8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	8.29e-39	4.08e-05	0.781
1. PBF	Q8X7P7	N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase	0.00e+00	5.81e-30	2.00e-10	0.7061
1. PBF	P9WN64	dTDP-glucose 4,6-dehydratase	0.00e+00	1.61e-24	1.74e-09	0.8249
1. PBF	B2VL47	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	7.85e-41	8.93e-05	0.7914
1. PBF	Q9CL97	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.38e-41	2.77e-04	0.7921
1. PBF	B5R5E3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.21e-39	2.83e-06	0.7732
1. PBF	Q6DF08	UDP-glucuronic acid decarboxylase 1	0.00e+00	3.47e-04	1.76e-04	0.8032
1. PBF	A7MQ91	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.34e-37	4.75e-05	0.7812
1. PBF	I1WGR6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.21e-39	5.43e-06	0.7194
1. PBF	Q32L94	Short-chain dehydrogenase/reductase family 42E member 1	1.11e-16	1.71e-23	2.14e-04	0.7691
1. PBF	B2T625	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.09e-41	2.33e-07	0.7357
1. PBF	O66256	dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD(+))	0.00e+00	3.24e-10	7.26e-06	0.7949
1. PBF	B1JXS7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.23e-42	9.57e-07	0.727
1. PBF	Q7VZF5	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.82e-40	0.029	0.7319
1. PBF	Q7WTB1	UDP-glucose 4-epimerase	0.00e+00	5.29e-57	1.60e-78	0.9517
1. PBF	Q5F9J0	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	5.67e-40	1.65e-06	0.7358
1. PBF	Q1CD11	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.46e-42	6.93e-06	0.7743
1. PBF	C4ZXL1	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.7745
1. PBF	O65780	UDP-glucose 4-epimerase GEPI42	0.00e+00	1.20e-34	9.39e-58	0.9348
1. PBF	A3N308	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.18e-41	2.56e-07	0.8031
1. PBF	Q9K002	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.61e-41	8.40e-07	0.7327
1. PBF	A9MKQ6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.39e-39	9.26e-07	0.7706
1. PBF	P56986	UDP-glucose 4-epimerase	0.00e+00	3.96e-50	9.83e-62	0.9453
1. PBF	B7MFI2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.772
1. PBF	A1SRT6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.18e-35	2.45e-04	0.7699
1. PBF	P67911	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.7764
1. PBF	B4F132	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.04e-38	5.18e-06	0.771
1. PBF	P39858	Protein CapI	0.00e+00	8.26e-43	3.80e-17	0.8556
1. PBF	Q8FCA0	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7782
1. PBF	Q43070	UDP-glucose 4-epimerase	0.00e+00	4.46e-36	9.29e-63	0.9481
1. PBF	A9IJJ7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	5.24e-38	0.007	0.7134
1. PBF	A0R5C5	UDP-glucose 4-epimerase	0.00e+00	3.97e-37	2.75e-12	0.8902
1. PBF	Q8ZJN4	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.46e-42	6.93e-06	0.7747
1. PBF	B5BHZ3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.82e-39	2.99e-06	0.7714
1. PBF	P55462	Probable dTDP-glucose 4,6-dehydratase	0.00e+00	2.76e-25	1.12e-10	0.8249
1. PBF	A4JCI2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	8.37e-40	8.74e-07	0.7266
1. PBF	B7ULH4	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.7746
1. PBF	P56997	UDP-glucose 4-epimerase	0.00e+00	4.86e-50	2.71e-62	0.9464
1. PBF	P55180	UDP-glucose 4-epimerase	0.00e+00	2.58e-49	4.20e-68	0.9452
1. PBF	D4GU72	Low-salt glycan biosynthesis protein Agl12	0.00e+00	4.01e-27	6.72e-20	0.88
1. PBF	Q9KDV3	UDP-glucose 4-epimerase	0.00e+00	7.22e-49	5.53e-73	0.9445
1. PBF	A4W527	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.59e-40	1.48e-05	0.7622
1. PBF	Q83PP2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7765
1. PBF	Q51061	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.22e-40	1.70e-06	0.739
1. PBF	A8GLC8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	5.94e-40	2.57e-04	0.7788
1. PBF	B2JF12	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.76e-40	7.24e-06	0.7228
1. PBF	A1KT78	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.38e-41	2.54e-07	0.7354
1. PBF	B7NES6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7711
1. PBF	P55584	Uncharacterized protein y4nL	0.00e+00	1.44e-24	5.96e-06	0.7812
1. PBF	B0BSD7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.18e-41	2.56e-07	0.8032
1. PBF	B5RGG8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.21e-39	2.83e-06	0.7722
1. PBF	Q1LQG2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.70e-39	0.001	0.7454
1. PBF	P67912	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.82e-39	2.99e-06	0.7747
1. PBF	B7N1S3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7767
1. PBF	Q329N6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.27e-38	8.69e-06	0.7752
1. PBF	Q59083	UDP-glucose 4-epimerase	0.00e+00	1.80e-50	2.80e-66	0.945
1. PBF	A3MHP7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.17e-40	3.16e-06	0.7177
1. PBF	Q46Y59	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.87e-41	1.07e-06	0.7265
1. PBF	Q0BH85	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.29e-39	9.48e-07	0.7275
1. PBF	Q31V04	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7731
1. PBF	Q9XCA1	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.50e-39	3.10e-06	0.7705
1. PBF	C0QZ84	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.26e-41	1.74e-06	0.7455
1. PBF	B1YV41	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.22e-40	9.48e-07	0.7273
1. PBF	Q0A4T8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.82e-41	7.30e-05	0.7845
1. PBF	Q0SYE8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7731
1. PBF	Q7WGU9	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.50e-39	0.029	0.7286
1. PBF	P96995	UDP-glucose 4-epimerase	0.00e+00	8.89e-58	2.82e-68	0.9432
1. PBF	Q9F7D4	UDP-glucose 4-epimerase	0.00e+00	3.87e-50	1.31e-62	0.9524
1. PBF	A0QSK6	dTDP-glucose 4,6-dehydratase	0.00e+00	2.61e-25	6.74e-10	0.8225
1. PBF	P33119	UDP-glucose 4-epimerase	0.00e+00	1.17e-46	3.01e-69	0.9244
1. PBF	Q9S642	dTDP-glucose 4,6-dehydratase	0.00e+00	1.59e-23	6.66e-17	0.8236
1. PBF	A9M3Q7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.75e-43	9.19e-07	0.7317
1. PBF	Q1R4X2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7719
1. PBF	P45048	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.41e-40	0.001	0.7754
1. PBF	Q0TBI8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7752
1. PBF	P26391	dTDP-glucose 4,6-dehydratase	0.00e+00	3.49e-24	3.46e-11	0.8049
1. PBF	Q3YVY3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.92e-38	2.89e-05	0.7747
1. PBF	Q9HYQ8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.21e-39	9.07e-06	0.6835
1. PBF	Q9CNY5	UDP-glucose 4-epimerase	0.00e+00	2.25e-47	6.32e-66	0.9491
1. PBF	Q7BJX9	UDP-N-acetylglucosamine 4-epimerase	0.00e+00	8.39e-36	2.15e-16	0.8399
1. PBF	P75517	UDP-glucose 4-epimerase	0.00e+00	3.80e-54	9.22e-44	0.9229
1. PBF	P67913	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.82e-39	2.99e-06	0.7693
1. PBF	O34886	Uncharacterized UDP-glucose epimerase YtcB	0.00e+00	2.04e-39	3.51e-19	0.8879
1. PBF	Q21Y60	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.29e-41	0.013	0.7446
1. PBF	O65781	UDP-glucose 4-epimerase GEPI48	0.00e+00	1.37e-37	1.41e-65	0.952
1. PBF	B1X953	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.775
1. PBF	A9MVL2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.82e-39	2.99e-06	0.7716
1. PBF	O54067	Probable UDP-glucuronate 4-epimerase	0.00e+00	7.69e-42	1.91e-07	0.8395
1. PBF	O25511	UDP-N-acetylglucosamine 4,6-dehydratase (inverting)	1.67e-15	1.76e-09	2.34e-05	0.6719
1. PBF	E8MF10	UDP-glucose 4-epimerase	0.00e+00	1.29e-54	5.66e-60	0.9295
1. PBF	D4GU71	Probable low-salt glycan biosynthesis reductase Agl14	0.00e+00	1.01e-15	0.013	0.8044
1. PBF	B6I3J9	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.776
1. PBF	A1V6L4	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.17e-40	3.16e-06	0.7172
1. PBF	Q12CM2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.55e-39	0.028	0.7321
1. PBF	Q7MY46	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	7.69e-42	6.80e-05	0.7746
1. PBF	B7LVH8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	0.7771
1. PBF	B4EB34	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.81e-42	8.51e-07	0.7266
1. PBF	A8A683	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.38e-37	2.03e-05	0.7708
1. PBF	Q56093	UDP-glucose 4-epimerase	0.00e+00	5.57e-51	2.91e-65	0.9521
1. PBF	A3NC24	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.17e-40	3.16e-06	0.7173
