Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54978.1

JCVISYN3A_0814

UDP-galactopyranose mutase.
M. mycoides homolog: Q6MRZ8.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 280
Unique PROST Go: 135
Unique BLAST Go: 7
Unique Foldseek Go: 52

Total Homologs: 1226
Unique PROST Homologs: 737
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 218

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: glf; UDP-galactopyranose mutase
Zhang et al. [4]: GO:0008767|UDP-galactopyranose mutase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q48485 (UDP-galactopyranose mutase) with a FATCAT P-Value: 0 and RMSD of 3.03 angstrom. The sequence alignment identity is 30.0%.
Structural alignment shown in left. Query protein AVX54978.1 colored as red in alignment, homolog Q48485 colored as blue. Query protein AVX54978.1 is also shown in right top, homolog Q48485 showed in right bottom. They are colored based on secondary structures.

  AVX54978.1 MNTLKALPTNINSYDYIFIGCGLSTATVCAKL-PKDKRILIIEKREHIGGNVYDHKKND--ILVHQYGPHIFHTNDKE-VFDFLNQFTTFNSYKNVVQAK 96
      Q48485 ----------MKSKKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIGGNSYDARDSETNVMVHVYGPHIFHT-DNETVWNYVNKHAEMMPYVNRVKAT 89

  AVX54978.1 IDDELIPLPVNVDSIKILF-----PNEAEDFINYLKEK------FPN--QEQVTILELSQIDKYQHIYQTIYTRIFASYTGKMWDKKIEDLDVSVFARVP 183
      Q48485 VNGQVFSLPINLHTINQFFSKTCSPDEARALI---AEKGDSTIADPQTFEEQ----ALRFIGK--ELYEA----FFKGYTIKQWGMQPSELPASILKRLP 176

  AVX54978.1 IYLTKRNTYFTDTYEGLPTKGYTQMVLNMLDSSNIDIVLNINITKHLQIKDNQIYINDELITKPVINCAPIDEIFGYKYDKLPYRSLNI-KFEELNNPNL 282
      Q48485 VRFNYDDNYFNHKFQGMPKCGYTQMIKSILNHENIKVDLQ----REFIVEERTHY--DH-----VFYSGPLDAFYGYQYGRLGYRTLDFKKF--TYQGDY 263

  AVX54978.1 QTTAVVNY--PEHPKMTRITEYKNFYP-EISNDKNTIISKEFPGAFEQNSKEFSERYYPIPN--DVSRDQYNKYVEESKKISNLYQLGRLAQYRYINMDQ 377
      Q48485 QGCAVMNYCSVDVP-YTRITEHKYFSPWE-QHD-GSVCYKEYSRACEEN--DIP--YYPIRQMGEMA--LLEKYLSLAENETNITFVGRLGTYRYLDMDV 354

  AVX54978.1 AVRSALDFADELIKKY-EK----------- 395
      Q48485 TIAEALKTAEVYLNSLTENQPMPVFTVSVR 384

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0042353	fucose biosynthetic process
1. PBF	GO:0008767	UDP-galactopyranose mutase activity
1. PBF	GO:0009243	O antigen biosynthetic process
1. PBF	GO:0050660	flavin adenine dinucleotide binding
2. PF	GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
2. PF	GO:0044179	hemolysis in another organism
2. PF	GO:0016117	carotenoid biosynthetic process
2. PF	GO:0050448	beta-cyclopiazonate dehydrogenase activity
2. PF	GO:0005096	GTPase activator activity
2. PF	GO:0009636	response to toxic substance
2. PF	GO:0003973	(S)-2-hydroxy-acid oxidase activity
2. PF	GO:0004729	oxygen-dependent protoporphyrinogen oxidase activity
2. PF	GO:0102223	4,4'-diapophytoene desaturase activity
2. PF	GO:0008718	D-amino-acid dehydrogenase activity
2. PF	GO:0090729	toxin activity
2. PF	GO:0050361	tryptophan 2-monooxygenase activity
2. PF	GO:0050664	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
2. PF	GO:0055130	D-alanine catabolic process
2. PF	GO:0090315	negative regulation of protein targeting to membrane
2. PF	GO:0030327	prenylated protein catabolic process
2. PF	GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors
2. PF	GO:0050151	oleate hydratase activity
2. PF	GO:0004769	steroid delta-isomerase activity
2. PF	GO:0050025	L-glutamate oxidase activity
2. PF	GO:0046872	metal ion binding
2. PF	GO:0047904	fructose 5-dehydrogenase activity
2. PF	GO:0046608	carotenoid isomerase activity
2. PF	GO:0016995	cholesterol oxidase activity
2. PF	GO:0016192	vesicle-mediated transport
2. PF	GO:0044532	modulation of apoptotic process in another organism
2. PF	GO:0019608	nicotine catabolic process
2. PF	GO:0052591	sn-glycerol-3-phosphate:ubiquinone-8 oxidoreductase activity
2. PF	GO:0016641	oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor
2. PF	GO:0050771	negative regulation of axonogenesis
2. PF	GO:0050029	L-lysine oxidase activity
2. PF	GO:0046196	4-nitrophenol catabolic process
2. PF	GO:0106329	L-phenylalaine oxidase activity
2. PF	GO:0050232	putrescine oxidase activity
2. PF	GO:0031304	intrinsic component of mitochondrial inner membrane
2. PF	GO:0005741	mitochondrial outer membrane
2. PF	GO:0016719	carotene 7,8-desaturase activity
2. PF	GO:0050622	glycine dehydrogenase (cyanide-forming) activity
2. PF	GO:0035452	extrinsic component of plastid membrane
2. PF	GO:0016120	carotene biosynthetic process
2. PF	GO:0031969	chloroplast membrane
2. PF	GO:0018632	4-nitrophenol 4-monooxygenase activity
2. PF	GO:0015995	chlorophyll biosynthetic process
2. PF	GO:0047545	2-hydroxyglutarate dehydrogenase activity
2. PF	GO:0019478	D-amino acid catabolic process
2. PF	GO:0016491	oxidoreductase activity
2. PF	GO:0005504	fatty acid binding
2. PF	GO:0009662	etioplast organization
2. PF	GO:0052887	7,9,9'-tricis-neurosporene:quinone oxidoreductase activity
2. PF	GO:0016166	phytoene dehydrogenase activity
2. PF	GO:1901158	neomycin biosynthetic process
2. PF	GO:0005093	Rab GDP-dissociation inhibitor activity
2. PF	GO:0006584	catecholamine metabolic process
2. PF	GO:0006915	apoptotic process
2. PF	GO:0051786	all-trans-retinol 13,14-reductase activity
2. PF	GO:0042742	defense response to bacterium
2. PF	GO:0097621	monoamine oxidase activity
2. PF	GO:0030328	prenylcysteine catabolic process
2. PF	GO:0050233	pyranose oxidase activity
2. PF	GO:0001735	prenylcysteine oxidase activity
2. PF	GO:0052889	9,9'-di-cis-zeta-carotene desaturation to 7,9,7',9'-tetra-cis-lycopene
2. PF	GO:0009509	chromoplast
2. PF	GO:0046592	polyamine oxidase activity
2. PF	GO:0052589	malate dehydrogenase (menaquinone) activity
2. PF	GO:0033717	gluconate 2-dehydrogenase (acceptor) activity
2. PF	GO:0016614	oxidoreductase activity, acting on CH-OH group of donors
2. PF	GO:0007264	small GTPase mediated signal transduction
2. PF	GO:0006783	heme biosynthetic process
2. PF	GO:0008924	malate dehydrogenase (quinone) activity
2. PF	GO:0044478	envenomation resulting in positive regulation of platelet aggregation in another organism
2. PF	GO:0006099	tricarboxylic acid cycle
2. PF	GO:0019746	hopanoid biosynthetic process
2. PF	GO:0052886	9,9'-dicis-carotene:quinone oxidoreductase activity
2. PF	GO:0016899	oxidoreductase activity, acting on the CH-OH group of donors, oxygen as acceptor
2. PF	GO:0071949	FAD binding
2. PF	GO:1901177	lycopene biosynthetic process
2. PF	GO:0047571	3-oxosteroid 1-dehydrogenase activity
2. PF	GO:0042135	neurotransmitter catabolic process
2. PF	GO:0034016	polyenoic fatty acid isomerase activity
2. PF	GO:0032482	Rab protein signal transduction
2. PF	GO:0001716	L-amino-acid oxidase activity
3. BF	GO:0016866	intramolecular transferase activity
5. P	GO:0046436	D-alanine metabolic process
5. P	GO:0003677	DNA binding
5. P	GO:0045964	positive regulation of dopamine metabolic process
5. P	GO:0018344	protein geranylgeranylation
5. P	GO:0052903	N1-acetylspermine:oxygen oxidoreductase (3-acetamidopropanal-forming) activity
5. P	GO:0006551	leucine metabolic process
5. P	GO:0006576	cellular biogenic amine metabolic process
5. P	GO:1902476	chloride transmembrane transport
5. P	GO:0043209	myelin sheath
5. P	GO:0008115	sarcosine oxidase activity
5. P	GO:0004148	dihydrolipoyl dehydrogenase activity
5. P	GO:0046203	spermidine catabolic process
5. P	GO:0010044	response to aluminum ion
5. P	GO:0005777	peroxisome
5. P	GO:0036088	D-serine catabolic process
5. P	GO:1905552	positive regulation of protein localization to endoplasmic reticulum
5. P	GO:0052902	spermidine:oxygen oxidoreductase (3-aminopropanal-forming) activity
5. P	GO:0006739	NADP metabolic process
5. P	GO:0014063	negative regulation of serotonin secretion
5. P	GO:0048046	apoplast
5. P	GO:0015031	protein transport
5. P	GO:0006562	proline catabolic process
5. P	GO:0016901	oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor
5. P	GO:0009446	putrescine biosynthetic process
5. P	GO:0003955	NAD(P)H dehydrogenase (quinone) activity
5. P	GO:0015044	rubredoxin-NAD+ reductase activity
5. P	GO:0005968	Rab-protein geranylgeranyltransferase complex
5. P	GO:0042443	phenylethylamine metabolic process
5. P	GO:0070178	D-serine metabolic process
5. P	GO:0005634	nucleus
5. P	GO:0009447	putrescine catabolic process
5. P	GO:0032981	mitochondrial respiratory chain complex I assembly
5. P	GO:0005640	nuclear outer membrane
5. P	GO:0052894	norspermine:oxygen oxidoreductase activity
5. P	GO:0019469	octopine catabolic process