1. PBF	P55579	Uncharacterized protein y4nG	0.00e+00	6.67e-16	2.97e-04	0.7205
2. PF	Q56598	GDP-mannose 4,6-dehydratase	0.00e+00	9.58e-19	NA	0.8096
2. PF	B5FFS9	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.53e-37	NA	0.7852
2. PF	Q06963	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.38e-41	NA	0.7842
2. PF	Q5RBE5	GDP-L-fucose synthase	0.00e+00	1.56e-20	NA	0.7928
2. PF	A2TBU1	Agroclavine dehydrogenase	5.85e-12	1.93e-03	NA	0.5747
2. PF	P71373	Epimerase family protein HI_1208	4.44e-15	4.76e-18	NA	0.7429
2. PF	Q99VK8	Epimerase family protein SAV0769	1.78e-15	6.10e-17	NA	0.7627
2. PF	Q8MIR0	L-threonine 3-dehydrogenase, mitochondrial	0.00e+00	3.75e-14	NA	0.7734
2. PF	O85713	GDP-mannose 4,6-dehydratase	0.00e+00	2.69e-22	NA	0.8229
2. PF	P0AC91	GDP-mannose 4,6-dehydratase	0.00e+00	2.00e-21	NA	0.8011
2. PF	A1TYR6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.16e-43	NA	0.8075
2. PF	Q9JRN7	GDP-6-deoxy-D-talose 4-dehydrogenase	0.00e+00	4.05e-34	NA	0.8695
2. PF	P29781	dTDP-4-dehydrorhamnose reductase	0.00e+00	6.49e-07	NA	0.7872
2. PF	P51103	Dihydroflavonol 4-reductase	5.00e-15	5.29e-09	NA	0.713
2. PF	P9WH08	dTDP-4-dehydrorhamnose reductase	2.22e-16	1.33e-06	NA	0.7348
2. PF	P0A5D2	Uncharacterized protein Mb0513	1.89e-15	1.15e-22	NA	0.7179
2. PF	Q8K3X3	GDP-mannose 4,6 dehydratase	0.00e+00	7.20e-16	NA	0.8094
2. PF	Q2FJ87	Uncharacterized epimerase/dehydratase SAUSA300_0538	0.00e+00	2.23e-34	NA	0.7879
2. PF	B8NU00	NmrA-like family domain-containing oxidoreductase lnaB	3.79e-06	8.60e-03	NA	0.508
2. PF	Q2YSF6	Epimerase family protein SAB0724c	2.00e-15	6.81e-17	NA	0.7681
2. PF	D4GP33	L-arabinose 1-dehydrogenase (NAD(P)(+))	4.97e-14	7.28e-07	NA	0.7191
2. PF	Q5HQV8	Epimerase family protein SERP0438	3.33e-15	3.27e-18	NA	0.7582
2. PF	C3LQK1	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.38e-41	NA	0.7851
2. PF	Q4QQZ4	Methionine adenosyltransferase 2 subunit beta	0.00e+00	1.69e-12	NA	0.7323
2. PF	A0A059TC02	Cinnamoyl-CoA reductase 1	2.44e-15	3.99e-07	NA	0.7298
2. PF	P14893	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	6.66e-16	1.25e-26	NA	0.705
2. PF	A5F3Z4	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.38e-41	NA	0.7835
2. PF	Q7A6Q5	Epimerase family protein SA0724	1.78e-15	6.10e-17	NA	0.7724
2. PF	A0QTF8	dTDP-4-dehydrorhamnose reductase	2.22e-16	7.60e-09	NA	0.6937
2. PF	Q4L3L8	Uncharacterized epimerase/dehydratase SH2450	0.00e+00	1.05e-37	NA	0.7661
2. PF	P0A1P4	CDP-abequose synthase	1.11e-16	3.80e-30	NA	0.7836
2. PF	Q4L4J7	Epimerase family protein SH2119	1.67e-15	2.51e-16	NA	0.7437
2. PF	B2U894	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.08e-39	NA	0.718
2. PF	A8Y0L5	GDP-mannose 4,6 dehydratase 1	0.00e+00	2.50e-19	NA	0.8215
2. PF	P0C7J0	dTDP-glucose 4,6-dehydratase	0.00e+00	2.09e-25	NA	0.8063
2. PF	P0AC90	GDP-mannose 4,6-dehydratase	0.00e+00	2.00e-21	NA	0.801
2. PF	P67233	Epimerase family protein Mb2239	1.25e-14	9.46e-13	NA	0.729
2. PF	Q6GJB5	Uncharacterized epimerase/dehydratase SAR0558	0.00e+00	4.51e-34	NA	0.7793
2. PF	Q7MPN6	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	5.04e-39	NA	0.7857
2. PF	Q888H1	Uronate dehydrogenase	2.02e-12	1.18e-09	NA	0.6729
2. PF	P39631	Spore coat polysaccharide biosynthesis protein SpsK	0.00e+00	5.32e-10	NA	0.8129
2. PF	Q0P8W4	UDP-N-acetylglucosamine 4,6-dehydratase (inverting)	1.33e-15	1.89e-12	NA	0.6615
2. PF	Q99W56	Uncharacterized epimerase/dehydratase SAV0553	0.00e+00	2.23e-34	NA	0.7891
2. PF	Q2MFU6	2'-dehydrokanamycin reductase	7.77e-16	3.70e-15	NA	0.7016
2. PF	Q6GIM1	Epimerase family protein SAR0825	1.55e-15	8.10e-17	NA	0.7576
2. PF	P9WKT2	Uncharacterized protein MT0522	1.67e-15	1.15e-22	NA	0.7027
2. PF	Q8PDW5	2-alkyl-3-oxoalkanoate reductase	0.00e+00	5.55e-29	NA	0.7283
2. PF	P55463	dTDP-4-dehydrorhamnose reductase	0.00e+00	1.32e-07	NA	0.7736
2. PF	O46516	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	5.55e-16	3.25e-24	NA	0.7201
2. PF	P73212	Putative dihydroflavonol 4-reductase	0.00e+00	5.19e-19	NA	0.7526
2. PF	Q1XDP9	Uncharacterized protein ycf39	1.11e-16	1.22e-04	NA	0.6148
2. PF	P37778	dTDP-4-dehydrorhamnose reductase	0.00e+00	5.40e-08	NA	0.7638
2. PF	Q40316	Vestitone reductase	7.77e-16	5.02e-12	NA	0.7474
2. PF	O66251	dTDP-4-dehydrorhamnose reductase	0.00e+00	7.17e-11	NA	0.7995
2. PF	Q46769	dTDP-4-dehydrorhamnose reductase	0.00e+00	2.81e-08	NA	0.7844
2. PF	Q00329	CDP-abequose synthase	0.00e+00	2.66e-25	NA	0.7765
2. PF	P55353	GDP-L-fucose synthase	0.00e+00	5.92e-26	NA	0.7818
2. PF	B1GVX5	Oxidoreductase BOA1	1.74e-05	7.80e-05	NA	0.5174
2. PF	P44094	D-erythronate dehydrogenase	3.33e-16	1.94e-36	NA	0.7595
2. PF	G4WJD3	GDP-L-colitose synthase	0.00e+00	2.93e-23	NA	0.8414
2. PF	Q6PQJ9	3-oxo-Delta(4,5)-steroid 5-beta-reductase	6.55e-15	6.39e-08	NA	0.7306
2. PF	Q92IG3	UDP-glucose 4-epimerase	1.21e-11	1.96e-06	NA	0.6116
2. PF	Q49VZ4	Epimerase family protein SSP1921	1.78e-15	2.05e-16	NA	0.7512
2. PF	P51106	Dihydroflavonol 4-reductase	2.66e-15	2.30e-09	NA	0.7218
2. PF	P51104	Dihydroflavonol 4-reductase	2.33e-15	4.71e-13	NA	0.7258
2. PF	A1KBH4	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.70e-39	NA	0.7399
2. PF	Q64421	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2	8.88e-16	1.25e-24	NA	0.7424
2. PF	Q2SYI1	dTDP-4-dehydrorhamnose reductase	0.00e+00	5.05e-10	NA	0.7542
2. PF	A7MSM1	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.62e-39	NA	0.7757
2. PF	P51110	Dihydroflavonol 4-reductase	2.22e-15	1.32e-10	NA	0.7281
2. PF	Q6T1X6	GDP-6-deoxy-D-mannose reductase	0.00e+00	3.56e-24	NA	0.8706
2. PF	G3XMB9	Ketoreductase azaE	1.89e-15	1.85e-13	NA	0.7281
2. PF	P55354	GDP-mannose 4,6-dehydratase	0.00e+00	3.39e-23	NA	0.8294
2. PF	A8GN21	UDP-glucose 4-epimerase	1.05e-11	7.28e-07	NA	0.6425
2. PF	O78472	Uncharacterized protein ycf39	1.11e-16	1.43e-05	NA	0.7137
2. PF	Q5R4E0	Methionine adenosyltransferase 2 subunit beta	0.00e+00	3.31e-12	NA	0.718
2. PF	Q8NXL7	Epimerase family protein MW0731	2.00e-15	4.10e-17	NA	0.7627
2. PF	Q2KIR8	L-threonine 3-dehydrogenase, mitochondrial	0.00e+00	2.50e-13	NA	0.784
2. PF	Q8CPY7	Epimerase family protein SE_0553	2.89e-15	3.27e-18	NA	0.7434
2. PF	Q0KBD2	D-erythronate dehydrogenase	1.11e-16	1.52e-32	NA	0.7248
2. PF	Q5HIC2	Uncharacterized epimerase/dehydratase SACOL0599	0.00e+00	2.23e-34	NA	0.7843
2. PF	O31574	Epimerase family protein YfhF	1.33e-15	4.25e-18	NA	0.7438
2. PF	D7U6G6	Anthocyanidin reductase ((2S)-flavan-3-ol-forming)	1.22e-14	1.04e-11	NA	0.711
2. PF	Q84KP0	Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase	2.22e-15	1.49e-11	NA	0.7188
2. PF	B6HV33	Ketoreductase adrE	1.20e-13	1.16e-04	NA	0.6657
2. PF	A0A221J5X1	(S)-8-oxocitronellyl enol synthase ISY2	2.40e-14	9.61e-08	NA	0.6296
2. PF	Q51366	GDP-mannose 4,6-dehydratase	0.00e+00	1.56e-23	NA	0.8362
2. PF	A1VR25	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.53e-40	NA	0.7398
2. PF	P51107	Dihydroflavonol 4-reductase	9.10e-15	9.05e-06	NA	0.7314
2. PF	Q88NN6	Uronate dehydrogenase	3.79e-09	4.15e-10	NA	0.6256
2. PF	Q9UUN9	Aldehyde reductase 2	2.10e-14	2.12e-06	NA	0.6517
2. PF	Q9N119	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	3.33e-16	6.13e-27	NA	0.7071
2. PF	Q6GBT4	Uncharacterized epimerase/dehydratase SAS0511	0.00e+00	2.23e-34	NA	0.7853
2. PF	A8EZA9	UDP-glucose 4-epimerase	1.21e-11	5.03e-07	NA	0.6289
2. PF	Q4UM33	UDP-glucose 4-epimerase	1.55e-11	2.53e-07	NA	0.6298
2. PF	Q7PCC4	Anthocyanidin reductase ((2S)-flavan-3-ol-forming)	1.22e-14	3.47e-11	NA	0.6986
2. PF	P27365	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1	7.77e-16	2.05e-24	NA	0.7116
2. PF	Q05342	CDP-abequose synthase	3.33e-16	4.94e-19	NA	0.7911
2. PF	Q4WZ69	Festuclavine dehydrogenase easG	2.87e-13	5.67e-08	NA	0.5894
2. PF	Q5HHP9	Epimerase family protein SACOL0834	2.11e-15	9.95e-17	NA	0.757
2. PF	Q87T56	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.29e-39	NA	0.7684
2. PF	P26392	dTDP-4-dehydrorhamnose reductase	0.00e+00	5.29e-09	NA	0.7712
2. PF	E1ACP6	NmrA-like family domain-containing oxidoreductase notA	8.80e-05	1.28e-04	NA	0.5054
2. PF	Q8Y0X8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.84e-40	NA	0.7183
2. PF	A0A221J5W8	(S)-8-oxocitronellyl enol synthase ISY1	1.44e-14	6.20e-07	NA	0.7081
2. PF	A8GRN9	UDP-glucose 4-epimerase	1.30e-11	2.07e-07	NA	0.6328
2. PF	Q566L8	Methionine adenosyltransferase 2 subunit beta	0.00e+00	5.51e-13	NA	0.7237
2. PF	P48279	Uncharacterized protein ycf39	0.00e+00	1.89e-04	NA	0.7035
2. PF	Q6GB61	Epimerase family protein SAS0734	1.89e-15	4.10e-17	NA	0.7618