5. P	GO:0052904	N1-acetylspermidine:oxygen oxidoreductase (3-acetamidopropanal-forming) activity
5. P	GO:0052899	N(1),N(12)-diacetylspermine:oxygen oxidoreductase (3-acetamidopropanal-forming) activity
5. P	GO:0044267	cellular protein metabolic process
5. P	GO:0034361	very-low-density lipoprotein particle
5. P	GO:0007625	grooming behavior
5. P	GO:0110142	ubiquinone biosynthesis complex
5. P	GO:0005778	peroxisomal membrane
5. P	GO:0004368	glycerol-3-phosphate dehydrogenase (quinone) activity
5. P	GO:0052896	spermidine oxidase (propane-1,3-diamine-forming) activity
5. P	GO:0008215	spermine metabolic process
5. P	GO:0007320	insemination
5. P	GO:1903602	thermospermine catabolic process
5. P	GO:0019440	tryptophan catabolic process to indole-3-acetate
5. P	GO:0006554	lysine catabolic process
5. P	GO:0070404	NADH binding
5. P	GO:0051378	serotonin binding
5. P	GO:0042402	cellular biogenic amine catabolic process
5. P	GO:0047151	methylenetetrahydrofolate-tRNA-(uracil-5-)-methyltransferase (FADH2-oxidizing) activity
5. P	GO:0051699	proline oxidase activity
5. P	GO:0102149	farnesylcysteine lyase activity
5. P	GO:0016651	oxidoreductase activity, acting on NAD(P)H
5. P	GO:0019646	aerobic electron transport chain
5. P	GO:0042428	serotonin metabolic process
5. P	GO:0051379	epinephrine binding
5. P	GO:0004324	ferredoxin-NADP+ reductase activity
5. P	GO:0048510	regulation of timing of transition from vegetative to reproductive phase
5. P	GO:0050661	NADP binding
5. P	GO:0009941	chloroplast envelope
5. P	GO:0045773	positive regulation of axon extension
5. P	GO:0050131	N-methyl-L-amino-acid oxidase activity
5. P	GO:0010459	negative regulation of heart rate
5. P	GO:0009635	response to herbicide
5. P	GO:0051698	saccharopine oxidase activity
5. P	GO:0005782	peroxisomal matrix
5. P	GO:0071871	response to epinephrine
5. P	GO:0009967	positive regulation of signal transduction
5. P	GO:0006533	aspartate catabolic process
5. P	GO:0006072	glycerol-3-phosphate metabolic process
5. P	GO:1990534	thermospermine oxidase activity
5. P	GO:1901307	positive regulation of spermidine biosynthetic process
5. P	GO:0003723	RNA binding
5. P	GO:0019168	2-octaprenylphenol hydroxylase activity
5. P	GO:0046501	protoporphyrinogen IX metabolic process
5. P	GO:1902114	D-valine metabolic process
5. P	GO:0006598	polyamine catabolic process
5. P	GO:0050031	L-pipecolate oxidase activity
5. P	GO:0052901	spermine:oxygen oxidoreductase (spermidine-forming) activity
5. P	GO:0008445	D-aspartate oxidase activity
5. P	GO:0009851	auxin biosynthetic process
5. P	GO:1902074	response to salt
5. P	GO:0005747	mitochondrial respiratory chain complex I
5. P	GO:0050172	phenylalanine 2-monooxygenase activity
5. P	GO:0033514	L-lysine catabolic process to acetyl-CoA via L-pipecolate
5. P	GO:0009324	D-amino-acid dehydrogenase complex
5. P	GO:0052898	N1-acetylspermidine:oxygen oxidoreductase (propane-1,3-diamine-forming) activity
5. P	GO:0052900	spermine oxidase (propane-1,3-diamine-forming) activity
5. P	GO:0042445	hormone metabolic process
5. P	GO:0045454	cell redox homeostasis
5. P	GO:0046208	spermine catabolic process
5. P	GO:0008131	primary amine oxidase activity
5. P	GO:0015046	rubredoxin-NADP+ reductase activity
5. P	GO:0004174	electron-transferring-flavoprotein dehydrogenase activity
5. P	GO:0046416	D-amino acid metabolic process
5. P	GO:0051412	response to corticosterone
5. P	GO:0051592	response to calcium ion
5. P	GO:0010269	response to selenium ion
5. P	GO:0007005	mitochondrion organization
5. P	GO:0042416	dopamine biosynthetic process
5. P	GO:0003884	D-amino-acid oxidase activity
5. P	GO:0031169	ferrichrome biosynthetic process
5. P	GO:0043448	alkane catabolic process
5. P	GO:0071869	response to catecholamine
5. P	GO:0009061	anaerobic respiration
5. P	GO:0006779	porphyrin-containing compound biosynthetic process
5. P	GO:0051289	protein homotetramerization
5. P	GO:0031267	small GTPase binding
5. P	GO:0042572	retinol metabolic process
5. P	GO:0030698	5,10-methylenetetrahydrofolate-dependent tRNA (m5U54) methyltransferase activity
5. P	GO:0009534	chloroplast thylakoid
5. P	GO:0019477	L-lysine catabolic process
5. P	GO:0052897	N8-acetylspermidine:oxygen oxidoreductase (propane-1,3-diamine-forming) activity
5. P	GO:0047821	D-glutamate oxidase activity
5. P	GO:0019563	glycerol catabolic process
5. P	GO:0052893	N1-acetylspermine:oxygen oxidoreductase (propane-1,3-diamine-forming) activity
5. P	GO:0005092	GDP-dissociation inhibitor activity
5. P	GO:0046653	tetrahydrofolate metabolic process
5. P	GO:0006782	protoporphyrinogen IX biosynthetic process
5. P	GO:0016021	integral component of membrane
5. P	GO:0042420	dopamine catabolic process
5. P	GO:0052895	N1-acetylspermine:oxygen oxidoreductase (N1-acetylspermidine-forming) activity
5. P	GO:0004362	glutathione-disulfide reductase (NADPH) activity
5. P	GO:0019480	L-alanine oxidation to pyruvate via D-alanine
5. P	GO:2000541	positive regulation of protein geranylgeranylation
5. P	GO:0016731	oxidoreductase activity, acting on iron-sulfur proteins as donors, NAD or NADP as acceptor
5. P	GO:0070224	sulfide:quinone oxidoreductase activity
5. P	GO:0034419	obsolete L-2-hydroxyglutarate oxidase activity
5. P	GO:0003957	NAD(P)+ transhydrogenase (B-specific) activity
5. P	GO:0016020	membrane
5. P	GO:0009331	glycerol-3-phosphate dehydrogenase complex
5. P	GO:0043799	glycine oxidase activity
6. F	GO:0019622	3-(3-hydroxy)phenylpropionate catabolic process
6. F	GO:0033765	steroid dehydrogenase activity, acting on the CH-CH group of donors
6. F	GO:0008688	3-(3-hydroxyphenyl)propionate hydroxylase activity
6. F	GO:0046300	2,4-dichlorophenoxyacetic acid catabolic process
6. F	GO:0016123	xanthophyll biosynthetic process
6. F	GO:0016628	oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
6. F	GO:0050898	nitrile metabolic process
6. F	GO:1902438	response to vanadate(3-)
6. F	GO:0102164	2-heptyl-3-hydroxy-4(1H)-quinolone synthase activity
6. F	GO:0046593	mandelonitrile lyase activity
6. F	GO:0046467	membrane lipid biosynthetic process
6. F	GO:0019380	3-phenylpropionate catabolic process
6. F	GO:0008802	betaine-aldehyde dehydrogenase activity
6. F	GO:0034628	'de novo' NAD biosynthetic process from aspartate
6. F	GO:0045550	geranylgeranyl reductase activity
6. F	GO:0016636	oxidoreductase activity, acting on the CH-CH group of donors, iron-sulfur protein as acceptor
6. F	GO:0018666	2,4-dichlorophenol 6-monooxygenase activity
6. F	GO:0004808	tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity
6. F	GO:0047670	anhydrotetracycline monooxygenase activity
6. F	GO:0019505	resorcinol metabolic process
6. F	GO:0006527	arginine catabolic process
6. F	GO:0016126	sterol biosynthetic process
6. F	GO:0042820	vitamin B6 catabolic process
6. F	GO:0009820	alkaloid metabolic process
6. F	GO:1901771	daunorubicin biosynthetic process
6. F	GO:0090330	regulation of platelet aggregation
6. F	GO:0008812	choline dehydrogenase activity
6. F	GO:0009399	nitrogen fixation
6. F	GO:0047645	alkan-1-ol dehydrogenase (acceptor) activity
6. F	GO:0044477	envenomation resulting in negative regulation of platelet aggregation in another organism
6. F	GO:0006694	steroid biosynthetic process
6. F	GO:0016156	fumarate reductase (NADH) activity
6. F	GO:0044318	L-aspartate:fumarate oxidoreductase activity
6. F	GO:0017000	antibiotic biosynthetic process
6. F	GO:0004506	squalene monooxygenase activity
6. F	GO:0019285	glycine betaine biosynthetic process from choline
6. F	GO:0004497	monooxygenase activity
6. F	GO:0005576	extracellular region
6. F	GO:0016645	oxidoreductase activity, acting on the CH-NH group of donors
6. F	GO:0046577	long-chain-alcohol oxidase activity
6. F	GO:0002097	tRNA wobble base modification
6. F	GO:0008734	L-aspartate oxidase activity
6. F	GO:0046572	versicolorin B synthase activity
6. F	GO:0033718	pyranose dehydrogenase (acceptor) activity
6. F	GO:0046862	chromoplast membrane
6. F	GO:0006113	fermentation
6. F	GO:0008654	phospholipid biosynthetic process
6. F	GO:0033095	aleurone grain
6. F	GO:0046246	terpene biosynthetic process
6. F	GO:0006650	glycerophospholipid metabolic process
6. F	GO:0033713	choline:oxygen 1-oxidoreductase activity
6. F	GO:0044398	envenomation resulting in induction of edema in another organism
7. B	GO:0005618	cell wall
7. B	GO:0048029	monosaccharide binding
7. B	GO:0045227	capsule polysaccharide biosynthetic process
7. B	GO:0009103	lipopolysaccharide biosynthetic process
7. B	GO:0005829	cytosol
7. B	GO:0071555	cell wall organization
7. B	GO:0071766	Actinobacterium-type cell wall biogenesis

Uniprot GO Annotations

GO	Description
GO:0016853	isomerase activity
GO:0008767	UDP-galactopyranose mutase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q48485	UDP-galactopyranose mutase	0.00e+00	4.37e-47	1.11e-50	0.8237
1. PBF	P75499	UDP-galactopyranose mutase	0.00e+00	6.06e-57	5.33e-87	0.9253
1. PBF	Q6E7F1	dTDP-fucopyranose mutase	0.00e+00	1.51e-51	1.45e-49	0.8399
1. PBF	P9WIQ0	UDP-galactopyranose mutase	0.00e+00	1.03e-50	7.23e-53	0.8344
1. PBF	Q48481	Probable UDP-galactopyranose mutase	0.00e+00	1.89e-42	3.70e-51	0.8253
1. PBF	Q49398	UDP-galactopyranose mutase	0.00e+00	2.74e-61	1.57e-81	0.9317
2. PF	Q0BTB0	Probable malate:quinone oxidoreductase	3.16e-02	5.85e-07	NA	0.3296
2. PF	B0VNF5	D-amino acid dehydrogenase	5.16e-03	7.94e-14	NA	0.3755
2. PF	Q6FDG0	Probable malate:quinone oxidoreductase	4.72e-02	4.84e-06	NA	0.3463
2. PF	P55349	Hydroxysqualene dehydroxylase	3.65e-05	6.81e-17	NA	0.5037
2. PF	O49901	Zeta-carotene desaturase, chloroplastic/chromoplastic	1.64e-04	5.68e-10	NA	0.5076
2. PF	P75063	Uncharacterized protein MG039 homolog	9.28e-03	9.06e-14	NA	0.4093
2. PF	B7H655	Probable malate:quinone oxidoreductase	2.32e-02	8.30e-04	NA	0.383
2. PF	Q4L978	4,4'-diaponeurosporene oxygenase	4.91e-04	3.03e-06	NA	0.5184
2. PF	B5AR80	L-amino-acid oxidase (Fragment)	8.19e-04	4.62e-05	NA	0.5404
2. PF	P56560	Amine oxidase [flavin-containing] B	5.72e-04	4.75e-03	NA	0.5428
2. PF	P54982	Phytoene desaturase	9.08e-05	2.17e-03	NA	0.5815
2. PF	P54979	zeta-carotene-forming phytoene desaturase	1.85e-04	3.14e-04	NA	0.5811
2. PF	O34214	Gluconate 2-dehydrogenase flavoprotein	2.29e-01	2.66e-05	NA	0.2509
2. PF	P50397	Rab GDP dissociation inhibitor beta	1.86e-03	2.07e-13	NA	0.4905
2. PF	Q9FV46	Zeta-carotene desaturase, chloroplastic/chromoplastic	4.59e-04	1.93e-05	NA	0.5147
2. PF	A5GRE3	Probable malate:quinone oxidoreductase	2.72e-02	3.05e-07	NA	0.3319
2. PF	Q17043	Aplysianin-A	3.30e-03	5.15e-08	NA	0.5343
2. PF	B5U6Y8	L-amino-acid oxidase	7.33e-04	2.97e-06	NA	0.5545
2. PF	Q7VRS0	Probable malate:quinone oxidoreductase	3.22e-02	5.02e-04	NA	0.3492
2. PF	P46882	Monoamine oxidase N	1.60e-03	4.86e-19	NA	0.5149
2. PF	B1JLH4	D-amino acid dehydrogenase	5.52e-03	4.14e-12	NA	0.3693
2. PF	Q639Y8	Probable malate:quinone oxidoreductase	2.43e-02	7.91e-04	NA	0.3804
2. PF	C3LEY8	Probable malate:quinone oxidoreductase	2.27e-02	8.89e-04	NA	0.3902
2. PF	B7JSX2	Probable malate:quinone oxidoreductase	2.23e-02	8.89e-04	NA	0.3955
2. PF	Q2FDU6	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	2.54e-05	1.23e-05	NA	0.5574
2. PF	A2XDA1	15-cis-phytoene desaturase, chloroplastic/chromoplastic	5.89e-04	6.60e-05	NA	0.5691
2. PF	P58027	Amine oxidase [flavin-containing] A	2.14e-04	4.20e-05	NA	0.5054
2. PF	Q6N3F3	Hydroxysqualene dehydroxylase	5.14e-05	8.94e-16	NA	0.4894
2. PF	Q7A3D9	4,4'-diaponeurosporene oxygenase	4.29e-04	1.21e-05	NA	0.5137
2. PF	Q3MHH6	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2	3.07e-03	1.09e-03	NA	0.5222
2. PF	Q9RAE6	D-amino acid dehydrogenase	4.79e-03	6.10e-14	NA	0.3798
2. PF	B1M860	D-amino acid dehydrogenase	6.60e-03	1.29e-13	NA	0.3663
2. PF	C0Z9W8	Probable malate:quinone oxidoreductase	2.52e-02	4.37e-04	NA	0.3478
2. PF	Q6G6B3	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	3.20e-05	1.04e-05	NA	0.5538
2. PF	O24163	Protoporphyrinogen oxidase, chloroplastic	5.44e-05	2.66e-10	NA	0.6244
2. PF	Q6G6B0	4,4'-diaponeurosporene oxygenase	3.91e-04	1.46e-05	NA	0.5144
2. PF	P63534	Putative flavin-containing monoamine oxidase AofH	2.48e-05	2.57e-13	NA	0.5568
2. PF	H8ZPX1	Pseudooxynicotine oxidase	5.31e-04	8.50e-09	NA	0.5787
2. PF	P86810	L-amino-acid oxidase	1.26e-03	4.50e-04	NA	0.5231
2. PF	A1KMJ5	Probable malate:quinone oxidoreductase	2.67e-02	2.07e-06	NA	0.3584
2. PF	Q0BUV2	D-amino acid dehydrogenase	9.78e-03	4.69e-12	NA	0.3569
2. PF	Q6IWZ0	L-amino-acid oxidase	4.47e-03	4.10e-10	NA	0.5647
2. PF	A9VJG1	Probable malate:quinone oxidoreductase	2.27e-02	4.53e-03	NA	0.398
2. PF	Q2UG11	Beta-cyclopiazonate dehydrogenase	4.13e-04	6.49e-17	NA	0.5092
2. PF	J7H670	L-amino acid oxidase Lm29	9.17e-04	8.12e-06	NA	0.553
2. PF	C3VEQ0	Zeta-carotene desaturase, chloroplastic/chromoplastic	8.52e-04	1.29e-10	NA	0.5267
2. PF	A3NXU9	D-amino acid dehydrogenase	5.00e-03	2.61e-12	NA	0.3621
2. PF	Q9JPB5	Hydroxyneurosporene desaturase	9.95e-04	4.03e-04	NA	0.5498
2. PF	A6MFL0	L-amino-acid oxidase	1.25e-03	9.81e-07	NA	0.5342
2. PF	Q2YWE8	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	2.44e-05	6.10e-06	NA	0.565
2. PF	P9WMP0	Coproporphyrinogen III oxidase	1.50e-05	5.51e-18	NA	0.6221
2. PF	Q7V8S6	Probable malate:quinone oxidoreductase	5.08e-02	9.26e-07	NA	0.3319
2. PF	Q48MT7	Renalase	1.58e-04	3.28e-09	NA	0.616
2. PF	P58739	D-amino acid dehydrogenase	6.10e-03	9.10e-12	NA	0.3742
2. PF	Q53U15	Paromamine 6'-oxidase	9.72e-02	1.20e-07	NA	0.3409
2. PF	B0UBI8	D-amino acid dehydrogenase	9.10e-03	3.87e-14	NA	0.3615
2. PF	Q4VKU9	4,4'-diapolycopene oxygenase	3.20e-04	6.96e-06	NA	0.551
2. PF	P29273	Phytoene dehydrogenase	1.78e-04	4.19e-11	NA	0.5068
2. PF	Q40406	15-cis-phytoene desaturase, chloroplastic/chromoplastic	1.89e-04	2.40e-06	NA	0.557
2. PF	Q52QW2	Prolycopene isomerase 2, chloroplastic	8.09e-04	3.82e-05	NA	0.5785
2. PF	B5F4E4	D-amino acid dehydrogenase	1.23e-02	1.09e-13	NA	0.3755
2. PF	P54980	Phytoene desaturase (neurosporene-forming)	4.65e-05	5.31e-03	NA	0.572
2. PF	Q5RE98	Amine oxidase [flavin-containing] B	5.56e-04	1.09e-03	NA	0.5365
2. PF	C1EYZ6	Probable malate:quinone oxidoreductase	2.23e-02	8.89e-04	NA	0.3819
2. PF	Q75ZP8	Pyranose 2-oxidase	2.42e-01	1.03e-05	NA	0.3203
2. PF	P64752	Uncharacterized protein Mb0921c	3.66e-03	3.21e-06	NA	0.4609
2. PF	Q8S4R4	Prolycopene isomerase, chloroplastic	5.05e-04	7.25e-05	NA	0.5701
2. PF	P58028	Amine oxidase [flavin-containing] B	4.34e-04	3.91e-04	NA	0.5379
2. PF	Q90W54	L-amino-acid oxidase	7.92e-04	3.51e-06	NA	0.5757
2. PF	P17059	Hydroxyneurosporene desaturase	5.07e-04	5.03e-09	NA	0.5852
2. PF	K9N7B7	L-amino acid oxidase Cdc18 (Fragment)	6.21e-04	5.95e-05	NA	0.554
2. PF	B9K2I7	D-amino acid dehydrogenase	1.18e-02	9.06e-14	NA	0.3767
2. PF	P21398	Amine oxidase [flavin-containing] A	4.65e-04	2.25e-05	NA	0.4992
2. PF	Q8KHS0	Flavin-dependent L-tryptophan oxidase RebO	2.56e-04	8.09e-13	NA	0.5308
2. PF	Q4JHE2	L-amino-acid oxidase	9.51e-04	3.00e-06	NA	0.5293
2. PF	P0DI84	L-amino-acid oxidase	6.92e-04	2.15e-07	NA	0.5702
2. PF	Q0P5H1	Prenylcysteine oxidase-like	2.46e-05	1.78e-15	NA	0.5244
2. PF	P22871	Phytoene desaturase (lycopene-forming)	3.32e-05	2.44e-04	NA	0.5785
2. PF	Q7YQM0	Rab GDP dissociation inhibitor alpha	1.75e-03	3.10e-13	NA	0.4595
2. PF	Q7WT72	1-hydroxycarotenoid 3,4-desaturase	5.20e-05	2.22e-05	NA	0.56
2. PF	C0RM68	D-amino acid dehydrogenase	5.37e-03	4.37e-12	NA	0.3702
2. PF	A9MCK4	D-amino acid dehydrogenase	5.15e-03	5.77e-12	NA	0.3732
2. PF	P06108	Protein p49	1.13e-04	2.37e-06	NA	0.4961
2. PF	P56601	Coproporphyrinogen III oxidase	6.60e-06	7.49e-22	NA	0.6535
2. PF	O96566	Protein anon-37Cs (Fragment)	5.69e-04	5.75e-10	NA	0.5197
2. PF	Q5HCY6	4,4'-diaponeurosporene oxygenase	4.50e-04	1.43e-05	NA	0.5321
2. PF	P9WKP6	Uncharacterized protein MT0921	3.64e-03	3.21e-06	NA	0.4476
2. PF	Q735Z0	Probable malate:quinone oxidoreductase	2.42e-02	7.17e-04	NA	0.3805
2. PF	A2S4P8	D-amino acid dehydrogenase	5.25e-03	1.71e-12	NA	0.3675
2. PF	Q8HXX7	Rab GDP dissociation inhibitor alpha	1.83e-03	2.65e-13	NA	0.5046
2. PF	Q39IE1	D-amino acid dehydrogenase	6.21e-03	2.09e-12	NA	0.3582
2. PF	P46371	Uncharacterized GMC-type oxidoreductase in thcA 5'region	2.52e-01	8.76e-03	NA	0.3185
2. PF	A3PBD7	Probable malate:quinone oxidoreductase	4.12e-02	1.28e-05	NA	0.3215
2. PF	Q8CMY4	Probable malate:quinone oxidoreductase 4	5.39e-02	1.43e-04	NA	0.3727
2. PF	Q7YRB7	Amine oxidase [flavin-containing] B	6.12e-04	6.30e-04	NA	0.5266
2. PF	A0A0A1GKA2	Carotenoid 3,4-desaturase	4.17e-05	4.92e-11	NA	0.5568
2. PF	Q55629	L-amino acid dehydrogenase	7.75e-05	1.42e-15	NA	0.5621
2. PF	O24164	Protoporphyrinogen oxidase, mitochondrial	1.79e-06	2.78e-18	NA	0.5958
2. PF	A1C8C5	FAD-dependent oxidoreductase oblC	1.27e-03	1.16e-16	NA	0.5198
2. PF	C7DLJ6	Oleate hydratase	4.04e-02	4.19e-04	NA	0.4478
2. PF	B7ILI6	Probable malate:quinone oxidoreductase	2.24e-02	7.75e-04	NA	0.3385