2. PF	Q8EG63	2-alkyl-3-oxoalkanoate reductase	0.00e+00	2.89e-13	NA	0.7521
2. PF	Q5FB34	Anthocyanidin reductase ((2S)-flavan-3-ol-forming)	1.11e-14	3.03e-11	NA	0.7015
2. PF	Q9XES5	Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase	2.55e-15	2.91e-11	NA	0.7188
2. PF	Q7A1Q7	Uncharacterized epimerase/dehydratase MW0508	0.00e+00	2.23e-34	NA	0.789
2. PF	Q1R1N5	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.41e-41	NA	0.7753
2. PF	Q29RI9	Methionine adenosyltransferase 2 subunit beta	0.00e+00	1.39e-12	NA	0.7172
2. PF	A0A221J5X3	(S)-8-oxocitronellyl enol synthase ISY1	1.24e-14	1.07e-06	NA	0.7161
2. PF	Q5HRJ9	Uncharacterized epimerase/dehydratase SERP0194	0.00e+00	5.77e-35	NA	0.7691
2. PF	H1ZZB0	Aurachin B dehydrogenase	0.00e+00	1.05e-28	NA	0.702
2. PF	A0A0D1BUI1	Fatty acid hydroxylase uhd1	9.11e-13	2.62e-06	NA	0.7274
2. PF	E5F146	dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD(P)(+))	0.00e+00	1.51e-26	NA	0.8019
2. PF	A8F1A5	UDP-glucose 4-epimerase	1.05e-11	2.78e-07	NA	0.6237
2. PF	P51238	Uncharacterized protein ycf39	1.11e-16	1.10e-04	NA	0.6875
2. PF	Q2L2R8	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.83e-38	NA	0.7497
2. PF	Q56623	UDP-glucose 4-epimerase	0.00e+00	3.21e-25	NA	0.7343
2. PF	O19883	Uncharacterized protein ycf39	9.08e-11	6.24e-06	NA	0.5875
2. PF	Q9RR27	Probable dTDP-4,6-dihydroxy-2-methyloxan-3-one 4-ketoreductase	0.00e+00	6.07e-09	NA	0.7786
2. PF	P0AC89	GDP-mannose 4,6-dehydratase	0.00e+00	2.00e-21	NA	0.8013
2. PF	Q6Q878	Short chain dehydrogenase sirS	1.79e-13	7.12e-13	NA	0.696
2. PF	Q8L2J6	UDP-glucose 4-epimerase	1.16e-11	1.98e-06	NA	0.6358
2. PF	Q331Q7	dTDP-4-dehydro-6-deoxy-D-allose reductase	0.00e+00	4.37e-26	NA	0.8054
2. PF	Q2FIM4	Epimerase family protein SAUSA300_0753	3.00e-15	9.95e-17	NA	0.765
2. PF	Q8DE09	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	4.40e-39	NA	0.7855
2. PF	Q9ZDJ5	UDP-glucose 4-epimerase	9.79e-10	1.43e-06	NA	0.6381
2. PF	Q4JBJ3	UDP-sulfoquinovose synthase	0.00e+00	2.96e-24	NA	0.7912
2. PF	Q9L9E9	dTDP-4-keto-6-deoxy-D-glucose reductase	0.00e+00	1.19e-08	NA	0.7996
2. PF	Q9JRN5	GDP-mannose 4,6-dehydratase	0.00e+00	9.26e-23	NA	0.785
2. PF	A0A1C9CX66	(S)-8-oxocitronellyl enol synthase CYC2	9.10e-15	5.09e-08	NA	0.7179
2. PF	Q3ZBE9	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating	1.11e-16	3.78e-23	NA	0.7451
2. PF	P9WQP6	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	0.00e+00	8.41e-29	NA	0.719
2. PF	A0A1Y0BRF3	Ketoreductase adrE	1.97e-09	7.64e-05	NA	0.6747
2. PF	P14720	Dihydroflavonol 4-reductase	8.33e-15	9.39e-09	NA	0.7185
2. PF	Q7A788	Uncharacterized epimerase/dehydratase SA0511	0.00e+00	2.23e-34	NA	0.7867
2. PF	Q8CQ79	Uncharacterized epimerase/dehydratase SE_0317	0.00e+00	5.77e-35	NA	0.7807
2. PF	O32960	Epimerase family protein ML0860	2.04e-14	6.44e-11	NA	0.7158
2. PF	Q84KI6	UDP-sulfoquinovose synthase, chloroplastic	0.00e+00	6.75e-04	NA	0.7805
2. PF	Q5E8J9	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.61e-38	NA	0.7831
2. PF	P9WGP6	Epimerase family protein MT2273	1.18e-14	9.46e-13	NA	0.7253
2. PF	Q5SFA6	dTDP-4-dehydro-6-deoxy-D-allose reductase	0.00e+00	1.18e-26	NA	0.8181
2. PF	B2FI29	2-alkyl-3-oxoalkanoate reductase	0.00e+00	1.75e-28	NA	0.7084
2. PF	P73467	Epimerase family protein slr1223	4.44e-16	5.19e-14	NA	0.7613
2. PF	Q5IFP1	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	6.66e-16	5.92e-26	NA	0.7083
2. PF	Q56872	GDP-mannose 4,6-dehydratase	0.00e+00	8.82e-19	NA	0.8122
2. PF	A0A221J5X6	(S)-8-oxocitronellyl enol synthase ISY2	1.07e-14	9.99e-09	NA	0.7225
2. PF	P51105	Dihydroflavonol 4-reductase	3.00e-15	4.34e-05	NA	0.7156
2. PF	P49534	Uncharacterized protein ycf39	2.22e-16	3.24e-06	NA	0.6701
2. PF	Q2YSA8	Uncharacterized epimerase/dehydratase SAB0504	0.00e+00	1.10e-34	NA	0.7867
2. PF	P33217	GDP-L-fucose synthase	0.00e+00	2.41e-23	NA	0.7792
2. PF	Q3SK74	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	8.56e-40	NA	0.7321
2. PF	Q06952	GDP-mannose 4,6-dehydratase	0.00e+00	2.16e-20	NA	0.8104
2. PF	Q60555	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1	7.77e-16	2.09e-25	NA	0.7543
2. PF	Q8KU07	NAD(P)H azoreductase	3.86e-13	1.06e-04	NA	0.7275
3. BF	Q32DT3	Bifunctional polymyxin resistance protein ArnA	5.56e-14	NA	0.030	0.7662
3. BF	C4ZU97	Bifunctional polymyxin resistance protein ArnA	4.59e-14	NA	0.029	0.7653
3. BF	B5R272	Bifunctional polymyxin resistance protein ArnA	3.83e-14	NA	0.012	0.7514
3. BF	B4SYX1	Bifunctional polymyxin resistance protein ArnA	3.77e-14	NA	0.041	0.7452
3. BF	B1IXT2	Bifunctional polymyxin resistance protein ArnA	4.83e-14	NA	0.029	0.7869
3. BF	C6DAW5	Bifunctional polymyxin resistance protein ArnA	5.97e-14	NA	0.045	0.7565
3. BF	B7MXT6	Bifunctional polymyxin resistance protein ArnA	5.76e-14	NA	0.028	0.7445
3. BF	C0Q069	Bifunctional polymyxin resistance protein ArnA	3.71e-14	NA	0.042	0.7454
3. BF	A0KGY6	Bifunctional polymyxin resistance protein ArnA	2.41e-14	NA	0.044	0.7745
3. BF	B7MG22	Bifunctional polymyxin resistance protein ArnA	5.86e-14	NA	0.022	0.7507
3. BF	A1ADA7	Bifunctional polymyxin resistance protein ArnA	5.67e-14	NA	0.022	0.7616
3. BF	P56600	Bifunctional protein GAL10 (Fragment)	6.21e-14	NA	6.09e-24	0.8463
3. BF	B5XTK9	Bifunctional polymyxin resistance protein ArnA	4.09e-14	NA	5.42e-04	0.7592
3. BF	B7UFR7	Bifunctional polymyxin resistance protein ArnA	5.73e-14	NA	0.015	0.7489
3. BF	B5FNT9	Bifunctional polymyxin resistance protein ArnA	3.94e-14	NA	0.045	0.7452
3. BF	Q2NRV7	Bifunctional polymyxin resistance protein ArnA	4.46e-14	NA	0.018	0.7544
3. BF	B4TPI2	Bifunctional polymyxin resistance protein ArnA	3.75e-14	NA	0.007	0.7628
3. BF	B7LM76	Bifunctional polymyxin resistance protein ArnA	5.23e-14	NA	0.024	0.7564
3. BF	B7LAS0	Bifunctional polymyxin resistance protein ArnA	5.61e-14	NA	0.030	0.7676
3. BF	A4SQW9	Bifunctional polymyxin resistance protein ArnA	2.71e-14	NA	0.005	0.7598
3. BF	A8A2C2	Bifunctional polymyxin resistance protein ArnA	5.44e-14	NA	0.028	0.7597
3. BF	A0A1B4XBH2	GDP-mannose 4,6-dehydratase sdnI	0.00e+00	NA	6.80e-06	0.8117
3. BF	Q1R9G0	Bifunctional polymyxin resistance protein ArnA	5.66e-14	NA	0.022	0.7488
3. BF	Q48HZ1	Bifunctional polymyxin resistance protein ArnA	3.02e-14	NA	0.015	0.7608
3. BF	A4WAM3	Bifunctional polymyxin resistance protein ArnA	5.12e-14	NA	0.047	0.7598
3. BF	Q3YZV1	Bifunctional polymyxin resistance protein ArnA	5.85e-14	NA	0.022	0.7446
3. BF	A7ZP73	Bifunctional polymyxin resistance protein ArnA	5.75e-14	NA	0.030	0.761
3. BF	O52325	Bifunctional polymyxin resistance protein ArnA	3.97e-14	NA	0.011	0.7452
3. BF	B1LLK9	Bifunctional polymyxin resistance protein ArnA	5.37e-14	NA	0.032	0.7492
3. BF	B7NNT4	Bifunctional polymyxin resistance protein ArnA	5.70e-14	NA	0.030	0.7616
3. BF	B5YXP8	Bifunctional polymyxin resistance protein ArnA	5.71e-14	NA	0.029	0.7659
3. BF	A6TF98	Bifunctional polymyxin resistance protein ArnA	4.25e-14	NA	0.001	0.7609
3. BF	Q4ZSZ2	Bifunctional polymyxin resistance protein ArnA	1.11e-15	NA	0.006	0.7717
3. BF	P35675	Uncharacterized protein in galE 3'region (Fragment)	2.52e-13	NA	1.53e-10	0.8283
3. BF	Q8FFM1	Bifunctional polymyxin resistance protein ArnA	5.55e-14	NA	0.032	0.7446
3. BF	P45602	UDP-glucose 4-epimerase (Fragment)	5.55e-16	NA	2.45e-24	0.9088
3. BF	Q4KC82	Bifunctional polymyxin resistance protein ArnA	3.32e-14	NA	0.027	0.793
3. BF	P0C0R6	Bifunctional polymyxin resistance protein ArnA	3.73e-14	NA	0.046	0.7456
3. BF	A1JPN5	Bifunctional polymyxin resistance protein ArnA	5.36e-14	NA	0.024	0.7682
3. BF	B1X8W8	Bifunctional polymyxin resistance protein ArnA	5.00e-14	NA	0.029	0.8009
3. BF	B6I7J8	Bifunctional polymyxin resistance protein ArnA	5.53e-14	NA	0.030	0.7446
3. BF	P09609	Bifunctional protein GAL10	0.00e+00	NA	6.19e-57	0.9419
3. BF	Q31YK2	Bifunctional polymyxin resistance protein ArnA	5.68e-14	NA	0.028	0.7428
3. BF	B5EZH8	Bifunctional polymyxin resistance protein ArnA	3.85e-14	NA	0.011	0.7516
3. BF	P40801	Bifunctional protein GAL10	0.00e+00	NA	2.19e-51	0.9417
3. BF	B7N5M0	Bifunctional polymyxin resistance protein ArnA	5.56e-14	NA	0.029	0.7664
3. BF	B5RCC4	Bifunctional polymyxin resistance protein ArnA	3.99e-14	NA	0.020	0.7452
3. BF	Q8XDZ3	Bifunctional polymyxin resistance protein ArnA	5.64e-14	NA	0.029	0.7609
3. BF	B4TBG6	Bifunctional polymyxin resistance protein ArnA	3.63e-14	NA	0.012	0.7433
3. BF	A9N5B2	Bifunctional polymyxin resistance protein ArnA	3.65e-14	NA	0.011	0.7632
3. BF	B7M5T7	Bifunctional polymyxin resistance protein ArnA	5.67e-14	NA	0.030	0.7675