2. PF	Q7A3E2	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	2.66e-05	1.23e-05	NA	0.5523
2. PF	C0HJE7	L-amino acid oxidase bordonein-L	7.21e-04	8.84e-05	NA	0.5402
2. PF	Q6TGQ8	L-amino-acid oxidase	8.75e-04	2.81e-05	NA	0.4936
2. PF	O97555	Rab GDP dissociation inhibitor alpha	1.49e-03	5.20e-13	NA	0.5167
2. PF	A8X2R1	L-2-hydroxyglutarate dehydrogenase, mitochondrial	1.54e-02	1.03e-06	NA	0.421
2. PF	P40974	Putrescine oxidase	6.46e-05	1.60e-17	NA	0.5553
2. PF	Q2VEX9	Prolycopene isomerase, chloroplastic	6.67e-04	1.16e-04	NA	0.5683
2. PF	Q6HHE0	Probable malate:quinone oxidoreductase	2.20e-02	8.89e-04	NA	0.395
2. PF	B7LSJ5	D-amino acid dehydrogenase	1.22e-02	1.26e-12	NA	0.3759
2. PF	Q9S3V1	Flavin-dependent L-tryptophan oxidase VioA	1.31e-03	6.55e-19	NA	0.4892
2. PF	B9E972	Oleate hydratase	2.86e-02	2.25e-02	NA	0.465
2. PF	A1B072	D-amino acid dehydrogenase	9.98e-03	1.30e-13	NA	0.3694
2. PF	Q5HKN2	Probable malate:quinone oxidoreductase 2	4.79e-02	1.85e-04	NA	0.3339
2. PF	Q9SE20	Zeta-carotene desaturase, chloroplastic/chromoplastic	1.71e-04	5.92e-07	NA	0.5028
2. PF	Q6WP39	L-amino-acid oxidase	8.67e-04	1.57e-05	NA	0.553
2. PF	O93364	L-amino-acid oxidase	7.28e-04	1.54e-04	NA	0.5421
2. PF	Q99R76	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	2.04e-05	1.23e-05	NA	0.5557
2. PF	P17054	Phytoene desaturase (neurosporene-forming)	7.02e-05	6.28e-03	NA	0.5868
2. PF	Q888A4	Renalase	5.01e-08	2.30e-10	NA	0.6124
2. PF	Q2FDU3	4,4'-diaponeurosporene oxygenase	4.33e-04	1.43e-05	NA	0.5152
2. PF	Q4VKV1	4,4'-diapophytoene desaturase (4,4'-diapolycopene-forming)	2.32e-05	2.60e-03	NA	0.5896
2. PF	Q6STF1	L-amino-acid oxidase	8.46e-04	3.79e-06	NA	0.5657
2. PF	Q64FG0	All-trans-retinol 13,14-reductase	6.50e-04	4.58e-06	NA	0.5327
2. PF	A6WYV7	D-amino acid dehydrogenase	1.32e-02	1.84e-12	NA	0.3595
2. PF	X2JCV5	L-amino acid oxidase	8.85e-04	2.29e-06	NA	0.5298
2. PF	P56742	L-amino-acid oxidase apoxin-1	7.20e-04	1.27e-04	NA	0.5619
2. PF	C3NZS9	Probable malate:quinone oxidoreductase	2.20e-02	8.89e-04	NA	0.3815
2. PF	A9WQR6	Probable malate:quinone oxidoreductase	2.67e-02	1.07e-05	NA	0.3508
2. PF	Q5HCY9	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	3.74e-06	1.37e-05	NA	0.5275
2. PF	Q57NK9	D-amino acid dehydrogenase	1.20e-02	1.57e-13	NA	0.3761
2. PF	Q66AQ6	D-amino acid dehydrogenase	5.47e-03	2.40e-12	NA	0.3692
2. PF	M2URK9	FAD-dependent oxidoreductase oblC	1.74e-03	6.92e-17	NA	0.4924
2. PF	A7GQI9	Probable malate:quinone oxidoreductase	2.89e-02	1.16e-04	NA	0.3973
2. PF	P0CC17	L-amino-acid oxidase	7.65e-04	3.44e-05	NA	0.4995
2. PF	P56602	Protoporphyrinogen oxidase	3.90e-05	2.46e-19	NA	0.6439
2. PF	A4TJC4	D-amino acid dehydrogenase	1.55e-02	4.31e-12	NA	0.3684
2. PF	P28554	15-cis-phytoene desaturase, chloroplastic/chromoplastic	1.97e-04	3.52e-03	NA	0.5684
2. PF	F8S0Z5	L-amino-acid oxidase	7.12e-04	1.27e-04	NA	0.5802
2. PF	B2K3Q3	D-amino acid dehydrogenase	5.49e-03	2.40e-12	NA	0.37
2. PF	Q88BB6	D-amino acid dehydrogenase	5.60e-03	8.10e-15	NA	0.4083
2. PF	A5U6K4	Probable malate:quinone oxidoreductase	2.61e-02	2.07e-06	NA	0.3857
2. PF	X2L4E2	L-amino acid oxidase (Fragment)	6.89e-04	5.65e-07	NA	0.5474
2. PF	P74306	Zeta-carotene desaturase	1.35e-04	7.54e-13	NA	0.5163
2. PF	A2CBH2	Probable malate:quinone oxidoreductase	5.12e-02	1.46e-06	NA	0.3322
2. PF	Q2KX12	Probable malate:quinone oxidoreductase	2.52e-02	2.42e-05	NA	0.3489
2. PF	A8QL58	L-amino-acid oxidase (Fragment)	9.68e-04	2.00e-07	NA	0.5512
2. PF	C3VEP9	15-cis-phytoene desaturase, chloroplastic/chromoplastic	2.01e-04	6.75e-04	NA	0.551
2. PF	B3QK65	Probable malate:quinone oxidoreductase	1.98e-02	3.83e-04	NA	0.3378
2. PF	P65420	Probable malate:quinone oxidoreductase	2.65e-02	2.07e-06	NA	0.3379
2. PF	Q6PLK3	Amine oxidase [flavin-containing] B	5.66e-04	2.72e-03	NA	0.5213
2. PF	A2BPP7	Probable malate:quinone oxidoreductase	3.69e-02	3.43e-06	NA	0.383
2. PF	A9MVW7	D-amino acid dehydrogenase	1.27e-02	1.82e-13	NA	0.3761
2. PF	O32434	Coproporphyrinogen III oxidase	2.91e-04	1.25e-14	NA	0.6134
2. PF	A5VVJ0	D-amino acid dehydrogenase	5.45e-03	4.37e-12	NA	0.362
2. PF	A7FI92	D-amino acid dehydrogenase	6.95e-03	2.40e-12	NA	0.3696
2. PF	Q579E2	D-amino acid dehydrogenase	5.93e-03	4.37e-12	NA	0.3648
2. PF	P0DPE9	4,4'-diapolycopen-4-al dehydrogenase	7.92e-05	3.55e-06	NA	0.5841
2. PF	O97556	Rab GDP dissociation inhibitor beta	2.11e-03	3.24e-13	NA	0.4899
2. PF	A8QL52	L-amino-acid oxidase	9.18e-04	5.27e-07	NA	0.5326
2. PF	Q9HXE3	FAD-dependent catabolic D-arginine dehydrogenase DauA	1.16e-02	4.92e-10	NA	0.4019
2. PF	B0U4L2	Probable malate:quinone oxidoreductase	4.99e-02	1.56e-03	NA	0.3383
2. PF	Q60HD5	Protoporphyrinogen oxidase	8.63e-06	4.47e-19	NA	0.6088
2. PF	A0K5P0	D-amino acid dehydrogenase	1.67e-02	3.86e-12	NA	0.3591
2. PF	Q8NUQ6	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	4.19e-06	1.04e-05	NA	0.53
2. PF	Q2YWE5	4,4'-diaponeurosporene oxygenase	4.43e-04	2.22e-05	NA	0.5115
2. PF	B7I894	Probable malate:quinone oxidoreductase	4.73e-02	2.93e-06	NA	0.3612
2. PF	P21685	Phytoene desaturase (lycopene-forming)	1.96e-04	2.87e-05	NA	0.536
2. PF	A0A2U8QPE6	L-amino acid oxidase	1.23e-03	7.12e-06	NA	0.5136
2. PF	Q89T28	D-amino acid dehydrogenase	1.21e-02	2.10e-11	NA	0.364
2. PF	Q4JHE1	L-amino-acid oxidase	9.84e-04	3.47e-05	NA	0.5457
2. PF	Q50008	Coproporphyrinogen III oxidase	1.43e-05	3.98e-19	NA	0.5865
2. PF	A3NC12	D-amino acid dehydrogenase	5.02e-03	1.71e-12	NA	0.3474
2. PF	Q9R6X4	Zeta-carotene desaturase	2.18e-04	1.38e-09	NA	0.5255
2. PF	P54978	Phytoene desaturase (lycopene-forming)	2.34e-04	6.01e-05	NA	0.5572
2. PF	Q94IG7	Protoporphyrinogen oxidase 2	1.89e-05	3.70e-15	NA	0.5878
2. PF	Q89XM4	Probable malate:quinone oxidoreductase	2.83e-02	2.84e-04	NA	0.3433
2. PF	A8I2M2	Probable malate:quinone oxidoreductase	2.87e-02	1.70e-05	NA	0.3265
2. PF	A9ADT7	D-amino acid dehydrogenase	1.46e-02	6.72e-12	NA	0.3504
2. PF	B7I1Q9	D-amino acid dehydrogenase	6.78e-03	3.39e-14	NA	0.3783
2. PF	Q4JHE3	L-amino-acid oxidase	9.17e-04	8.07e-07	NA	0.5386
2. PF	P9WQ14	Putative flavin-containing monoamine oxidase AofH	2.84e-05	2.57e-13	NA	0.5501
2. PF	B0V946	Probable malate:quinone oxidoreductase	4.49e-02	2.93e-06	NA	0.3627
2. PF	C1AFW6	Probable malate:quinone oxidoreductase	2.55e-02	2.07e-06	NA	0.3851
2. PF	Q8FVC0	D-amino acid dehydrogenase	5.49e-03	4.56e-12	NA	0.3696
2. PF	G4MT60	Rab GDP-dissociation inhibitor	2.84e-03	1.23e-13	NA	0.4506
2. PF	P60028	Rab GDP dissociation inhibitor alpha	1.53e-03	2.85e-13	NA	0.4543
2. PF	B7H2E9	D-amino acid dehydrogenase	5.42e-03	3.39e-14	NA	0.3742
2. PF	P35903	Achacin	4.53e-03	1.70e-10	NA	0.5314
2. PF	H1VQW0	FAD-dependent oxidoreductase dpchF	5.70e-04	4.81e-17	NA	0.5379
2. PF	A3M361	Probable malate:quinone oxidoreductase	4.49e-02	1.56e-06	NA	0.3646
2. PF	Q31N27	Probable zeta-carotene desaturase	1.93e-04	1.55e-10	NA	0.4999
2. PF	B5XK69	Oleate hydratase	4.43e-02	5.54e-04	NA	0.4753
2. PF	P21856	Rab GDP dissociation inhibitor alpha	1.65e-03	3.74e-13	NA	0.5047
2. PF	Q5PCU1	D-amino acid dehydrogenase	1.20e-02	1.09e-13	NA	0.3745
2. PF	Q6QWR1	Pyranose 2-oxidase	2.30e-01	4.37e-04	NA	0.3073
2. PF	P06617	Tryptophan 2-monooxygenase	8.68e-04	2.33e-10	NA	0.5543
2. PF	Q81C25	Probable malate:quinone oxidoreductase	2.33e-02	5.65e-04	NA	0.3311
2. PF	Q01671	Hydroxyneurosporene desaturase	4.78e-04	2.85e-09	NA	0.5394
2. PF	A9BU40	D-amino acid dehydrogenase	5.99e-03	6.00e-13	NA	0.3665
2. PF	B1JXT8	D-amino acid dehydrogenase	1.58e-02	5.61e-12	NA	0.3668
2. PF	O30745	D-amino acid dehydrogenase	1.45e-02	3.05e-14	NA	0.3737
2. PF	Q5RAP5	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2	2.37e-03	2.59e-04	NA	0.5374
2. PF	Q9JWK3	Probable malate:quinone oxidoreductase	3.94e-02	1.37e-05	NA	0.3674
2. PF	A8QL51	L-amino-acid oxidase	9.42e-04	5.33e-07	NA	0.5383
2. PF	A0A024BTN9	L-amino acid oxidase Bs29 (Fragment)	7.98e-04	1.38e-05	NA	0.5609
2. PF	F5HN72	Beta-cyclopiazonate dehydrogenase	6.36e-04	6.49e-17	NA	0.5118
2. PF	P54981	Phytoene dehydrogenase	7.87e-05	6.49e-07	NA	0.4649
2. PF	Q1H378	D-amino acid dehydrogenase	1.10e-02	6.44e-13	NA	0.3698
2. PF	Q9SMJ3	Zeta-carotene desaturase, chloroplastic/chromoplastic	3.50e-04	2.12e-06	NA	0.5047
2. PF	B4TXX3	D-amino acid dehydrogenase	1.27e-02	1.09e-13	NA	0.3757
2. PF	B0VXW0	L-amino-acid oxidase	6.55e-04	2.29e-05	NA	0.5531
2. PF	A3M0Z0	D-amino acid dehydrogenase	6.45e-03	2.79e-14	NA	0.363
2. PF	Q5RE60	Amine oxidase [flavin-containing] A	5.30e-04	3.82e-05	NA	0.5378
2. PF	B8NI10	Beta-cyclopiazonate dehydrogenase	4.40e-04	2.44e-18	NA	0.4999
2. PF	Q8NUQ3	4,4'-diaponeurosporene oxygenase	4.23e-04	1.44e-05	NA	0.5135
2. PF	Q53589	4,4'-diaponeurosporene oxygenase	4.39e-04	1.43e-05	NA	0.5163
2. PF	Q8CQ96	Probable malate:quinone oxidoreductase 2	5.45e-02	1.16e-04	NA	0.3354
2. PF	Q5NP65	Hydroxysqualene dehydroxylase	1.11e-05	2.02e-16	NA	0.496
2. PF	P0A5A8	Coproporphyrinogen III oxidase	2.98e-06	5.51e-18	NA	0.6059
2. PF	Q5NU32	Amine oxidase [flavin-containing] A	4.65e-04	3.26e-05	NA	0.4993
2. PF	Q981X2	D-amino acid dehydrogenase 3	1.09e-02	1.37e-14	NA	0.3824
2. PF	G8XQX1	L-amino-acid oxidase	7.76e-04	4.53e-06	NA	0.5551
2. PF	P49253	Amine oxidase [flavin-containing]	5.46e-04	4.97e-04	NA	0.5073
2. PF	Q99R73	4,4'-diaponeurosporene oxygenase	2.91e-04	1.21e-05	NA	0.5136
2. PF	Q52QW3	Prolycopene isomerase 1, chloroplastic	7.52e-04	5.76e-05	NA	0.5844
2. PF	Q827H4	Monomeric sarcosine oxidase	3.38e-02	2.83e-11	NA	0.3671
2. PF	A8G3D1	Probable malate:quinone oxidoreductase	4.18e-02	7.86e-06	NA	0.3551
2. PF	B7HVJ1	Probable malate:quinone oxidoreductase	2.18e-02	8.06e-04	NA	0.3575
2. PF	Q98B75	D-amino acid dehydrogenase 2	5.86e-03	4.75e-14	NA	0.3977
2. PF	A1JQN9	D-amino acid dehydrogenase	5.28e-03	8.50e-12	NA	0.3992
2. PF	P26294	15-cis-phytoene desaturase	1.64e-04	4.19e-11	NA	0.5516
2. PF	A8I711	D-amino acid dehydrogenase	5.14e-03	1.13e-13	NA	0.372
2. PF	Q2MF66	6'''-hydroxyparomomycin C oxidase	7.72e-02	5.92e-07	NA	0.3368
2. PF	Q5AUY0	FAD-dependent oxidoreductase dbaF	2.61e-04	1.65e-15	NA	0.4917
2. PF	Q5RCE1	Rab GDP dissociation inhibitor beta	1.75e-03	6.17e-13	NA	0.4902
2. PF	A5V4F9	D-amino acid dehydrogenase	1.13e-02	3.06e-13	NA	0.3769
2. PF	Q8GAJ0	4-methylaminobutanoate oxidase (methylamine-forming)	3.14e-04	1.03e-16	NA	0.5552
2. PF	C1I201	Para-nitrophenol 4-monooxygenase	7.85e-02	5.78e-03	NA	0.4026
2. PF	P81382	L-amino-acid oxidase	8.19e-04	8.13e-05	NA	0.5399
2. PF	P9WJP4	Probable malate:quinone oxidoreductase	2.59e-02	2.07e-06	NA	0.3576
2. PF	B9J484	Probable malate:quinone oxidoreductase	2.41e-02	8.06e-04	NA	0.388
2. PF	Q6GDN5	4,4'-diaponeurosporene oxygenase	3.00e-04	1.10e-05	NA	0.5106
2. PF	Q9Z9Q7	Probable malate:quinone oxidoreductase	2.20e-02	2.05e-04	NA	0.3541
2. PF	Q6NA55	Probable malate:quinone oxidoreductase	2.79e-02	2.29e-04	NA	0.3436
2. PF	M1VMF7	Fructose dehydrogenase large subunit	1.76e-01	9.36e-06	NA	0.3054
2. PF	O07855	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	5.17e-06	1.23e-05	NA	0.5634
2. PF	P47285	Uncharacterized protein MG039	1.32e-02	1.46e-15	NA	0.4124
2. PF	O96570	Protein anon-37Cs	1.79e-03	1.79e-08	NA	0.5125
2. PF	C5B9W5	D-amino acid dehydrogenase	1.20e-02	2.07e-13	NA	0.3704
2. PF	B2SDA2	D-amino acid dehydrogenase	4.96e-03	4.37e-12	NA	0.3702
2. PF	Q8W257	Polyenoic fatty acid isomerase	5.18e-05	2.33e-12	NA	0.5194
2. PF	C1DJZ7	D-amino acid dehydrogenase	6.21e-03	1.14e-13	NA	0.3822
2. PF	O85228	Hydrogen cyanide synthase subunit HcnC	1.60e-02	4.13e-11	NA	0.3682
2. PF	P12676	Cholesterol oxidase	1.29e-01	2.25e-04	NA	0.3168
2. PF	Q6Q7J2	Rab GDP dissociation inhibitor beta	1.74e-03	3.15e-13	NA	0.5113
2. PF	P22637	Cholesterol oxidase	1.57e-01	4.66e-03	NA	0.3299
2. PF	Q6GDN7	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	3.71e-06	4.95e-06	NA	0.5543
2. PF	L7WC64	1-hydroxycarotenoid 3,4-desaturase	6.52e-05	8.52e-08	NA	0.5509
2. PF	Q63S25	D-amino acid dehydrogenase	5.38e-03	1.94e-12	NA	0.347
2. PF	Q8YD04	D-amino acid dehydrogenase	5.51e-03	4.37e-12	NA	0.365
2. PF	B5FTN1	D-amino acid dehydrogenase	1.31e-02	1.82e-13	NA	0.3753
2. PF	Q6Q2J0	Amine oxidase [flavin-containing] A	4.61e-04	2.69e-05	NA	0.5234
4. PB	P37747	UDP-galactopyranose mutase	0.00e+00	8.23e-55	4.09e-65	NA
4. PB	P9WIQ1	UDP-galactopyranose mutase	0.00e+00	1.03e-50	7.23e-53	NA
5. P	B0BR13	Probable malate:quinone oxidoreductase	2.84e-02	2.12e-06	NA	NA
5. P	O67931	Sulfide-quinone reductase	2.46e-01	7.38e-04	NA	NA
5. P	E9QYP0	L-ornithine N(5)-monooxygenase	4.91e-01	2.98e-02	NA	NA
5. P	Q8S9J1	Protoporphyrinogen oxidase 2, chloroplastic/mitochondrial	1.81e-06	3.93e-15	NA	NA
5. P	O24913	Malate:quinone oxidoreductase	1.02e-02	2.82e-09	NA	NA
5. P	B4TBF2	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.04e-01	1.58e-08	NA	NA
5. P	P24552	D-amino-acid oxidase	1.06e-01	9.39e-09	NA	NA
5. P	B5BEP9	Nitric oxide reductase FlRd-NAD(+) reductase	5.02e-01	2.33e-02	NA	NA
5. P	Q3Z357	N-methyl-L-tryptophan oxidase	9.20e-02	2.82e-09	NA	NA
5. P	Q8Z553	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.93e-01	3.90e-08	NA	NA
5. P	Q4R510	FAD-dependent oxidoreductase domain-containing protein 1	3.37e-02	1.13e-07	NA	NA
5. P	B2HV78	Probable malate:quinone oxidoreductase	4.60e-02	1.56e-06	NA	NA
5. P	Q9HFE4	Thiol-specific monooxygenase	8.49e-01	1.43e-02	NA	NA
5. P	Q59327	3-oxo-5-alpha-steroid 4-dehydrogenase	2.32e-01	2.78e-03	NA	NA
5. P	B5F365	Nitric oxide reductase FlRd-NAD(+) reductase	4.97e-01	1.93e-02	NA	NA
5. P	A3MHR1	D-amino acid dehydrogenase	5.03e-03	1.71e-12	NA	NA
5. P	P14920	D-amino-acid oxidase	8.11e-02	2.12e-06	NA	NA
5. P	Q9AR38	Protoporphyrinogen oxidase, chloroplastic	8.88e-05	4.14e-08	NA	NA
5. P	B7VM91	Soluble pyridine nucleotide transhydrogenase	2.61e-01	2.27e-02	NA	NA
5. P	S5FMM4	Glycine oxidase	9.33e-03	2.36e-09	NA	NA
5. P	Q6D2L3	Probable malate:quinone oxidoreductase	3.50e-02	6.96e-05	NA	NA
5. P	P50399	Rab GDP dissociation inhibitor beta	1.79e-03	6.19e-14	NA	NA
5. P	Q5PI45	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.04e-01	1.58e-08	NA	NA
5. P	Q54NS8	Apoptosis-inducing factor homolog B	2.93e-01	2.16e-04	NA	NA
5. P	Q57M68	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.01e-01	2.07e-08	NA	NA
5. P	Q5FP90	Probable malate:quinone oxidoreductase	1.67e-02	6.81e-06	NA	NA
5. P	P81383	L-amino-acid oxidase	3.29e-04	8.22e-08	NA	NA
5. P	P32397	Coproporphyrinogen III oxidase	1.32e-04	1.82e-17	NA	NA
5. P	C4K3I8	Soluble pyridine nucleotide transhydrogenase	3.02e-01	1.36e-02	NA	NA
5. P	P9WQ15	Putative flavin-containing monoamine oxidase AofH	8.22e-05	2.57e-13	NA	NA
5. P	A2C0M6	Probable malate:quinone oxidoreductase	8.10e-02	4.05e-06	NA	NA
5. P	A9IP97	D-amino acid dehydrogenase	8.33e-03	3.91e-13	NA	NA
5. P	Q9N4Z0	L-2-hydroxyglutarate dehydrogenase, mitochondrial	1.75e-02	5.60e-08	NA	NA
5. P	O07085	Uncharacterized oxidoreductase CzcO	6.81e-01	9.34e-03	NA	NA
5. P	B7M934	N-methyl-L-tryptophan oxidase	9.20e-02	4.27e-09	NA	NA
5. P	P50264	Polyamine oxidase FMS1	3.35e-03	5.78e-09	NA	NA
5. P	P28553	15-cis-phytoene desaturase, chloroplastic/chromoplastic	1.79e-04	9.88e-06	NA	NA
5. P	P9WP27	Probable D-amino-acid oxidase	8.34e-02	1.07e-06	NA	NA
5. P	B1YEQ1	Ferredoxin--NADP reductase 2	3.15e-01	4.39e-02	NA	NA
5. P	P58525	N-methyl-L-tryptophan oxidase	3.67e-02	4.32e-10	NA	NA
5. P	Q5U2W9	Renalase	5.38e-03	1.11e-12	NA	NA
5. P	P33642	Glycine oxidase	2.62e-02	2.04e-13	NA	NA
5. P	A4TCE3	Probable malate:quinone oxidoreductase	4.13e-02	7.77e-03	NA	NA
5. P	Q2SY06	D-amino acid dehydrogenase	6.17e-03	1.24e-12	NA	NA
5. P	O14252	Putative oxidoreductase C6G10.06	7.03e-02	7.75e-10	NA	NA
5. P	Q92C76	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.48e-01	1.50e-02	NA	NA
5. P	Q5HLN0	Probable malate:quinone oxidoreductase 1	4.10e-02	1.25e-05	NA	NA
5. P	Q6NGL9	Probable malate:quinone oxidoreductase	2.90e-02	4.10e-06	NA	NA
5. P	P39958	Rab GDP-dissociation inhibitor	2.94e-03	1.69e-14	NA	NA
5. P	C1EP56	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.58e-01	3.96e-02	NA	NA
5. P	Q10062	Protoporphyrinogen oxidase	1.32e-05	9.00e-21	NA	NA
5. P	Q8XE13	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.00e-01	4.92e-07	NA	NA
5. P	B4TKD3	D-amino acid dehydrogenase	1.27e-02	1.82e-13	NA	NA
5. P	B7NN21	Probable malate:quinone oxidoreductase	4.66e-02	1.33e-02	NA	NA
5. P	B5FL04	N-methyl-L-tryptophan oxidase	3.55e-02	1.44e-09	NA	NA
5. P	Q87AS0	Probable malate:quinone oxidoreductase	5.06e-02	4.21e-03	NA	NA
5. P	Q4WD43	Amino acid oxidase fsqB	5.34e-02	1.29e-06	NA	NA
5. P	P0A6J6	D-amino acid dehydrogenase	1.28e-02	5.59e-13	NA	NA
5. P	A6TAW4	D-amino acid dehydrogenase	1.35e-02	1.21e-13	NA	NA
5. P	Q2SF51	Probable malate:quinone oxidoreductase	2.61e-02	2.78e-05	NA	NA
5. P	Q7VDF8	Probable malate:quinone oxidoreductase	3.82e-02	1.66e-05	NA	NA
5. P	Q8XE45	Malate:quinone oxidoreductase	7.02e-02	1.05e-02	NA	NA
5. P	B7N3Z3	D-amino acid dehydrogenase	1.25e-02	5.59e-13	NA	NA
5. P	Q99ML5	Prenylcysteine oxidase	5.13e-05	2.75e-14	NA	NA
5. P	B7N5H2	Probable malate:quinone oxidoreductase	5.02e-02	1.33e-02	NA	NA