3. BF	B2TW38	Putative bifunctional polymyxin resistance protein ArnA	2.78e-15	NA	0.025	0.7688
4. PB	O22141	UDP-glucuronate 4-epimerase 4	0.00e+00	4.01e-06	2.96e-19	NA
4. PB	O35469	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6	4.44e-16	1.69e-26	0.020	NA
4. PB	P18645	UDP-glucose 4-epimerase	0.00e+00	3.90e-42	1.66e-62	NA
4. PB	P37759	dTDP-glucose 4,6-dehydratase 1	0.00e+00	1.20e-24	4.96e-11	NA
4. PB	A5UIN9	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.54e-40	0.001	NA
4. PB	Q58455	Uncharacterized protein MJ1055	0.00e+00	3.81e-42	2.53e-15	NA
4. PB	O95455	dTDP-D-glucose 4,6-dehydratase	0.00e+00	1.91e-20	1.04e-11	NA
4. PB	Q8LDN8	Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3	0.00e+00	1.60e-37	8.03e-61	NA
4. PB	Q5PQX0	UDP-glucuronic acid decarboxylase 1	0.00e+00	2.14e-06	8.32e-05	NA
4. PB	Q4QLI0	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.72e-40	0.001	NA
4. PB	Q42605	Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1	0.00e+00	1.05e-36	6.01e-61	NA
4. PB	Q9SN58	UDP-glucose 4-epimerase 5	0.00e+00	1.13e-39	6.90e-67	NA
4. PB	Q8S9Z2	UDP-D-apiose/UDP-D-xylose synthase	0.00e+00	5.15e-27	0.004	NA
4. PB	Q553X7	UDP-glucose 4-epimerase	0.00e+00	3.55e-42	8.89e-60	NA
4. PB	Q9FI17	Putative UDP-arabinose 4-epimerase 4	0.00e+00	3.86e-05	2.90e-52	NA
4. PB	O35048	3 beta-hydroxysteroid dehydrogenase type 7	1.88e-08	3.33e-22	6.67e-07	NA
4. PB	Q91XL3	UDP-glucuronic acid decarboxylase 1	0.00e+00	9.48e-07	7.95e-05	NA
4. PB	Q564Q1	UDP-glucose 4-epimerase	0.00e+00	4.13e-44	3.97e-50	NA
4. PB	P26150	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3	8.88e-16	8.82e-27	0.003	NA
4. PB	B0UWU3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	8.19e-38	6.43e-05	NA
4. PB	Q8VDR7	dTDP-D-glucose 4,6-dehydratase	0.00e+00	1.27e-21	2.16e-10	NA
4. PB	Q9ZUY6	UDP-D-apiose/UDP-D-xylose synthase 1	0.00e+00	1.49e-29	2.39e-05	NA
4. PB	P9WN65	dTDP-glucose 4,6-dehydratase	0.00e+00	1.61e-24	1.74e-09	NA
4. PB	Q54WS6	dTDP-D-glucose 4,6-dehydratase	0.00e+00	2.47e-11	8.72e-13	NA
4. PB	Q9ZV36	UDP-glucuronic acid decarboxylase 6	0.00e+00	1.91e-18	2.66e-08	NA
4. PB	Q8R059	UDP-glucose 4-epimerase	0.00e+00	2.33e-44	1.15e-64	NA
4. PB	Q6GMI9	UDP-glucuronic acid decarboxylase 1	0.00e+00	1.83e-05	1.49e-04	NA
4. PB	Q8H930	Probable UDP-arabinose 4-epimerase 1	0.00e+00	5.56e-11	3.62e-49	NA
4. PB	P27830	dTDP-glucose 4,6-dehydratase 2	0.00e+00	1.79e-26	1.89e-15	NA
4. PB	Q9SUN3	Probable UDP-arabinose 4-epimerase 3	0.00e+00	1.10e-10	6.64e-51	NA
4. PB	Q7CRQ0	Uronate dehydrogenase	4.22e-09	1.84e-15	6.25e-04	NA
4. PB	Q8H0B2	Probable UDP-arabinose 4-epimerase 3	0.00e+00	1.03e-14	4.42e-49	NA
4. PB	Q9M0B6	UDP-glucuronate 4-epimerase 1	0.00e+00	4.05e-10	5.40e-14	NA
4. PB	Q9T0A7	UDP-glucose 4-epimerase 2	0.00e+00	1.62e-39	6.15e-65	NA
4. PB	A3C4S4	GDP-mannose 3,5-epimerase 1	0.00e+00	6.17e-30	6.64e-04	NA
4. PB	O81312	UDP-glucuronate 4-epimerase 3	0.00e+00	9.96e-08	3.66e-17	NA
4. PB	Q6GZS4	Uncharacterized protein 052L	NA	6.77e-29	1.65e-05	NA
4. PB	Q9LPC1	UDP-glucuronate 4-epimerase 2	0.00e+00	6.46e-09	1.00e-16	NA
4. PB	A8DZE7	Short-chain dehydrogenase/reductase family 42E member 1	1.11e-16	2.37e-19	6.73e-07	NA
4. PB	P9WN67	UDP-glucose 4-epimerase	0.00e+00	2.88e-34	1.02e-10	NA
4. PB	Q9LZI2	UDP-glucuronic acid decarboxylase 2	0.00e+00	1.01e-02	4.80e-08	NA
4. PB	Q9D665	Short-chain dehydrogenase/reductase family 42E member 1	3.38e-12	2.51e-22	6.27e-05	NA
4. PB	O43050	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating	0.00e+00	2.83e-26	0.002	NA
4. PB	Q31FG4	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	6.47e-39	0.002	NA
4. PB	Q9H2F3	3 beta-hydroxysteroid dehydrogenase type 7	1.22e-15	4.51e-24	4.34e-05	NA
4. PB	Q9W0P5	UDP-glucose 4-epimerase	0.00e+00	2.30e-41	2.76e-63	NA
4. PB	Q9C7W7	UDP-glucose 4-epimerase 4	0.00e+00	3.72e-42	6.89e-64	NA
4. PB	Q9SA77	UDP-arabinose 4-epimerase 1	0.00e+00	1.19e-13	1.76e-55	NA
4. PB	P26149	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2	5.55e-16	5.67e-27	0.010	NA
4. PB	Q9STI6	UDP-glucuronate 4-epimerase 5	0.00e+00	1.68e-08	2.89e-12	NA
4. PB	Q9EQC1	3 beta-hydroxysteroid dehydrogenase type 7	1.22e-15	5.61e-25	4.65e-08	NA
4. PB	P21097	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	NA	5.29e-35	0.005	NA
4. PB	P67910	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	9.71e-39	2.84e-05	NA
4. PB	Q65WA7	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	2.23e-38	4.80e-05	NA
4. PB	Q57664	Putative UDP-glucose 4-epimerase	0.00e+00	3.15e-35	1.97e-31	NA
4. PB	Q14376	UDP-glucose 4-epimerase	0.00e+00	8.96e-40	1.19e-62	NA
4. PB	Q8LNZ3	UDP-glucose 4-epimerase 1	0.00e+00	3.75e-41	3.01e-66	NA
4. PB	Q8WUS8	Short-chain dehydrogenase/reductase family 42E member 1	2.58e-12	1.08e-19	9.24e-08	NA
4. PB	Q9Y7X5	UDP-glucose 4-epimerase uge1	0.00e+00	1.22e-44	7.14e-69	NA
4. PB	A0KQV3	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	5.13e-44	0.004	NA
4. PB	Q8H0B6	Probable UDP-arabinose 4-epimerase 2	0.00e+00	5.46e-22	4.34e-48	NA
4. PB	Q9FIE8	UDP-glucuronic acid decarboxylase 3	0.00e+00	1.46e-19	3.13e-06	NA
4. PB	Q8S8T4	UDP-glucuronic acid decarboxylase 4	0.00e+00	1.23e-03	2.00e-07	NA
4. PB	Q8NBZ7	UDP-glucuronic acid decarboxylase 1	0.00e+00	1.06e-06	9.93e-05	NA
4. PB	O57245	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	NA	7.86e-36	0.005	NA
4. PB	Q9SGE0	UDP-D-apiose/UDP-D-xylose synthase 2	0.00e+00	4.46e-29	2.27e-05	NA
4. PB	Q5UR12	Putative dTDP-D-glucose 4,6-dehydratase	NA	1.33e-30	2.43e-08	NA
4. PB	Q9SN95	UDP-glucuronic acid decarboxylase 5	0.00e+00	1.39e-19	3.12e-07	NA
4. PB	Q9LIS3	UDP-glucuronate 4-epimerase 6	0.00e+00	1.99e-04	2.54e-15	NA
4. PB	Q6ZDJ7	UDP-glucose 4-epimerase 2	0.00e+00	8.19e-11	9.78e-68	NA
4. PB	A6VLD2	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.13e-39	2.48e-04	NA
4. PB	A4SHC0	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	3.10e-44	8.79e-05	NA
4. PB	P26670	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	NA	2.00e-35	0.006	NA
4. PB	O64749	Putative UDP-arabinose 4-epimerase 2	0.00e+00	5.20e-13	4.95e-53	NA
4. PB	Q3A8K5	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	1.09e-38	1.77e-04	NA
4. PB	Q652A8	UDP-glucose 4-epimerase 3	0.00e+00	2.31e-29	3.30e-56	NA
4. PB	P09147	UDP-glucose 4-epimerase	0.00e+00	6.28e-52	4.36e-68	NA
4. PB	P53199	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating	0.00e+00	4.20e-29	5.84e-09	NA
4. PB	Q2R1V8	GDP-mannose 3,5-epimerase 2	0.00e+00	9.41e-30	0.009	NA
4. PB	Q6K2E1	UDP-glucose 4-epimerase 4	0.00e+00	1.93e-28	1.98e-68	NA
5. P	Q8K0C9	GDP-mannose 4,6 dehydratase	0.00e+00	8.36e-17	NA	NA
5. P	B6VRE6	Isoflavone reductase homolog A622-like	4.57e-08	9.40e-05	NA	NA
5. P	Q6K9A2	Cinnamoyl-CoA reductase 1	4.66e-15	8.75e-07	NA	NA
5. P	E9F8M1	Oxidoreductase swnN	3.47e-08	1.10e-05	NA	NA
5. P	A8H0U0	Malate dehydrogenase	1.62e-03	2.48e-02	NA	NA
5. P	O81355	Phenylcoumaran benzylic ether reductase Pyrc5	5.21e-08	8.96e-06	NA	NA
5. P	Q65T37	Malate dehydrogenase	2.31e-03	8.76e-03	NA	NA
5. P	Q9SK66	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	1.24e-13	4.79e-02	NA	NA
5. P	Q9LD12	Bifunctional pinoresinol-lariciresinol reductase	5.56e-08	9.67e-06	NA	NA
5. P	Q9LQ04	Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase	2.66e-15	1.87e-10	NA	NA
5. P	B7M0U8	Malate dehydrogenase	2.58e-03	1.57e-02	NA	NA
5. P	Q55C77	GDP-L-fucose synthase	0.00e+00	6.83e-23	NA	NA
5. P	A1AGC9	Malate dehydrogenase	1.98e-03	3.32e-02	NA	NA
5. P	O22133	Protein BRI1-5 ENHANCED 1	2.66e-15	1.79e-03	NA	NA
5. P	A4WF48	Malate dehydrogenase	2.81e-03	3.32e-02	NA	NA
5. P	Q9NRG7	Epimerase family protein SDR39U1	3.62e-14	7.61e-17	NA	NA
5. P	B2WSN0	Eugenol synthase 2	6.45e-08	1.49e-04	NA	NA
5. P	A0A1C9CX56	(S)-8-oxocitronellyl enol synthase CYC1	3.97e-14	8.65e-07	NA	NA
5. P	P41400	Aspartate-semialdehyde dehydrogenase	3.03e-02	1.96e-02	NA	NA
5. P	P0A1F8	Aspartate-semialdehyde dehydrogenase	5.74e-02	1.88e-02	NA	NA
5. P	P52578	Isoflavone reductase homolog	4.45e-08	8.72e-04	NA	NA
5. P	Q84V83	Leucoanthocyanidin reductase	2.71e-06	8.60e-03	NA	NA
5. P	Q5E875	Malate dehydrogenase	2.54e-03	1.42e-02	NA	NA
5. P	K7WDL7	(S)-8-oxocitronellyl enol synthase	2.96e-14	6.02e-08	NA	NA
5. P	Q2NGI3	Malate dehydrogenase	9.73e-03	1.48e-04	NA	NA
5. P	Q15GI3	Isoeugenol synthase 1	3.03e-12	7.69e-06	NA	NA
5. P	B9HRL7	Phenylcoumaran benzylic ether reductase POP1	6.28e-08	3.23e-05	NA	NA
5. P	Q0MQB4	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	5.53e-14	2.99e-03	NA	NA
5. P	I1LHU6	Isoflavone reductase	3.80e-08	2.39e-04	NA	NA
5. P	P61890	Malate dehydrogenase	1.99e-03	3.32e-02	NA	NA