5. P	A3PRF6	D-amino acid dehydrogenase	1.86e-02	1.97e-12	NA	NA
5. P	B0BTN3	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.10e-01	1.25e-08	NA	NA
5. P	Q9ZKQ7	D-amino acid dehydrogenase	1.38e-02	1.18e-15	NA	NA
5. P	Q9Y7N4	D-amino-acid oxidase	8.81e-02	6.13e-07	NA	NA
5. P	Q8FFQ5	Probable malate:quinone oxidoreductase	5.80e-02	7.49e-03	NA	NA
5. P	B7LFZ3	N-methyl-L-tryptophan oxidase	9.29e-02	4.27e-09	NA	NA
5. P	A4WDR7	Nitric oxide reductase FlRd-NAD(+) reductase	5.17e-01	4.51e-02	NA	NA
5. P	A8XJ44	D-amino-acid oxidase	7.84e-02	1.61e-05	NA	NA
5. P	Q1R9K7	Probable malate:quinone oxidoreductase	4.93e-02	1.05e-02	NA	NA
5. P	P0A6J7	D-amino acid dehydrogenase	1.22e-02	5.59e-13	NA	NA
5. P	B4RBL4	D-amino acid dehydrogenase	1.19e-02	2.11e-12	NA	NA
5. P	Q6HEY3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.59e-01	3.99e-02	NA	NA
5. P	Q8CV11	Probable malate:quinone oxidoreductase	3.02e-02	2.37e-05	NA	NA
5. P	C5CAA3	Probable malate:quinone oxidoreductase	4.62e-02	3.74e-05	NA	NA
5. P	Q0S251	Probable malate:quinone oxidoreductase	2.93e-02	1.93e-04	NA	NA
5. P	Q9JX24	D-amino acid dehydrogenase	7.28e-03	1.71e-14	NA	NA
5. P	A7ZZ17	N-methyl-L-tryptophan oxidase	9.07e-02	5.10e-09	NA	NA
5. P	Q2UPB4	Thioredoxin reductase aclT	4.37e-01	2.33e-02	NA	NA
5. P	B7UFM4	Probable malate:quinone oxidoreductase	6.00e-02	6.76e-03	NA	NA
5. P	Q9LRI8	Protoporphyrinogen oxidase 1, chloroplastic	1.28e-05	1.35e-06	NA	NA
5. P	P72835	Uncharacterized protein slr1300	6.85e-02	3.69e-03	NA	NA
5. P	Q2RMZ4	Ubiquinone hydroxylase UbiL	9.40e-02	2.97e-03	NA	NA
5. P	A6UB96	D-amino acid dehydrogenase	4.39e-03	4.22e-14	NA	NA
5. P	B4S9F8	Ferredoxin--NADP reductase	3.42e-01	3.96e-02	NA	NA
5. P	A6H0E6	Probable malate:quinone oxidoreductase	3.48e-02	1.15e-05	NA	NA
5. P	A7IHQ4	D-amino acid dehydrogenase	1.10e-02	2.43e-13	NA	NA
5. P	A4SNB0	D-amino acid dehydrogenase	1.74e-02	1.89e-12	NA	NA
5. P	Q5BLE8	All-trans-retinol 13,14-reductase	6.34e-04	2.99e-05	NA	NA
5. P	B4TF25	Nitric oxide reductase FlRd-NAD(+) reductase	5.04e-01	1.47e-02	NA	NA
5. P	Q32ER8	N-methyl-L-tryptophan oxidase	9.03e-02	4.55e-09	NA	NA
5. P	Q8DF11	D-amino acid dehydrogenase	1.05e-02	4.91e-13	NA	NA
5. P	A8GFF7	D-amino acid dehydrogenase	1.58e-02	1.33e-12	NA	NA
5. P	B7NL75	N-methyl-L-tryptophan oxidase	9.12e-02	6.80e-09	NA	NA
5. P	P59097	Pyranose 2-oxidase	4.63e-01	3.37e-05	NA	NA
5. P	Q8VC10	Oxidative stress-induced growth inhibitor 1	5.99e-01	5.89e-03	NA	NA
5. P	Q99R54	Putative flavoprotein monooxygenase	4.36e-01	1.98e-02	NA	NA
5. P	P25535	2-octaprenylphenol hydroxylase	7.45e-02	1.29e-03	NA	NA
5. P	P50398	Rab GDP dissociation inhibitor alpha	1.47e-03	3.64e-13	NA	NA
5. P	B7LAN4	Probable malate:quinone oxidoreductase	4.62e-02	8.60e-03	NA	NA
5. P	B3H2E6	Probable malate:quinone oxidoreductase	2.44e-02	2.12e-06	NA	NA
5. P	Q7VFF6	Probable malate:quinone oxidoreductase	2.55e-02	8.48e-06	NA	NA
5. P	Q57KT2	Nitric oxide reductase FlRd-NAD(+) reductase	5.27e-01	3.53e-02	NA	NA
5. P	Q1CI06	N-methyl-L-tryptophan oxidase	3.83e-02	1.23e-09	NA	NA
5. P	B7LAR0	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.26e-01	2.45e-06	NA	NA
5. P	A1AD63	Probable malate:quinone oxidoreductase	5.84e-02	1.05e-02	NA	NA
5. P	Q9HVF1	Probable malate:quinone oxidoreductase 2	4.99e-02	8.93e-05	NA	NA
5. P	Q0I239	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.93e-01	4.35e-08	NA	NA
5. P	B6I9Q0	D-amino acid dehydrogenase	1.28e-02	5.59e-13	NA	NA
5. P	Q9SJA7	Probable sarcosine oxidase	8.48e-02	1.80e-07	NA	NA
5. P	A4XNV3	D-amino acid dehydrogenase	1.71e-02	5.67e-13	NA	NA
5. P	B2TW33	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.20e-01	2.62e-06	NA	NA
5. P	Q3BNX3	D-amino acid dehydrogenase	6.49e-03	2.48e-14	NA	NA
5. P	B5RCB0	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.72e-01	1.58e-08	NA	NA
5. P	P80093	15-cis-phytoene desaturase, chloroplastic/chromoplastic	2.03e-04	1.59e-04	NA	NA
5. P	B0S6C5	Inactive all-trans-retinol 13,14-reductase	1.52e-03	2.36e-04	NA	NA
5. P	P33940	Malate:quinone oxidoreductase	5.02e-02	1.67e-02	NA	NA
5. P	B4SUJ5	D-amino acid dehydrogenase	1.23e-02	1.82e-13	NA	NA
5. P	A3MZ98	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.74e-01	1.25e-08	NA	NA
5. P	Q6UG02	Pyranose 2-oxidase	5.20e-01	4.38e-05	NA	NA
5. P	B4TET2	N-methyl-L-tryptophan oxidase	3.64e-02	3.46e-10	NA	NA
5. P	Q47861	Tryptophan 2-monooxygenase	9.15e-04	2.81e-10	NA	NA
5. P	A5WAY8	D-amino acid dehydrogenase	5.83e-03	1.79e-13	NA	NA
5. P	Q4JV42	Probable malate:quinone oxidoreductase	1.73e-02	2.65e-06	NA	NA
5. P	A1A653	Fe-regulated protein 8	3.46e-01	1.86e-02	NA	NA
5. P	B4T3B2	Nitric oxide reductase FlRd-NAD(+) reductase	5.41e-01	1.58e-02	NA	NA
5. P	Q9ZTP4	Zeta-carotene desaturase, chloroplastic/chromoplastic	1.29e-04	1.28e-08	NA	NA
5. P	Q52671	Sarcosine oxidase subunit beta	1.22e-02	1.13e-09	NA	NA
5. P	B7GYG6	Probable malate:quinone oxidoreductase	4.46e-02	3.14e-06	NA	NA
5. P	A7ZZC3	D-amino acid dehydrogenase	1.26e-02	5.59e-13	NA	NA
5. P	A8GBY8	Probable malate:quinone oxidoreductase	5.56e-02	1.32e-05	NA	NA
5. P	Q5HKD6	Probable malate:quinone oxidoreductase 3	5.23e-02	6.89e-06	NA	NA
5. P	Q8VHE9	All-trans-retinol 13,14-reductase	5.46e-04	4.58e-06	NA	NA
5. P	P72299	Opine oxidase subunit B	4.28e-02	1.36e-11	NA	NA
5. P	C3LW14	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.95e-01	1.06e-06	NA	NA
5. P	Q6DCP1	FAD-dependent oxidoreductase domain-containing protein 1	4.18e-02	1.32e-05	NA	NA
5. P	Q819X4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.47e-01	4.17e-02	NA	NA
5. P	B5R258	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.51e-01	1.58e-08	NA	NA
5. P	Q4QMN2	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.53e-01	1.05e-08	NA	NA
5. P	Q669J9	N-methyl-L-tryptophan oxidase	3.83e-02	1.23e-09	NA	NA
5. P	P50970	Dihydrolipoyl dehydrogenase	3.19e-01	4.28e-03	NA	NA
5. P	A9MFX5	Nitric oxide reductase FlRd-NAD(+) reductase	4.67e-01	1.88e-02	NA	NA
5. P	B8HAT7	Probable malate:quinone oxidoreductase	2.50e-02	1.26e-06	NA	NA
5. P	P40874	N-methyl-L-tryptophan oxidase	9.12e-02	4.85e-09	NA	NA
5. P	B6I7H1	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.21e-01	2.45e-06	NA	NA
5. P	P9WN81	Glycerol-3-phosphate dehydrogenase 1	4.69e-02	2.19e-02	NA	NA
5. P	A7MNG1	Probable malate:quinone oxidoreductase	7.92e-02	3.79e-03	NA	NA
5. P	B7N5K6	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.25e-01	1.22e-06	NA	NA
5. P	Q8YNJ4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.15e-01	2.19e-02	NA	NA
5. P	Q8Z4C4	Nitric oxide reductase FlRd-NAD(+) reductase	5.06e-01	1.75e-02	NA	NA
5. P	A3KCL7	D-aspartate oxidase	7.69e-02	7.12e-07	NA	NA
5. P	Q98F08	D-amino acid dehydrogenase 1	1.12e-02	7.87e-13	NA	NA
5. P	Q8FFN4	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.07e-01	3.60e-07	NA	NA
5. P	A0RFE8	Probable malate:quinone oxidoreductase	2.27e-02	9.81e-04	NA	NA
5. P	Q2RNR2	Ferredoxin--NADP reductase	1.83e-01	5.17e-03	NA	NA
5. P	B6I697	Nitric oxide reductase FlRd-NAD(+) reductase	5.32e-01	2.93e-02	NA	NA
5. P	B1XA76	D-amino acid dehydrogenase	1.19e-02	5.59e-13	NA	NA
5. P	Q9HNS3	Probable anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.21e-01	2.59e-07	NA	NA
5. P	Q636J4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.92e-01	3.99e-02	NA	NA
5. P	P79076	Pyranose 2-oxidase	5.59e-01	1.43e-05	NA	NA
5. P	Q18006	Putative sarcosine oxidase	2.93e-02	7.36e-11	NA	NA
5. P	B6JPI8	Probable malate:quinone oxidoreductase	1.61e-02	3.72e-09	NA	NA
5. P	A8A3I8	Nitric oxide reductase FlRd-NAD(+) reductase	6.51e-01	3.62e-02	NA	NA
5. P	A8YV48	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.20e-01	1.89e-02	NA	NA
5. P	A9BE38	Probable malate:quinone oxidoreductase	4.13e-02	3.51e-05	NA	NA
5. P	O87388	Sarcosine oxidase subunit beta	1.26e-02	1.88e-08	NA	NA
5. P	Q816D9	Ferredoxin--NADP reductase	1.85e-01	4.75e-02	NA	NA
5. P	Q99042	D-amino-acid oxidase	1.20e-01	1.07e-07	NA	NA
5. P	Q3JQ00	D-amino acid dehydrogenase	6.04e-03	2.61e-12	NA	NA
5. P	Q8X850	Nitric oxide reductase FlRd-NAD(+) reductase	6.28e-01	3.69e-02	NA	NA
5. P	C4ZTN0	D-amino acid dehydrogenase	1.25e-02	5.59e-13	NA	NA
5. P	A6TBU4	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.38e-01	2.30e-10	NA	NA
5. P	Q58845	Uncharacterized protein MJ1450	5.88e-02	2.78e-06	NA	NA
5. P	Q9UJX0	Oxidative stress-induced growth inhibitor 1	7.50e-01	4.67e-02	NA	NA
5. P	Q0BQJ9	Ferredoxin--NADP reductase	1.95e-01	1.73e-02	NA	NA
5. P	A9M3T2	D-amino acid dehydrogenase	1.24e-02	1.14e-14	NA	NA
5. P	P0DPS2	L-amino oxidase (Fragments)	NA	3.47e-04	NA	NA
5. P	P40012	Protoporphyrinogen oxidase	9.97e-06	2.74e-20	NA	NA
5. P	Q9SU79	Probable polyamine oxidase 5	2.63e-03	2.07e-07	NA	NA
5. P	B5XVA0	Nitric oxide reductase FlRd-NAD(+) reductase	4.85e-01	2.61e-02	NA	NA
5. P	Q2U5I0	Probable FAD-dependent monooxygenase kojA	6.63e-02	7.45e-04	NA	NA
5. P	Q3IXK6	D-amino acid dehydrogenase	1.68e-02	1.22e-12	NA	NA
5. P	Q6GDJ6	Probable malate:quinone oxidoreductase 2	4.53e-02	2.16e-04	NA	NA
5. P	A4IMR6	Probable malate:quinone oxidoreductase	2.56e-02	5.30e-05	NA	NA
5. P	P00393	Type II NADH:quinone oxidoreductase	4.56e-01	3.72e-02	NA	NA
5. P	B7M5Q1	Probable malate:quinone oxidoreductase	4.88e-02	7.84e-03	NA	NA
5. P	B5BCR1	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.49e-01	1.58e-08	NA	NA
5. P	Q9H9P8	L-2-hydroxyglutarate dehydrogenase, mitochondrial	2.20e-02	2.14e-04	NA	NA
5. P	B5RDG6	Nitric oxide reductase FlRd-NAD(+) reductase	5.69e-01	3.38e-02	NA	NA
5. P	Q10305	Probable secretory pathway GDP dissociation inhibitor 1	1.83e-03	2.57e-15	NA	NA
5. P	A4QF08	Probable malate:quinone oxidoreductase	2.34e-02	4.43e-07	NA	NA
5. P	A8A273	Probable malate:quinone oxidoreductase	5.44e-02	7.02e-03	NA	NA
5. P	C4L614	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.86e-01	3.92e-02	NA	NA
5. P	B5QV90	Nitric oxide reductase FlRd-NAD(+) reductase	5.05e-01	1.78e-02	NA	NA
5. P	B2JF25	D-amino acid dehydrogenase	1.87e-02	1.62e-12	NA	NA
5. P	P25262	Modification methylase HgiBI	7.93e-01	1.51e-02	NA	NA
5. P	Q7N3Z6	D-amino acid dehydrogenase	5.44e-03	4.69e-12	NA	NA
5. P	A4JCJ3	D-amino acid dehydrogenase	1.63e-02	3.75e-12	NA	NA
5. P	Q0J290	Polyamine oxidase 7	3.92e-03	3.92e-06	NA	NA
5. P	Q8FIR3	N-methyl-L-tryptophan oxidase	9.07e-02	6.46e-09	NA	NA
5. P	Q8XX54	D-amino acid dehydrogenase 2	1.19e-02	1.45e-14	NA	NA
5. P	O35078	D-amino-acid oxidase	8.70e-02	1.72e-07	NA	NA
5. P	Q83ML0	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.14e-01	1.75e-06	NA	NA
5. P	B1X8A6	Probable malate:quinone oxidoreductase	5.77e-02	1.67e-02	NA	NA
5. P	P85207	Dihydrolipoyl dehydrogenase	4.76e-01	3.65e-02	NA	NA
5. P	Q7V2Q2	Probable malate:quinone oxidoreductase	3.02e-02	2.78e-06	NA	NA
5. P	Q73GH2	Ferredoxin--NADP reductase	1.73e-01	5.26e-03	NA	NA
5. P	B7MXS2	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.98e-01	1.71e-06	NA	NA
5. P	B1LQ29	Nitric oxide reductase FlRd-NAD(+) reductase	6.98e-01	2.96e-02	NA	NA
5. P	A8F1N2	Ferredoxin--NADP reductase	1.80e-01	2.68e-02	NA	NA
5. P	Q7NWR6	D-amino acid dehydrogenase	5.82e-03	3.86e-11	NA	NA
5. P	Q31ZB5	N-methyl-L-tryptophan oxidase	9.12e-02	4.27e-09	NA	NA
5. P	Q9M9Y8	Prolycopene isomerase, chloroplastic	6.99e-04	6.59e-06	NA	NA
5. P	B1YV52	D-amino acid dehydrogenase	7.42e-03	3.40e-12	NA	NA
5. P	B1LIV1	N-methyl-L-tryptophan oxidase	9.15e-02	6.31e-09	NA	NA
5. P	Q81P44	Probable malate:quinone oxidoreductase	2.26e-02	8.89e-04	NA	NA
5. P	Q7ZAG8	Sulfide-quinone reductase	4.82e-01	5.30e-05	NA	NA
5. P	B1X8D6	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.29e-01	2.45e-06	NA	NA
5. P	Q7XR46	Polyamine oxidase 4	3.81e-04	3.35e-07	NA	NA
5. P	P58524	N-methyl-L-tryptophan oxidase	4.10e-02	6.72e-10	NA	NA
5. P	Q2NS49	Probable malate:quinone oxidoreductase	4.35e-02	2.13e-03	NA	NA
5. P	A8GW75	Ferredoxin--NADP reductase	1.71e-01	1.96e-02	NA	NA
5. P	P40875	Sarcosine oxidase subunit beta	8.39e-03	5.03e-08	NA	NA
5. P	Q1CBK6	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.01e-01	2.71e-08	NA	NA
5. P	A8WXM1	D-aspartate oxidase 2	4.35e-02	1.20e-06	NA	NA
5. P	Q1C6L1	N-methyl-L-tryptophan oxidase	4.15e-02	1.23e-09	NA	NA
5. P	P21397	Amine oxidase [flavin-containing] A	4.50e-04	6.74e-05	NA	NA
5. P	Q922Z0	D-aspartate oxidase	9.72e-02	7.72e-05	NA	NA
5. P	P0A0E6	Dihydrolipoyl dehydrogenase	3.90e-01	1.16e-02	NA	NA
5. P	A0KJP1	D-amino acid dehydrogenase	8.05e-03	5.13e-13	NA	NA
5. P	C3LT39	D-amino acid dehydrogenase	1.17e-02	3.64e-15	NA	NA
5. P	Q89HV6	Ferredoxin--NADP reductase	1.96e-01	4.47e-02	NA	NA
5. P	Q1BY09	D-amino acid dehydrogenase	6.23e-03	3.86e-12	NA	NA
5. P	Q9JXD7	Probable malate:quinone oxidoreductase	4.61e-02	1.41e-05	NA	NA
5. P	P38758	Putative oxidoreductase TDA3	1.75e-02	2.78e-06	NA	NA
5. P	Q61598	Rab GDP dissociation inhibitor beta	1.71e-03	6.19e-14	NA	NA
5. P	A0AWY9	Probable malate:quinone oxidoreductase	4.22e-02	9.40e-05	NA	NA
5. P	Q9CQF9	Prenylcysteine oxidase	5.10e-05	8.18e-14	NA	NA
5. P	Q29RU9	Peroxisomal sarcosine oxidase	4.50e-02	4.73e-09	NA	NA
5. P	Q9HUH4	Probable FAD-dependent oxidoreductase PA4991	5.20e-02	1.35e-14	NA	NA
5. P	Q88Q83	Glycine oxidase	3.05e-02	2.13e-13	NA	NA
5. P	Q7MF00	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.36e-01	1.89e-06	NA	NA
5. P	Q1LPH7	Ferredoxin--NADP reductase 1	2.49e-01	4.32e-02	NA	NA
5. P	B0UVX7	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.09e-01	2.34e-08	NA	NA
5. P	Q8J136	Pyranose 2-oxidase	5.53e-01	1.09e-05	NA	NA
5. P	A4TLT6	N-methyl-L-tryptophan oxidase	3.64e-02	1.23e-09	NA	NA
5. P	A8EYV4	Ferredoxin--NADP reductase	1.57e-01	3.62e-02	NA	NA
5. P	A9MH03	N-methyl-L-tryptophan oxidase	3.35e-02	9.28e-10	NA	NA
5. P	A5CPE3	Probable malate:quinone oxidoreductase	2.97e-02	7.60e-06	NA	NA
5. P	Q8ZAH6	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.73e-01	2.71e-08	NA	NA
5. P	Q887Z4	Probable malate:quinone oxidoreductase	3.76e-02	1.69e-04	NA	NA
5. P	P75728	3-demethoxyubiquinol 3-hydroxylase	5.68e-02	5.02e-04	NA	NA
5. P	Q0TII6	D-amino acid dehydrogenase	1.16e-02	5.59e-13	NA	NA
5. P	A5CF57	Ferredoxin--NADP reductase	1.88e-01	4.96e-02	NA	NA
5. P	Q96RQ9	L-amino-acid oxidase	4.54e-03	1.99e-04	NA	NA
5. P	A5F3D0	D-amino acid dehydrogenase	1.19e-02	6.00e-15	NA	NA
5. P	Q1R7Y9	Nitric oxide reductase FlRd-NAD(+) reductase	5.60e-01	4.13e-02	NA	NA
5. P	A7ZP63	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.86e-01	1.73e-06	NA	NA
5. P	B7JBP8	Sulfide-quinone reductase	3.09e-01	3.45e-03	NA	NA
5. P	Q556K3	Probable flavin-containing monoamine oxidase B	1.05e-04	2.48e-14	NA	NA
5. P	Q1WUT6	Ferredoxin--NADP reductase	2.49e-01	3.12e-02	NA	NA
5. P	B7JJB0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.97e-01	3.99e-02	NA	NA
5. P	Q5HGY8	Dihydrolipoyl dehydrogenase	3.86e-01	1.16e-02	NA	NA
5. P	B0RIH2	Probable malate:quinone oxidoreductase	2.94e-02	2.58e-05	NA	NA
5. P	B5XNY5	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.68e-01	5.23e-09	NA	NA
5. P	A7RDN6	Renalase	1.91e-04	1.92e-12	NA	NA
5. P	A3N262	Probable malate:quinone oxidoreductase	2.76e-02	1.58e-06	NA	NA
5. P	O45307	D-aspartate oxidase 1	5.34e-02	2.39e-05	NA	NA
5. P	B5XQ81	D-amino acid dehydrogenase	1.41e-02	1.87e-13	NA	NA
5. P	Q91YP0	L-2-hydroxyglutarate dehydrogenase, mitochondrial	2.29e-02	1.04e-03	NA	NA
5. P	B7MFC3	Probable malate:quinone oxidoreductase	5.35e-02	1.05e-02	NA	NA
5. P	P24386	Rab proteins geranylgeranyltransferase component A 1	4.79e-02	3.44e-02	NA	NA
5. P	Q732N8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.80e-01	4.10e-02	NA	NA
5. P	A5FGX2	Probable malate:quinone oxidoreductase	4.80e-02	1.35e-05	NA	NA
5. P	Q0TEG9	Nitric oxide reductase FlRd-NAD(+) reductase	5.74e-01	3.12e-02	NA	NA
5. P	Q88PU7	Probable malate:quinone oxidoreductase 1	3.68e-02	9.46e-06	NA	NA
5. P	Q0VTB0	Rubredoxin-NAD(+) reductase	3.62e-01	2.43e-02	NA	NA
5. P	A9R9D3	D-amino acid dehydrogenase	1.30e-02	2.40e-12	NA	NA
5. P	Q0DUI8	15-cis-phytoene desaturase, chloroplastic/chromoplastic	5.67e-04	6.60e-05	NA	NA
5. P	Q5B2E9	Pyranose 2-oxidase	2.21e-01	9.21e-05	NA	NA
5. P	B0KQ74	D-amino acid dehydrogenase	5.66e-03	1.36e-13	NA	NA
5. P	P22942	D-amino-acid oxidase	7.21e-02	1.53e-06	NA	NA
5. P	P65422	Probable malate:quinone oxidoreductase 1	7.16e-02	1.16e-06	NA	NA
5. P	Q65R09	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.45e-01	2.50e-07	NA	NA
5. P	C0ZY77	Probable malate:quinone oxidoreductase	4.07e-02	2.54e-04	NA	NA
5. P	Q8ZEL7	D-amino acid dehydrogenase	5.81e-03	2.40e-12	NA	NA
5. P	Q8LLD4	Rab escort protein 1	6.32e-03	1.54e-05	NA	NA
5. P	B9JI94	D-amino acid dehydrogenase	1.40e-02	2.43e-13	NA	NA
5. P	B5F947	N-methyl-L-tryptophan oxidase	3.81e-02	5.18e-10	NA	NA
5. P	A1TRN6	Ferredoxin--NADP reductase	2.21e-01	7.42e-03	NA	NA
5. P	B0R6S4	Probable anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.40e-01	2.59e-07	NA	NA
5. P	A6TCX6	Nitric oxide reductase FlRd-NAD(+) reductase	5.69e-01	4.32e-02	NA	NA
5. P	Q32DU5	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.01e-01	8.26e-07	NA	NA
5. P	Q31Z75	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.04e-01	5.99e-07	NA	NA