5. P	B5F7L9	Malate dehydrogenase	2.69e-03	1.41e-02	NA	NA
5. P	P96198	Aspartate-semialdehyde dehydrogenase	5.19e-02	3.50e-02	NA	NA
5. P	B5FIT7	Malate dehydrogenase	2.53e-03	1.67e-02	NA	NA
5. P	O74913	Uncharacterized protein C757.02c	5.20e-14	6.88e-09	NA	NA
5. P	Q62878	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4	3.33e-16	2.37e-24	NA	NA
5. P	B7LRL0	Malate dehydrogenase	2.72e-03	2.46e-02	NA	NA
5. P	Q54L85	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating	1.11e-16	1.32e-24	NA	NA
5. P	Q9ZDL2	Aspartate-semialdehyde dehydrogenase	1.77e-02	4.17e-02	NA	NA
5. P	A0A0B6VQ48	Phenylacetaldehyde reductase	3.55e-15	1.92e-08	NA	NA
5. P	Q7WS85	Malate dehydrogenase	2.35e-03	1.41e-02	NA	NA
5. P	Q31WA4	Malate dehydrogenase	1.99e-03	3.32e-02	NA	NA
5. P	Q6AW21	Malate dehydrogenase	2.36e-03	3.59e-02	NA	NA
5. P	A0A411KUU5	Oxidase ucsJ	3.72e-13	7.25e-17	NA	NA
5. P	Q67WR2	Probable GDP-L-fucose synthase 1	0.00e+00	4.11e-18	NA	NA
5. P	Q0D1P7	NAD-dependent epimerase/dehydratase terH	2.12e-14	2.65e-07	NA	NA
5. P	Q9T030	Phenylcoumaran benzylic ether reductase 1	6.12e-08	7.24e-04	NA	NA
5. P	O65679	Probable pinoresinol-lariciresinol reductase 3	8.67e-08	3.72e-03	NA	NA
5. P	Q0T052	Malate dehydrogenase	2.54e-03	2.66e-02	NA	NA
5. P	A8A545	Malate dehydrogenase	1.95e-03	3.32e-02	NA	NA
5. P	B1KGG7	Malate dehydrogenase	1.73e-03	4.32e-02	NA	NA
5. P	Q16795	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	5.43e-14	3.86e-03	NA	NA
5. P	Q61694	NADPH-dependent 3-keto-steroid reductase Hsd3b5	5.55e-16	6.88e-26	NA	NA
5. P	Q7VP41	Malate dehydrogenase	1.91e-03	2.54e-02	NA	NA
5. P	Q9HDU4	Uncharacterized protein PB2B2.11	0.00e+00	8.14e-25	NA	NA
5. P	Q8K3X2	GDP-L-fucose synthase	0.00e+00	7.20e-20	NA	NA
5. P	Q5XLY0	Putative anthocyanidin reductase	1.55e-14	5.46e-10	NA	NA
5. P	A1ZAI3	Putative fatty acyl-CoA reductase CG8303	6.10e-12	4.35e-02	NA	NA
5. P	W6QRI9	Festuclavine synthase I	4.47e-12	4.14e-06	NA	NA
5. P	Q9SAH9	Cinnamoyl-CoA reductase 2	6.66e-16	6.79e-08	NA	NA
5. P	P27364	NADPH-dependent 3-keto-steroid reductase Hsd3b5	6.66e-16	1.72e-26	NA	NA
5. P	A0A2Z5TWF0	NmrA-like family domain-containing oxidoreductase himF	2.09e-05	3.86e-03	NA	NA
5. P	Q4R0H9	Bifunctional pinoresinol-lariciresinol reductase 1	4.79e-08	6.96e-04	NA	NA
5. P	P0C7R5	Malate dehydrogenase	2.51e-03	1.58e-02	NA	NA
5. P	Q67477	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	NA	2.34e-26	NA	NA
5. P	A7FMU2	Malate dehydrogenase	2.15e-03	1.58e-02	NA	NA
5. P	B7NDL4	Malate dehydrogenase	2.63e-03	4.06e-02	NA	NA
5. P	B7LHU4	Malate dehydrogenase	2.55e-03	1.57e-02	NA	NA
5. P	A4TRK3	Malate dehydrogenase	2.16e-03	1.58e-02	NA	NA
5. P	P22071	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1	7.77e-16	4.95e-24	NA	NA
5. P	Q03049	Putative uncharacterized oxidoreductase YDR541C	1.67e-15	2.81e-13	NA	NA
5. P	Q67WR5	Putative GDP-L-fucose synthase 2	0.00e+00	3.36e-20	NA	NA
5. P	P52580	Isoflavone reductase homolog IRL	1.27e-07	5.36e-03	NA	NA
5. P	Q9SVP6	Pinoresinol reductase 2	5.80e-08	1.05e-03	NA	NA
5. P	B2VGW7	Malate dehydrogenase	2.20e-03	1.46e-02	NA	NA
5. P	G5EER4	GDP-L-fucose synthase	0.00e+00	1.50e-23	NA	NA
5. P	P23591	GDP-L-fucose synthase	0.00e+00	1.51e-19	NA	NA
5. P	Q54LJ8	NmrA-like family domain-containing protein DDB_G0286605	1.06e-08	7.64e-05	NA	NA
5. P	L0E2U6	NmrA-like family domain-containing oxidoreductase phqG	1.54e-05	9.25e-04	NA	NA
5. P	A9R584	Malate dehydrogenase	2.02e-03	1.58e-02	NA	NA
5. P	A6NKP2	Putative short-chain dehydrogenase/reductase family 42E member 2	1.78e-15	4.48e-14	NA	NA
5. P	Q61767	NADPH-dependent 3-keto-steroid reductase Hsd3b4	7.77e-16	1.37e-24	NA	NA
5. P	P9WQP7	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase	0.00e+00	8.41e-29	NA	NA
5. P	Q6Q885	Short chain dehydrogenase sirR	1.38e-13	6.44e-11	NA	NA
5. P	B5YSW2	Malate dehydrogenase	1.94e-03	3.32e-02	NA	NA
5. P	P32055	GDP-L-fucose synthase	0.00e+00	1.31e-25	NA	NA
5. P	Q5U2R0	Methionine adenosyltransferase 2 subunit beta	0.00e+00	4.75e-12	NA	NA
5. P	Q72RJ9	N-acetyl-gamma-glutamyl-phosphate reductase	1.15e-01	3.53e-02	NA	NA
5. P	Q3YX11	Malate dehydrogenase	1.82e-03	3.32e-02	NA	NA
5. P	B5YAL8	N-acetyl-gamma-glutamyl-phosphate reductase	4.69e-02	4.96e-02	NA	NA
5. P	B6I1V4	Malate dehydrogenase	2.56e-03	2.83e-02	NA	NA
5. P	Q9LMU0	Putative GDP-L-fucose synthase 2	0.00e+00	3.13e-24	NA	NA
5. P	C6DKH1	Malate dehydrogenase	2.18e-03	1.05e-02	NA	NA
5. P	P52581	Isoflavone reductase homolog	6.63e-08	3.23e-05	NA	NA
5. P	D9PVI7	Malate dehydrogenase	7.67e-03	4.86e-07	NA	NA
5. P	P53183	Putative uncharacterized oxidoreductase YGL039W	2.89e-15	2.77e-10	NA	NA
5. P	M1WEN5	Agroclavine dehydrogenase	2.47e-12	1.97e-05	NA	NA
5. P	A1SRP8	Malate dehydrogenase	1.67e-03	2.83e-02	NA	NA
5. P	B5XSQ7	Malate dehydrogenase	2.62e-03	2.05e-02	NA	NA
5. P	B1VN94	(4-alkanoyl-5-oxo-2,5-dihydrofuran-3-yl)methyl phosphate reductase	4.19e-14	3.75e-06	NA	NA
5. P	P48364	Malate dehydrogenase	2.38e-03	2.52e-02	NA	NA
5. P	Q0MQB3	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	5.53e-14	5.17e-03	NA	NA
5. P	B6VRE8	Phenylcoumaran benzylic ether reductase TP7	6.95e-08	1.31e-05	NA	NA
5. P	B8NWW2	NmrA-like family domain-containing oxidoreductase lnbB	1.38e-05	4.63e-04	NA	NA
5. P	Q58461	Uncharacterized membrane protein MJ1061	2.22e-16	8.86e-12	NA	NA
5. P	A0A221J5P3	(S)-8-oxocitronellyl enol synthase	1.38e-14	4.40e-08	NA	NA
5. P	Q9SA52	Chloroplast stem-loop binding protein of 41 kDa b, chloroplastic	5.55e-15	1.18e-11	NA	NA
5. P	A9N855	Malate dehydrogenase	2.43e-03	1.41e-02	NA	NA
5. P	Q57JA9	Malate dehydrogenase	2.34e-03	1.96e-02	NA	NA
5. P	B1LGK2	Malate dehydrogenase	2.54e-03	2.76e-02	NA	NA
5. P	P59307	N-acetyl-gamma-glutamyl-phosphate reductase	8.66e-02	1.93e-02	NA	NA
5. P	D4GS48	NAD-dependent glucose-6-phosphate dehydrogenase	1.48e-07	2.45e-07	NA	NA
5. P	Q0I491	Malate dehydrogenase	2.26e-03	3.45e-03	NA	NA
5. P	Q6D9D1	Malate dehydrogenase	1.89e-03	2.46e-02	NA	NA
5. P	Q5P2S1	ADP-L-glycero-D-manno-heptose-6-epimerase	0.00e+00	8.37e-38	NA	NA
5. P	Q4QL89	Malate dehydrogenase	2.55e-03	2.13e-02	NA	NA
5. P	P0CT21	Agroclavine dehydrogenase	3.01e-12	2.32e-05	NA	NA
5. P	Q9SEV0	Anthocyanidin reductase	4.33e-15	1.06e-15	NA	NA
5. P	P37226	Malate dehydrogenase	2.54e-03	1.01e-02	NA	NA
5. P	P44427	Malate dehydrogenase	2.86e-03	2.02e-02	NA	NA
5. P	P9WH09	dTDP-4-dehydrorhamnose reductase	2.22e-16	1.33e-06	NA	NA
5. P	Q68X56	Aspartate-semialdehyde dehydrogenase	1.70e-02	4.51e-02	NA	NA
5. P	B4TWK9	Malate dehydrogenase	2.36e-03	1.41e-02	NA	NA
5. P	A9MNX5	Malate dehydrogenase	2.64e-03	1.43e-02	NA	NA
5. P	L7WRQ4	NmrA-like family domain-containing oxidoreductase notA'	8.22e-06	4.43e-06	NA	NA
5. P	P51108	Dihydroflavonol 4-reductase	3.00e-15	7.95e-10	NA	NA
5. P	Q5ZID0	NmrA-like family domain-containing protein 1	7.01e-08	2.86e-03	NA	NA
5. P	B7NKU9	Malate dehydrogenase	2.67e-03	2.76e-02	NA	NA
5. P	Q9FX01	3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1	2.00e-15	9.52e-10	NA	NA
5. P	P0CB81	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	5.83e-14	2.29e-03	NA	NA
5. P	A3QB91	Malate dehydrogenase	1.92e-03	3.65e-02	NA	NA
5. P	B2WSN1	Eugenol synthase 1	6.62e-08	4.68e-06	NA	NA
5. P	Q9LL41	Phenylcoumaran benzylic ether reductase PT1	7.37e-08	4.87e-04	NA	NA
5. P	B4TJT3	Malate dehydrogenase	2.59e-03	1.41e-02	NA	NA
5. P	B1IQP3	Malate dehydrogenase	2.53e-03	1.58e-02	NA	NA
5. P	B0BQN0	Malate dehydrogenase	1.73e-03	1.41e-03	NA	NA
5. P	A1JIV0	Malate dehydrogenase	1.92e-03	2.23e-02	NA	NA
5. P	Q0VCN1	NmrA-like family domain-containing protein 1	1.69e-07	2.67e-04	NA	NA
5. P	P0A1F9	Aspartate-semialdehyde dehydrogenase	5.61e-02	1.88e-02	NA	NA
5. P	D0VWT0	Eugenol synthase 1	2.05e-12	2.78e-03	NA	NA
5. P	P0AD13	Protein YeeZ	7.11e-15	6.07e-05	NA	NA
5. P	B7MBZ7	Malate dehydrogenase	1.84e-03	3.32e-02	NA	NA
5. P	Q93ZB9	Fatty acyl-CoA reductase 3	1.37e-06	4.03e-02	NA	NA
5. P	Q54LW0	Prestalk A differentiation protein A	2.23e-12	1.12e-06	NA	NA
5. P	Q60176	L-2-hydroxycarboxylate dehydrogenase (NAD(P)(+))	4.33e-03	3.26e-02	NA	NA
5. P	Q9FUW6	Phenylcoumaran benzylic ether reductase Betv6	5.07e-08	3.19e-05	NA	NA
5. P	P15904	Protochlorophyllide reductase (Fragment)	1.22e-03	2.88e-02	NA	NA
5. P	A8AQC8	Malate dehydrogenase	2.82e-03	2.15e-02	NA	NA
5. P	O49213	GDP-L-fucose synthase 1	0.00e+00	7.42e-25	NA	NA
5. P	C0PZQ4	Malate dehydrogenase	2.31e-03	1.41e-02	NA	NA
5. P	Q2G035	Epimerase family protein SAOUHSC_00792	2.00e-15	9.95e-17	NA	NA
5. P	Q99LB6	Methionine adenosyltransferase 2 subunit beta	0.00e+00	1.92e-12	NA	NA
5. P	D4AN96	Oxidoreductase swnR	6.40e-11	2.90e-06	NA	NA
5. P	O48917	UDP-sulfoquinovose synthase, chloroplastic	0.00e+00	1.19e-03	NA	NA
5. P	Q559Z0	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	4.36e-13	7.72e-05	NA	NA
5. P	A6TEQ3	Malate dehydrogenase	2.54e-03	1.96e-02	NA	NA
5. P	Q15738	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating	0.00e+00	7.23e-22	NA	NA
5. P	P0AD12	Protein YeeZ	2.22e-15	6.07e-05	NA	NA
5. P	P93143	Bifunctional pinoresinol-lariciresinol reductase	4.15e-08	8.94e-08	NA	NA
5. P	B8F5K4	Malate dehydrogenase	2.80e-03	1.41e-02	NA	NA
5. P	A0A0U5GGX2	Short chain dehydrogenase ausT	9.19e-14	5.39e-10	NA	NA
5. P	P0C1D9	Aspartate-semialdehyde dehydrogenase	3.43e-02	1.60e-02	NA	NA
5. P	P0AC88	GDP-mannose 4,6-dehydratase	0.00e+00	2.00e-21	NA	NA
5. P	P22072	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2	1.33e-15	1.37e-26	NA	NA
5. P	A3N1U6	Malate dehydrogenase	1.54e-03	1.84e-03	NA	NA
5. P	P0A9Q9	Aspartate-semialdehyde dehydrogenase	3.93e-01	4.88e-02	NA	NA
5. P	O25801	Aspartate-semialdehyde dehydrogenase	3.82e-02	1.43e-02	NA	NA
5. P	Q00016	Isoflavone reductase	5.24e-08	5.72e-03	NA	NA
5. P	Q0TCN0	Malate dehydrogenase	2.61e-03	3.26e-02	NA	NA
5. P	M1T9X3	Phenylcoumaran benzylic ether reductase IRL1	8.23e-08	4.09e-03	NA	NA
5. P	A3R052	Bifunctional pinoresinol-lariciresinol reductase	5.30e-08	1.91e-05	NA	NA
5. P	Q9CN86	Malate dehydrogenase	1.72e-03	3.52e-03	NA	NA
5. P	A5UIX3	Malate dehydrogenase	2.53e-03	2.43e-02	NA	NA
5. P	Q8Z3E0	Malate dehydrogenase	2.37e-03	1.36e-02	NA	NA
5. P	Q9UT59	Putative uncharacterized oxidoreductase C513.07	1.33e-15	1.37e-11	NA	NA
5. P	P61889	Malate dehydrogenase	2.01e-03	3.32e-02	NA	NA
5. P	Q2G0M5	Uncharacterized epimerase/dehydratase SAOUHSC_00535	0.00e+00	2.23e-34	NA	NA
5. P	A0ST44	Ketoreductase CTB6	1.29e-13	7.61e-12	NA	NA
5. P	Q93VR3	GDP-mannose 3,5-epimerase	0.00e+00	6.55e-30	NA	NA
5. P	B5BGR3	Malate dehydrogenase	2.40e-03	1.41e-02	NA	NA
5. P	E6Y2X0	Bifunctional pinoresinol-lariciresinol reductase 2	7.09e-08	2.34e-04	NA	NA
5. P	P61892	Malate dehydrogenase	2.28e-03	1.58e-02	NA	NA
5. P	Q32BA3	Malate dehydrogenase	2.59e-03	2.15e-02	NA	NA
5. P	P37760	dTDP-4-dehydrorhamnose reductase	0.00e+00	3.80e-08	NA	NA
5. P	Q5BJJ6	Methionine adenosyltransferase 2 subunit beta	0.00e+00	1.01e-10	NA	NA
5. P	A7MNR3	Malate dehydrogenase	2.69e-03	2.33e-02	NA	NA
5. P	Q6KYZ5	Putative [LysW]-L-2-aminoadipate/[LysW]-L-glutamate phosphate reductase	2.97e-02	2.73e-02	NA	NA
5. P	B2WSM8	Isoeugenol synthase 1	6.01e-12	5.57e-03	NA	NA
5. P	O94563	Putative uncharacterized oxidoreductase C1773.04	1.67e-15	1.14e-13	NA	NA
5. P	Q9LD14	Bifunctional pinoresinol-lariciresinol reductase 1	4.34e-08	2.55e-05	NA	NA
5. P	P24815	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1	3.33e-16	1.42e-26	NA	NA
5. P	Q9STX2	3-oxo-Delta(4,5)-steroid 5-beta-reductase	9.44e-15	1.75e-06	NA	NA
5. P	W7LL82	NAD-dependent epimerase/dehydratase FUM13	1.36e-13	9.62e-11	NA	NA
5. P	Q6AW23	Malate dehydrogenase	2.40e-03	2.27e-02	NA	NA
5. P	P83778	Malate dehydrogenase, cytoplasmic	2.94e-03	2.34e-03	NA	NA
5. P	P52575	Isoflavone reductase	3.53e-08	2.03e-04	NA	NA
5. P	Q8K2T1	NmrA-like family domain-containing protein 1	1.03e-07	4.43e-06	NA	NA
5. P	P51102	Dihydroflavonol 4-reductase	8.77e-15	3.35e-03	NA	NA
5. P	Q12177	Uncharacterized protein YLL056C	1.44e-15	3.60e-20	NA	NA
5. P	O31512	Uncharacterized oxidoreductase YesF	5.48e-12	4.97e-09	NA	NA
5. P	Q5PPL3	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating	0.00e+00	1.32e-23	NA	NA
5. P	E9F8M2	Oxidoreductase swnR	2.66e-11	2.70e-04	NA	NA
5. P	Q7MYW9	Malate dehydrogenase	2.18e-03	1.57e-02	NA	NA
5. P	Q7VFV4	Malate dehydrogenase	7.79e-03	4.17e-03	NA	NA
5. P	P9WKT3	Uncharacterized protein Rv0501	2.00e-15	1.15e-22	NA	NA
5. P	B5R0N2	Malate dehydrogenase	2.66e-03	1.41e-02	NA	NA
5. P	Q1RIB3	Aspartate-semialdehyde dehydrogenase	2.44e-02	4.53e-03	NA	NA
5. P	O45583	GDP-mannose 4,6 dehydratase 2	0.00e+00	1.88e-18	NA	NA
5. P	P34943	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	9.11e-14	8.44e-03	NA	NA
5. P	P52579	Isoflavone reductase homolog A622	3.66e-08	2.84e-04	NA	NA
5. P	P52577	Isoflavone reductase homolog P3	9.44e-08	8.30e-04	NA	NA
5. P	Q9ZK28	Aspartate-semialdehyde dehydrogenase	4.07e-02	3.69e-02	NA	NA
5. P	O60547	GDP-mannose 4,6 dehydratase	0.00e+00	6.49e-17	NA	NA
5. P	P0A9R1	Aspartate-semialdehyde dehydrogenase	3.06e-01	4.88e-02	NA	NA
5. P	E1U332	Isoflavone reductase-like protein	6.95e-08	1.06e-06	NA	NA
5. P	A0A2I1BT56	Ketoreductase nvfG	2.13e-14	1.23e-06	NA	NA
5. P	Q9LD00	Bifunctional pinoresinol-lariciresinol reductase 3	5.71e-08	4.57e-05	NA	NA
5. P	Q15YH0	Malate dehydrogenase	2.46e-03	8.60e-03	NA	NA
5. P	P25077	Malate dehydrogenase	2.38e-03	1.41e-02	NA	NA
5. P	P39315	Quinone oxidoreductase 2	2.34e-13	2.01e-03	NA	NA
5. P	Q1CBY7	Malate dehydrogenase	1.99e-03	1.58e-02	NA	NA
5. P	D7PI19	Short chain dehydrogenase gsfE	4.93e-14	5.06e-13	NA	NA
5. P	Q9LD13	Bifunctional pinoresinol-lariciresinol reductase 2	4.01e-08	2.07e-06	NA	NA
5. P	Q07YA5	Malate dehydrogenase	2.10e-03	1.96e-02	NA	NA
5. P	Q7X3X5	Malate dehydrogenase	2.41e-03	4.43e-02	NA	NA
5. P	A8FRU0	Malate dehydrogenase	1.59e-03	3.96e-02	NA	NA
5. P	Q8TWG5	Malate dehydrogenase	1.07e-02	2.93e-02	NA	NA
5. P	P83775	Putative NADPH-dependent methylglyoxal reductase GRP2	3.77e-15	9.10e-12	NA	NA
5. P	B5KRH5	Bifunctional pinoresinol-lariciresinol reductase	5.32e-08	1.15e-05	NA	NA
5. P	Q1CEJ3	Malate dehydrogenase	2.01e-03	1.58e-02	NA	NA
5. P	Q9LYA9	Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic	5.72e-14	7.31e-04	NA	NA
5. P	A0A140JWT5	NmrA-like family domain-containing oxidoreductase ptmS	2.70e-07	1.88e-02	NA	NA
5. P	P0C1D8	Aspartate-semialdehyde dehydrogenase	3.42e-02	2.11e-02	NA	NA
5. P	Q5BK63	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	5.38e-14	8.60e-03	NA	NA
5. P	B0UUR6	Malate dehydrogenase	2.15e-03	3.08e-03	NA	NA
5. P	Q12068	NADPH-dependent methylglyoxal reductase GRE2	1.38e-14	5.59e-14	NA	NA
5. P	Q9NZL9	Methionine adenosyltransferase 2 subunit beta	0.00e+00	3.31e-12	NA	NA
5. P	P0DKC8	Bifunctional pinoresinol-lariciresinol reductase	4.71e-08	3.72e-04	NA	NA
5. P	P25284	NADH-ubiquinone oxidoreductase 40 kDa subunit, mitochondrial	3.82e-13	8.67e-06	NA	NA
5. P	Q9DC69	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	6.67e-14	2.32e-03	NA	NA
5. P	B0TUH8	Malate dehydrogenase	1.72e-03	4.47e-02	NA	NA
5. P	P0CB82	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial	4.77e-14	2.29e-03	NA	NA
5. P	B0LL23	Bifunctional pinoresinol-lariciresinol reductase	4.04e-08	1.29e-06	NA	NA
5. P	B1JMK1	Malate dehydrogenase	1.99e-03	1.58e-02	NA	NA
5. P	Q6Q888	Short chain dehydrogenase sirQ	3.16e-13	1.88e-09	NA	NA
5. P	B8CSY7	Malate dehydrogenase	1.98e-03	3.85e-02	NA	NA
5. P	S0DZI6	Nitrogen metabolite regulation-like protein bik4	8.66e-09	3.71e-06	NA	NA
5. P	Q17QH8	Epimerase family protein SDR39U1	4.86e-14	1.16e-16	NA	NA
5. P	P32419	Malate dehydrogenase, peroxisomal	9.12e-04	6.37e-04	NA	NA
5. P	B5FGF5	Malate dehydrogenase	2.53e-03	1.43e-02	NA	NA
5. P	Q5U907	Malate dehydrogenase	9.90e-04	1.33e-03	NA	NA
5. P	L0E2T7	NmrA-like family domain-containing oxidoreductase malD	1.97e-07	7.56e-05	NA	NA
5. P	I3PLR3	Noscapine synthase SDR1	2.69e-14	1.13e-09	NA	NA
5. P	P61891	Malate dehydrogenase	1.84e-03	3.32e-02	NA	NA
5. P	P14168	CDP-paratose synthase	0.00e+00	3.67e-21	NA	NA
5. P	P75821	Uncharacterized protein YbjS	0.00e+00	4.74e-29	NA	NA
5. P	Q9FVQ6	Pinoresinol reductase 1	6.53e-08	1.10e-02	NA	NA
5. P	Q15GI4	Eugenol synthase 1	3.53e-12	2.36e-04	NA	NA
5. P	B2U1U9	Malate dehydrogenase	1.98e-03	3.32e-02	NA	NA
5. P	B3H269	Malate dehydrogenase	1.76e-03	1.41e-03	NA	NA
5. P	P0A9R0	Aspartate-semialdehyde dehydrogenase	3.08e-01	4.88e-02	NA	NA
5. P	A7ZSD0	Malate dehydrogenase	1.93e-03	3.32e-02	NA	NA
5. P	P52576	Isoflavone reductase	3.16e-08	4.15e-04	NA	NA
5. P	A0A3G9HN61	NAD-dependent epimerase/dehydratase ALT6	1.63e-13	4.08e-12	NA	NA
5. P	Q9SNY3	GDP-mannose 4,6 dehydratase 1	0.00e+00	2.62e-17	NA	NA
5. P	P0DUL7	NmrA-like family domain-containing oxidoreductase hkm9	1.68e-06	6.53e-05	NA	NA
5. P	P77775	Epimerase family protein YfcH	3.22e-15	4.29e-14	NA	NA
5. P	Q1R6A3	Malate dehydrogenase	1.82e-03	3.32e-02	NA	NA
5. P	B2K2N5	Malate dehydrogenase	2.30e-03	1.58e-02	NA	NA
5. P	Q83Q04	Malate dehydrogenase	2.55e-03	2.66e-02	NA	NA
5. P	B6EL39	Malate dehydrogenase	2.57e-03	3.82e-02	NA	NA
5. P	P14060	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1	9.99e-16	1.43e-25	NA	NA
5. P	Q9VMW9	GDP-mannose 4,6 dehydratase	0.00e+00	7.12e-13	NA	NA
5. P	P93031	GDP-mannose 4,6 dehydratase 2	0.00e+00	2.21e-16	NA	NA
5. P	B7N0M1	Malate dehydrogenase	1.98e-03	3.32e-02	NA	NA
5. P	Q9XWF0	3beta-hydroxysteroid dehydrogenase/Delta(5)-Delta(4) isomerase 1	1.99e-10	5.08e-15	NA	NA
5. P	O26290	Malate dehydrogenase	8.95e-03	7.37e-07	NA	NA
5. P	A8G8Y7	Malate dehydrogenase	2.48e-03	2.80e-02	NA	NA
5. P	Q5AU62	Nitrogen metabolite repression protein nmrA	2.18e-07	6.11e-03	NA	NA
5. P	P53560	Uncharacterized protein YtbQ	5.22e-15	1.09e-06	NA	NA
5. P	P26439	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2	6.66e-16	1.07e-24	NA	NA
5. P	Q18801	GDP-mannose 4,6 dehydratase 1	0.00e+00	6.47e-15	NA	NA
5. P	Q9CA28	Tetraketide alpha-pyrone reductase 2	1.11e-16	1.07e-09	NA	NA
5. P	P53111	NADPH-dependent aldehyde reductase ARI1	3.77e-15	6.77e-15	NA	NA
5. P	P54448	Putative 6-phosphogluconate dehydrogenase YqeC	3.90e-03	3.65e-03	NA	NA
5. P	Q8K3F7	L-threonine 3-dehydrogenase, mitochondrial	0.00e+00	1.82e-14	NA	NA
5. P	Q4UM57	Aspartate-semialdehyde dehydrogenase	1.51e-02	2.80e-02	NA	NA
5. P	A0A2G5ICG8	Ketoreductase CTB6	2.00e-13	4.14e-12	NA	NA
5. P	Q1ZXF7	GDP-mannose 4,6 dehydratase	0.00e+00	5.93e-19	NA	NA
5. P	P30903	Aspartate-semialdehyde dehydrogenase	1.83e-01	2.41e-02	NA	NA
5. P	A0A2I1BSW0	Asnovolin J 5',6'-dehydrogenase nvfM	6.96e-10	1.85e-04	NA	NA
5. P	C4ZSX4	Malate dehydrogenase	1.84e-03	3.32e-02	NA	NA
5. P	Q13630	GDP-L-fucose synthase	0.00e+00	5.56e-21	NA	NA
5. P	A5UCQ1	Malate dehydrogenase	2.55e-03	2.96e-02	NA	NA
5. P	B1XHK9	Malate dehydrogenase	1.96e-03	3.32e-02	NA	NA
5. P	C5BF98	Malate dehydrogenase	2.08e-03	2.37e-02	NA	NA
5. P	Q9W1X8	Probable GDP-L-fucose synthase	0.00e+00	1.45e-26	NA	NA
5. P	A8C7S1	Agroclavine dehydrogenase	1.45e-12	2.22e-06	NA	NA
5. P	Q9S9N9	Cinnamoyl-CoA reductase 1	2.11e-15	5.12e-06	NA	NA
5. P	B7UJW8	Malate dehydrogenase	1.95e-03	3.32e-02	NA	NA
5. P	Q9R1J0	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating	0.00e+00	1.37e-24	NA	NA
5. P	B5REV7	Malate dehydrogenase	2.70e-03	1.31e-02	NA	NA
5. P	Q5UPS5	Uncharacterized protein L780	NA	5.71e-16	NA	NA
5. P	Q9HBL8	NmrA-like family domain-containing protein 1	7.74e-08	4.92e-04	NA	NA
5. P	Q500U8	Tetraketide alpha-pyrone reductase 1	6.66e-15	5.17e-06	NA	NA
5. P	W6Q1E9	Festuclavine synthase II	1.78e-12	8.13e-08	NA	NA
5. P	Q9Y7K4	Uncharacterized protein C2A9.02	5.55e-16	1.04e-17	NA	NA
5. P	B4T769	Malate dehydrogenase	2.35e-03	1.93e-02	NA	NA
5. P	Q5M8N4	Epimerase family protein SDR39U1	3.80e-14	1.38e-16	NA	NA
5. P	P9WGP7	Epimerase family protein Rv2216	1.17e-14	9.46e-13	NA	NA
5. P	P57008	Aspartate-semialdehyde dehydrogenase	1.32e-01	2.59e-02	NA	NA
5. P	Q4R0I0	Bifunctional pinoresinol-lariciresinol reductase	4.19e-08	1.87e-04	NA	NA
6. F	Q8D341	Bifunctional polymyxin resistance protein ArnA	8.88e-16	NA	NA	0.784
6. F	A0A1Y0BRF8	Short chain dehydrogenase adrF	2.25e-05	NA	NA	0.6288
6. F	P71052	Probable polysaccharide biosynthesis protein EpsC	7.71e-10	NA	NA	0.7069
6. F	Q0P9D4	UDP-N-acetyl-alpha-D-glucosamine C6 dehydratase	1.08e-10	NA	NA	0.6708
6. F	A7FHH4	Bifunctional polymyxin resistance protein ArnA	1.33e-15	NA	NA	0.7666
6. F	A3LQJ9	Protein FMP52-3, mitochondrial	4.62e-05	NA	NA	0.6533
6. F	Q5PNA6	Bifunctional polymyxin resistance protein ArnA	3.96e-14	NA	NA	0.7454
6. F	A6VCK9	Ribosomal RNA large subunit methyltransferase E	1.73e-05	NA	NA	0.6263
6. F	B2HXD3	Ribosomal RNA large subunit methyltransferase E	1.87e-05	NA	NA	0.6228
6. F	Q83QT8	Bifunctional polymyxin resistance protein ArnA	5.65e-14	NA	NA	0.7593
6. F	A5DEZ6	Protein FMP52, mitochondrial	1.65e-05	NA	NA	0.6745
6. F	Q9P5L2	Protein fmp-52, mitochondrial	1.16e-06	NA	NA	0.6446
6. F	Q53877	Putative daunorubicin C-13 ketoreductase DnrU	1.99e-04	NA	NA	0.4901
6. F	Q5B7U4	Non-reducing polyketide synthase pkiA	2.16e-02	NA	NA	0.6711
6. F	Q5N3J5	Formate-dependent phosphoribosylglycinamide formyltransferase	3.44e-02	NA	NA	0.6043
6. F	A0R518	Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872	1.66e-09	NA	NA	0.6329
6. F	Q57NB7	Formate-dependent phosphoribosylglycinamide formyltransferase	2.47e-02	NA	NA	0.5929
6. F	A8E657	Alpha-aminoadipic semialdehyde synthase, mitochondrial	1.87e-01	NA	NA	0.3313
6. F	Q31QP9	Formate-dependent phosphoribosylglycinamide formyltransferase	3.13e-02	NA	NA	0.623
6. F	O32099	Benzil reductase ((S)-benzoin forming)	1.07e-05	NA	NA	0.6161
6. F	A4XYE8	Ribosomal RNA large subunit methyltransferase E	1.50e-05	NA	NA	0.6101
6. F	Q3KPT7	3-hydroxybutyrate dehydrogenase type 2	1.52e-10	NA	NA	0.6243
6. F	Q0CRQ4	Adenylate-forming reductase	1.60e-05	NA	NA	0.6768
6. F	P9WGQ0	Putative oxidoreductase MT1904	3.67e-08	NA	NA	0.6149
6. F	B0VEE9	Ribosomal RNA large subunit methyltransferase E	1.40e-05	NA	NA	0.6221
6. F	A0A3G9HAL8	Short-chain dehydrogenase/reductase cdmF	1.35e-05	NA	NA	0.6874
6. F	Q7SHI2	Short-chain dehydrogenase srdE	7.60e-06	NA	NA	0.5278
6. F	Q9LBG2	Levodione reductase	1.38e-09	NA	NA	0.5738
6. F	Q6D2F1	Bifunctional polymyxin resistance protein ArnA	6.99e-14	NA	NA	0.7673
6. F	Q5RA68	Hydroxysteroid dehydrogenase-like protein 2	5.57e-05	NA	NA	0.5023
6. F	B7VBN2	Bifunctional polymyxin resistance protein ArnA	2.83e-14	NA	NA	0.7636
6. F	A1VC40	Ribosomal RNA large subunit methyltransferase E	1.78e-03	NA	NA	0.5741
6. F	B2VJA4	Formate-dependent phosphoribosylglycinamide formyltransferase	2.21e-02	NA	NA	0.5008
6. F	Q02FS0	Ribosomal RNA large subunit methyltransferase E	1.74e-05	NA	NA	0.6264
6. F	P0DOV5	Sulfoquinovose 1-dehydrogenase	9.72e-06	NA	NA	0.5867
6. F	Q53949	Trk system potassium uptake protein TrkA	3.19e-02	NA	NA	0.4917
6. F	A3LSB6	Protein FMP52-2, mitochondrial	7.17e-05	NA	NA	0.6568
6. F	P71037	Uncharacterized protein YwnB	1.63e-04	NA	NA	0.5973
6. F	Q02R25	Bifunctional polymyxin resistance protein ArnA	2.78e-14	NA	NA	0.756
6. F	P0A5Y5	3-oxoacyl-[acyl-carrier-protein] reductase MabA	2.34e-10	NA	NA	0.5898
6. F	Q30DW7	Averufin oxidase A	3.52e-04	NA	NA	0.5088
6. F	Q8XBJ4	Oxidoreductase UcpA	1.66e-09	NA	NA	0.5933
6. F	Q3YZ12	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	2.35e-05	NA	NA	0.6104
6. F	G9N4A9	Short-chain dehydrogenase virD	1.24e-05	NA	NA	0.536
6. F	P13859	Cis-toluene dihydrodiol dehydrogenase	5.38e-07	NA	NA	0.5736
6. F	B6I5B4	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	2.42e-05	NA	NA	0.6166
6. F	A5DSN1	Protein FMP52, mitochondrial	9.60e-08	NA	NA	0.6333
6. F	Q83RE8	NADP-dependent 3-hydroxy acid dehydrogenase YdfG	4.42e-10	NA	NA	0.6421
6. F	B7GY18	Ribosomal RNA large subunit methyltransferase E	5.60e-04	NA	NA	0.6219
6. F	A5CX75	Ribosomal RNA large subunit methyltransferase E	1.12e-05	NA	NA	0.6432
6. F	Q53882	Aklaviketone reductase DauE	7.79e-05	NA	NA	0.6023
6. F	A0A097ZPC9	Short chain dehydrogenase andC	7.32e-06	NA	NA	0.6064
6. F	P50203	Acetoacetyl-CoA reductase	4.94e-10	NA	NA	0.6023
6. F	B1XB16	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	2.04e-05	NA	NA	0.617
6. F	S0DXJ2	Non-canonical non-ribosomal peptide synthetase FUB8	6.30e-07	NA	NA	0.5869
6. F	A1CYD8	Protein fmp52-2, mitochondrial	1.24e-06	NA	NA	0.6784
6. F	Q1E7Y1	Protein FMP52, mitochondrial	1.94e-07	NA	NA	0.6184
6. F	Q88DV0	Ribosomal RNA large subunit methyltransferase E	1.72e-05	NA	NA	0.6134
6. F	P0AFP5	Uncharacterized oxidoreductase YbbO	1.30e-06	NA	NA	0.577
6. F	P66782	Uncharacterized oxidoreductase Mb1385	1.43e-09	NA	NA	0.616
6. F	A3LUX6	Protein FMP52-1, mitochondrial	5.31e-06	NA	NA	0.6993
6. F	P0C5D8	Protein FMP52, mitochondrial	6.02e-07	NA	NA	0.6505
6. F	B2S3S1	Ribosomal RNA large subunit methyltransferase E	1.04e-03	NA	NA	0.5562
6. F	Q2SMM1	Ribosomal RNA large subunit methyltransferase E	1.25e-05	NA	NA	0.5874
6. F	N4WE43	Dehydrogenase RED2	6.45e-08	NA	NA	0.6823
6. F	W6QP06	Short-chain dehydrogenase/reductase prx4	5.64e-05	NA	NA	0.4408
6. F	P25145	Uncharacterized oxidoreductase Lmo0432	8.30e-06	NA	NA	0.6221
6. F	P9WIH4	Uncharacterized protein MT2107	2.04e-07	NA	NA	0.6175
6. F	A4TIM4	Bifunctional polymyxin resistance protein ArnA	1.44e-15	NA	NA	0.7705
6. F	Q6F8N1	Ribosomal RNA large subunit methyltransferase E	4.18e-04	NA	NA	0.6209
6. F	A0A0D4BSN8	Beta-methylindole-3-pyruvate reductase	3.81e-02	NA	NA	0.3572
6. F	A2QWW3	Protein fmp52, mitochondrial	6.68e-07	NA	NA	0.686
6. F	P14721	Dihydroflavonol 4-reductase	7.13e-14	NA	NA	0.7108
6. F	C4ZXB6	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	2.04e-05	NA	NA	0.6255
6. F	B1JJ30	Bifunctional polymyxin resistance protein ArnA	3.03e-14	NA	NA	0.7697
6. F	A0A1V0QS34	Short-chain dehydrogenase/reductase eriB	2.41e-03	NA	NA	0.5508
6. F	C1DFL6	Ribosomal RNA large subunit methyltransferase E	2.12e-05	NA	NA	0.6211
6. F	A3M851	Ribosomal RNA large subunit methyltransferase E	3.78e-04	NA	NA	0.6219
6. F	P9WGT2	3-oxoacyl-[acyl-carrier-protein] reductase MabA	2.49e-10	NA	NA	0.5898
6. F	B6H065	Short-chain dehydrogenase/reductase prx4	6.34e-06	NA	NA	0.6231
6. F	A1DMU2	Protein fmp52-1, mitochondrial	1.43e-09	NA	NA	0.6656
6. F	Q53139	Precorrin-6A reductase	1.64e-02	NA	NA	0.3512
6. F	Q55336	Formate-dependent phosphoribosylglycinamide formyltransferase	3.44e-02	NA	NA	0.5081
6. F	Q0CI32	Protein fmp52-1, mitochondrial	1.03e-09	NA	NA	0.6988
6. F	Q7N3Q7	Bifunctional polymyxin resistance protein ArnA	2.85e-14	NA	NA	0.7654
6. F	A8FRR2	Bifunctional polymyxin resistance protein ArnA	2.71e-14	NA	NA	0.7588
6. F	Q2TXI3	Protein fmp52-2, mitochondrial	1.27e-06	NA	NA	0.6828
6. F	P52556	Flavin reductase (NADPH)	6.27e-09	NA	NA	0.6469
6. F	Q6FRC1	Protein FMP52, mitochondrial	1.26e-05	NA	NA	0.6879
6. F	Q5BCH7	Protein fmp52, mitochondrial	7.28e-07	NA	NA	0.6544
6. F	Q45983	Post-translational flagellin modification protein A	4.85e-09	NA	NA	0.594
6. F	G4N286	Short-chain dehydrogenase RED1	1.19e-04	NA	NA	0.5929
6. F	Q0TFI7	Bifunctional polymyxin resistance protein ArnA	5.56e-14	NA	NA	0.7554
6. F	C3KAD2	Bifunctional polymyxin resistance protein ArnA	2.75e-14	NA	NA	0.777
6. F	Q4WMS0	Protein fmp52, mitochondrial	2.76e-09	NA	NA	0.6875
6. F	Q92EK7	Uncharacterized oxidoreductase Lin0452	6.08e-06	NA	NA	0.6274
6. F	Q3KCC1	Bifunctional polymyxin resistance protein ArnA	3.51e-14	NA	NA	0.7915
6. F	Q93PD8	Bifunctional polymyxin resistance protein ArnA	3.10e-14	NA	NA	0.7706
6. F	A8GDR7	Bifunctional polymyxin resistance protein ArnA	2.60e-14	NA	NA	0.7849
6. F	B4ETL7	Bifunctional polymyxin resistance protein ArnA	2.75e-14	NA	NA	0.758
6. F	P72220	Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	9.82e-07	NA	NA	0.571
6. F	A0A455R5K2	Short-chain dehydrogenase/reductase ascJ	1.59e-05	NA	NA	0.5039
6. F	Q66KC4	Hydroxysteroid dehydrogenase-like protein 2	1.45e-04	NA	NA	0.5075
6. F	A5ABG8	Oxidase pynE	2.90e-07	NA	NA	0.4726
6. F	B0KHY6	Ribosomal RNA large subunit methyltransferase E	1.65e-05	NA	NA	0.6136
6. F	A0A084R1K2	Short-chain dehydrogenase/reductase ATR9	2.06e-09	NA	NA	0.6298
6. F	Q4WR19	Short chain dehydrogenase helC	2.05e-05	NA	NA	0.604
6. F	O07399	3-oxoacyl-[acyl-carrier-protein] reductase MabA	4.10e-10	NA	NA	0.5701
6. F	B5BCP6	Bifunctional polymyxin resistance protein ArnA	3.77e-14	NA	NA	0.7517
6. F	A2T7G9	Oxidoreductase HTATIP2	1.53e-06	NA	NA	0.5423
6. F	Q75AB3	Protein FMP52, mitochondrial	8.68e-05	NA	NA	0.6829
6. F	Q4JK73	Estradiol 17-beta-dehydrogenase 11	3.92e-06	NA	NA	0.6145
6. F	A3F5F0	Secoisolariciresinol dehydrogenase	6.20e-05	NA	NA	0.5341
6. F	P71534	3-oxoacyl-[acyl-carrier-protein] reductase MabA	4.98e-10	NA	NA	0.6782
6. F	Q8X505	NADP-dependent 3-hydroxy acid dehydrogenase YdfG	4.47e-10	NA	NA	0.6381
6. F	Q1C742	Bifunctional polymyxin resistance protein ArnA	1.22e-15	NA	NA	0.7718
6. F	A6QP05	Dehydrogenase/reductase SDR family member 12	2.81e-06	NA	NA	0.6346
6. F	Q0T2M8	Bifunctional polymyxin resistance protein ArnA	5.77e-14	NA	NA	0.7657
6. F	Q3T0Z7	Dihydropteridine reductase	9.42e-06	NA	NA	0.6153
6. F	B2VBI9	Bifunctional polymyxin resistance protein ArnA	5.33e-14	NA	NA	0.7887
6. F	A4FUZ6	Hydroxysteroid dehydrogenase-like protein 2	2.45e-04	NA	NA	0.4718
6. F	Q8ZDX8	Bifunctional polymyxin resistance protein ArnA	3.63e-14	NA	NA	0.772
6. F	A0A1B1ZGB5	Adenylate-forming reductase Nps10	5.17e-05	NA	NA	0.6288
6. F	A0A1E1FFP5	Short chain dehydrogenase prhI	6.85e-05	NA	NA	0.5825
6. F	O05730	Probable short-chain type dehydrogenase/reductase VdlC	3.16e-05	NA	NA	0.554
6. F	Q4JXR6	Formate-dependent phosphoribosylglycinamide formyltransferase	3.12e-02	NA	NA	0.5358
6. F	Q1R183	Sulfoacetaldehyde reductase	1.50e-09	NA	NA	0.6579
6. F	B7V1G4	Ribosomal RNA large subunit methyltransferase E	1.53e-05	NA	NA	0.6254
6. F	Q0CZ00	Protein fmp52-2, mitochondrial	8.80e-07	NA	NA	0.6681
6. F	P65685	Uncharacterized protein Mb2073c	2.92e-07	NA	NA	0.6016
6. F	Q9HY63	Bifunctional polymyxin resistance protein ArnA	8.88e-16	NA	NA	0.7635
6. F	B7M7P4	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	2.37e-05	NA	NA	0.6144
6. F	O07548	Uncharacterized protein YheG	7.02e-05	NA	NA	0.5915
6. F	Q53217	Uncharacterized short-chain type dehydrogenase/reductase y4vI	8.49e-05	NA	NA	0.5378
6. F	B7LDD3	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	2.48e-09	NA	NA	0.6166
6. F	W7N2C1	Non-canonical non-ribosomal peptide synthetase FUB8	1.21e-06	NA	NA	0.6084
6. F	C1C4R8	3-hydroxybutyrate dehydrogenase type 2	1.41e-10	NA	NA	0.6216
6. F	Q9ZKW1	Probable short-chain type dehydrogenase/reductase VdlC	3.26e-05	NA	NA	0.5638
6. F	P39853	Capsular polysaccharide biosynthesis protein CapD	6.42e-10	NA	NA	0.6759
6. F	B6HV34	Short chain dehydrogenase adrF	8.43e-06	NA	NA	0.6884
6. F	A5W995	Ribosomal RNA large subunit methyltransferase E	1.62e-05	NA	NA	0.657
6. F	A0A2I1BSW8	Asnovolin H dehydrogenase nvfC	9.80e-06	NA	NA	0.6099
6. F	A6V1P0	Bifunctional polymyxin resistance protein ArnA	8.88e-16	NA	NA	0.7763
6. F	B7I636	Ribosomal RNA large subunit methyltransferase E	1.44e-05	NA	NA	0.6353
6. F	Q1CIH7	Bifunctional polymyxin resistance protein ArnA	3.36e-14	NA	NA	0.7707
6. F	A9R093	Bifunctional polymyxin resistance protein ArnA	1.55e-15	NA	NA	0.7705
6. F	A0A023I4C8	Short-chain dehydrogenase/reductase prx4	1.05e-04	NA	NA	0.5345
6. F	Q7DDL2	Ribosomal RNA large subunit methyltransferase E	1.24e-05	NA	NA	0.6201
6. F	Q46381	Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	3.20e-09	NA	NA	0.5464
6. F	A1CTL5	Protein fmp52, mitochondrial	7.95e-07	NA	NA	0.6851
6. F	A8ACE0	Formate-dependent phosphoribosylglycinamide formyltransferase	2.19e-02	NA	NA	0.5121
6. F	A0A2U8U2K8	Oxidoreductase asL5	2.29e-10	NA	NA	0.6349
6. F	Q30UL7	Formate-dependent phosphoribosylglycinamide formyltransferase	2.85e-02	NA	NA	0.5528
6. F	Q7RZR2	3-ketodihydrosphingosine reductase gsl-3	6.68e-06	NA	NA	0.4237
6. F	Q83QJ8	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	2.45e-05	NA	NA	0.6166
6. F	Q6BLA6	Protein FMP52, mitochondrial	1.38e-07	NA	NA	0.6673
6. F	Q5RCH8	Peroxisomal trans-2-enoyl-CoA reductase	1.31e-09	NA	NA	0.5533
6. F	Q4KIG3	Ribosomal RNA large subunit methyltransferase E	2.06e-05	NA	NA	0.6096
6. F	P0CI32	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	1.80e-05	NA	NA	0.5719
6. F	C0Q2G8	Formate-dependent phosphoribosylglycinamide formyltransferase	2.07e-02	NA	NA	0.5929
6. F	Q8Z540	Bifunctional polymyxin resistance protein ArnA	3.77e-14	NA	NA	0.7596
6. F	P9WGR4	Uncharacterized oxidoreductase MT0502	2.47e-10	NA	NA	0.6186
6. F	Q93UV4	Fluoren-9-ol dehydrogenase	1.25e-05	NA	NA	0.4658
6. F	Q3T046	3-hydroxybutyrate dehydrogenase type 2	1.78e-10	NA	NA	0.6107
6. F	Q1IF51	Ribosomal RNA large subunit methyltransferase E	2.01e-05	NA	NA	0.6098
6. F	B1LNJ7	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	2.58e-05	NA	NA	0.6062
6. F	P9WFZ2	Trk system potassium uptake protein TrkA	1.65e-02	NA	NA	0.6577
6. F	Q73L97	Ribosomal RNA large subunit methyltransferase E	2.50e-05	NA	NA	0.6523
6. F	Q2UMY4	Protein fmp52-1, mitochondrial	6.22e-07	NA	NA	0.6587
6. F	P41907	UPF0744 protein YSD83	2.76e-04	NA	NA	0.3892
6. F	B0VSM4	Ribosomal RNA large subunit methyltransferase E	1.35e-05	NA	NA	0.6223
6. F	E1ACR0	NmrA-like family domain-containing oxidoreductase notO	9.33e-05	NA	NA	0.5572
6. F	A6Q6K6	Formate-dependent phosphoribosylglycinamide formyltransferase	2.34e-02	NA	NA	0.5659
6. F	B2K5L3	Bifunctional polymyxin resistance protein ArnA	3.01e-14	NA	NA	0.7648
6. F	A8A347	3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase	2.14e-05	NA	NA	0.6065
6. F	P9WGR6	Uncharacterized oxidoreductase MT0971	1.90e-06	NA	NA	0.6286
6. F	P9WGQ6	Uncharacterized oxidoreductase MT1177	5.04e-10	NA	NA	0.5864
7. B	Q9LH76	Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3	0.00e+00	NA	9.98e-10	NA
7. B	Q9SYM5	Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1	0.00e+00	NA	3.18e-07	NA
7. B	Q9HDU3	Bifunctional protein gal10	0.00e+00	NA	2.47e-58	NA
7. B	Q8VZC0	UDP-glucuronic acid decarboxylase 1	0.00e+00	NA	7.50e-07	NA
7. B	Q8IZJ6	Inactive L-threonine 3-dehydrogenase, mitochondrial	2.96e-12	NA	4.81e-04	NA
7. B	P04397	Bifunctional protein GAL10	0.00e+00	NA	2.99e-57	NA
7. B	P77398	Bifunctional polymyxin resistance protein ArnA	3.11e-15	NA	0.029	NA
7. B	Q9LPG6	Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2	0.00e+00	NA	4.82e-09	NA