5. P	Q6TGQ9	L-amino-acid oxidase (Fragment)	1.16e-03	1.15e-06	NA	NA
5. P	B5FXE5	Ferroptosis suppressor protein 1	1.97e-01	4.32e-02	NA	NA
5. P	Q8D1V2	Probable malate:quinone oxidoreductase	4.86e-02	1.72e-07	NA	NA
5. P	Q8ZMJ6	Nitric oxide reductase FlRd-NAD(+) reductase	5.93e-01	1.78e-02	NA	NA
5. P	P58523	N-methyl-L-tryptophan oxidase	9.27e-02	6.38e-09	NA	NA
5. P	Q5L2C2	Glycine oxidase	1.76e-02	1.29e-10	NA	NA
5. P	A9N5C9	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.92e-01	2.20e-08	NA	NA
5. P	A4XSQ1	Soluble pyridine nucleotide transhydrogenase	2.41e-01	2.66e-02	NA	NA
5. P	Q492E3	Probable malate:quinone oxidoreductase	3.51e-02	1.46e-03	NA	NA
5. P	Q32H27	D-amino acid dehydrogenase	1.25e-02	3.10e-13	NA	NA
5. P	Q64FW2	All-trans-retinol 13,14-reductase	6.94e-04	2.64e-05	NA	NA
5. P	Q88EM0	D-amino acid dehydrogenase 1	5.70e-03	3.69e-13	NA	NA
5. P	P48638	Glutathione reductase	3.50e-01	4.92e-02	NA	NA
5. P	B1X9H2	N-methyl-L-tryptophan oxidase	9.10e-02	4.85e-09	NA	NA
5. P	Q5HCU5	Probable malate:quinone oxidoreductase 2	4.41e-02	2.16e-04	NA	NA
5. P	Q7UCT6	D-amino acid dehydrogenase	1.23e-02	3.58e-13	NA	NA
5. P	B4RR07	D-amino acid dehydrogenase	1.12e-02	3.43e-15	NA	NA
5. P	Q3U4I7	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2	4.46e-03	1.03e-04	NA	NA
5. P	O34292	Putative thiamine biosynthesis oxidoreductase ThiO	6.60e-03	6.76e-14	NA	NA
5. P	P64183	Glycerol-3-phosphate dehydrogenase 1	5.10e-02	2.19e-02	NA	NA
5. P	B9IVC1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.74e-01	2.80e-02	NA	NA
5. P	Q9LXC0	Guanosine nucleotide diphosphate dissociation inhibitor At5g09550	1.46e-03	3.24e-13	NA	NA
5. P	O34363	Putative L-amino-acid oxidase YobN	3.37e-04	2.97e-09	NA	NA
5. P	Q1GGU2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.93e-01	4.24e-02	NA	NA
5. P	Q99K82	Spermine oxidase	3.42e-03	2.23e-08	NA	NA
5. P	P50395	Rab GDP dissociation inhibitor beta	1.96e-03	3.24e-13	NA	NA
5. P	B2I8R2	Probable malate:quinone oxidoreductase	5.21e-02	4.21e-03	NA	NA
5. P	Q9D826	Peroxisomal sarcosine oxidase	3.90e-02	3.49e-09	NA	NA
5. P	Q9ZMY5	Malate:quinone oxidoreductase	2.17e-02	3.00e-09	NA	NA
5. P	Q1RHV1	Ferredoxin--NADP reductase	1.73e-01	2.07e-02	NA	NA
5. P	B2K770	N-methyl-L-tryptophan oxidase	4.11e-02	1.23e-09	NA	NA
5. P	B7MIK0	N-methyl-L-tryptophan oxidase	9.27e-02	8.40e-09	NA	NA
5. P	B2VJ51	D-amino acid dehydrogenase	6.66e-03	2.25e-11	NA	NA
5. P	A2BV78	Probable malate:quinone oxidoreductase	3.86e-02	1.08e-05	NA	NA
5. P	Q3S8R0	6-methylpretetramide 4-monooxygenase	4.56e-02	4.41e-04	NA	NA
5. P	Q46GZ7	Probable malate:quinone oxidoreductase	5.22e-02	6.89e-06	NA	NA
5. P	A1A9V4	N-methyl-L-tryptophan oxidase	9.18e-02	8.40e-09	NA	NA
5. P	Q5R9N7	L-2-hydroxyglutarate dehydrogenase, mitochondrial	2.38e-02	8.76e-06	NA	NA
5. P	Q9HTQ0	D-amino acid dehydrogenase 1	6.25e-03	6.00e-13	NA	NA
5. P	B8IJ86	D-amino acid dehydrogenase	8.87e-03	2.85e-13	NA	NA
5. P	Q8ZP17	D-amino acid dehydrogenase	1.30e-02	1.82e-13	NA	NA
5. P	B8NI25	Amino acid oxidase imqH	7.74e-02	1.97e-08	NA	NA
5. P	A1T7G4	Probable malate:quinone oxidoreductase	4.13e-02	3.11e-03	NA	NA
5. P	O43029	L-pipecolate oxidase	1.88e-02	1.02e-08	NA	NA
5. P	Q9Z3S3	Probable oxidoreductase OrdL	1.16e-02	4.21e-10	NA	NA
5. P	P21880	Dihydrolipoyl dehydrogenase	5.74e-01	5.94e-03	NA	NA
5. P	B4F1H1	Soluble pyridine nucleotide transhydrogenase	2.46e-01	4.47e-02	NA	NA
5. P	A4WCP1	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.77e-01	1.74e-07	NA	NA
5. P	Q5LST0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.35e-01	2.21e-02	NA	NA
5. P	Q5W9R9	Phenylalanine 2-monooxygenase precursor	1.80e-02	2.19e-06	NA	NA
5. P	Q9UTM9	L-saccharopine oxidase	4.84e-02	5.17e-06	NA	NA
5. P	B2FSQ8	Probable malate:quinone oxidoreductase	4.47e-02	2.99e-03	NA	NA
5. P	Q13VE3	D-amino acid dehydrogenase	6.93e-03	2.09e-12	NA	NA
5. P	Q8N2H3	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2	2.51e-03	1.16e-04	NA	NA
5. P	Q9PF27	D-amino acid dehydrogenase	6.53e-03	3.81e-14	NA	NA
5. P	Q166D3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.14e-01	1.81e-02	NA	NA
5. P	P43800	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.47e-01	2.23e-08	NA	NA
5. P	Q9HU99	D-amino acid dehydrogenase 2	1.56e-02	7.86e-15	NA	NA
5. P	Q5F5E9	Probable malate:quinone oxidoreductase	2.90e-02	1.11e-05	NA	NA
5. P	A0AI79	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.18e-01	1.49e-02	NA	NA
5. P	A8AFS0	D-amino acid dehydrogenase	1.22e-02	2.47e-13	NA	NA
5. P	C6DH98	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	4.39e-01	5.16e-09	NA	NA
5. P	Q7W641	D-amino acid dehydrogenase	6.16e-03	5.28e-13	NA	NA
5. P	Q1GXL1	Probable malate:quinone oxidoreductase	3.07e-02	1.63e-05	NA	NA
5. P	B5ET22	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	4.24e-01	4.67e-08	NA	NA
5. P	Q68FT3	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2	2.77e-03	7.96e-05	NA	NA
5. P	Q2FXA5	Coproporphyrinogen III oxidase	1.06e-05	1.85e-19	NA	NA
5. P	Q8NBM8	Prenylcysteine oxidase-like	1.84e-05	2.30e-14	NA	NA
5. P	Q8P4Q9	D-amino acid dehydrogenase	6.28e-03	3.81e-14	NA	NA
5. P	Q8H191	Probable polyamine oxidase 4	7.45e-04	6.20e-07	NA	NA
5. P	Q3YZZ7	Probable malate:quinone oxidoreductase	7.30e-02	8.44e-03	NA	NA
5. P	P37727	Rab proteins geranylgeranyltransferase component A 1	4.82e-02	1.43e-02	NA	NA
5. P	Q3ALG7	Probable malate:quinone oxidoreductase	4.27e-02	4.18e-07	NA	NA
5. P	B1IUA3	D-amino acid dehydrogenase	1.35e-02	5.59e-13	NA	NA
5. P	O69282	Malate:quinone oxidoreductase	2.40e-02	4.43e-07	NA	NA
5. P	A8AI19	N-methyl-L-tryptophan oxidase	3.64e-02	2.48e-09	NA	NA
5. P	Q10058	Putative oxidoreductase C1F5.03c	5.02e-02	3.49e-09	NA	NA
5. P	Q6NSN2	Amine oxidase [flavin-containing]	4.03e-04	2.78e-05	NA	NA
5. P	B9DPG3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.36e-01	2.05e-02	NA	NA
5. P	Q62M46	D-amino acid dehydrogenase	5.14e-03	1.71e-12	NA	NA
5. P	C0PWN3	Nitric oxide reductase FlRd-NAD(+) reductase	4.93e-01	3.53e-02	NA	NA
5. P	B4EXU2	D-amino acid dehydrogenase	6.11e-03	1.58e-11	NA	NA
5. P	P26374	Rab proteins geranylgeranyltransferase component A 2	4.94e-02	1.75e-02	NA	NA
5. P	B7NJF1	D-amino acid dehydrogenase	1.32e-02	5.59e-13	NA	NA
5. P	Q9ZD33	Ferredoxin--NADP reductase	1.74e-01	3.69e-02	NA	NA
5. P	Q8C0L6	Peroxisomal N(1)-acetyl-spermine/spermidine oxidase	3.06e-03	3.63e-06	NA	NA
5. P	A9MJD3	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.94e-01	1.15e-08	NA	NA
5. P	Q1I2V6	D-amino acid dehydrogenase	6.47e-03	2.33e-13	NA	NA
5. P	P9WEX5	FAD-dependent oxidoreductase dpasF	1.82e-03	1.57e-16	NA	NA
5. P	B2TZB5	D-amino acid dehydrogenase	1.45e-02	3.15e-13	NA	NA
5. P	P9WMP1	Coproporphyrinogen III oxidase	1.64e-05	5.51e-18	NA	NA
5. P	A7FH13	N-methyl-L-tryptophan oxidase	4.14e-02	1.23e-09	NA	NA
5. P	B4TPG8	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.92e-01	1.72e-08	NA	NA
5. P	C6DGU9	D-amino acid dehydrogenase	1.59e-02	2.21e-12	NA	NA
5. P	Q66FX5	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.64e-01	1.88e-08	NA	NA
5. P	Q9P0Z9	Peroxisomal sarcosine oxidase	2.28e-02	9.64e-10	NA	NA
5. P	B7MXP1	Probable malate:quinone oxidoreductase	4.97e-02	1.11e-02	NA	NA
5. P	Q9FNA2	Polyamine oxidase 1	1.41e-03	7.36e-06	NA	NA
5. P	P0A0E7	Dihydrolipoyl dehydrogenase	3.84e-01	1.16e-02	NA	NA
5. P	B3H0P4	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.73e-01	1.25e-08	NA	NA
5. P	B1HNU2	Probable malate:quinone oxidoreductase	2.84e-02	1.20e-06	NA	NA
5. P	Q3Z2V9	D-amino acid dehydrogenase	1.27e-02	5.59e-13	NA	NA
5. P	B7MKI0	Nitric oxide reductase FlRd-NAD(+) reductase	6.35e-01	4.13e-02	NA	NA
5. P	P49086	15-cis-phytoene desaturase, chloroplastic/chromoplastic	1.81e-04	8.21e-06	NA	NA
5. P	Q17VT7	Probable malate:quinone oxidoreductase	1.68e-02	2.28e-08	NA	NA
5. P	P9WJP5	Probable malate:quinone oxidoreductase	2.72e-02	2.07e-06	NA	NA
5. P	B7LM86	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.19e-01	1.33e-06	NA	NA
5. P	B7M5S7	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.20e-01	2.45e-06	NA	NA
5. P	B4F088	Probable malate:quinone oxidoreductase	1.83e-02	5.60e-04	NA	NA
5. P	B4TT18	Nitric oxide reductase FlRd-NAD(+) reductase	5.21e-01	1.70e-02	NA	NA
5. P	A1RVM8	D-proline dehydrogenase	4.23e-02	3.27e-18	NA	NA
5. P	A7MBI3	L-2-hydroxyglutarate dehydrogenase, mitochondrial	2.36e-02	6.53e-05	NA	NA
5. P	Q9LYT1	Polyamine oxidase 3	7.77e-04	3.86e-05	NA	NA
5. P	Q88CB1	D-amino acid dehydrogenase 2	5.51e-03	1.32e-13	NA	NA
5. P	Q1QUD2	Probable malate:quinone oxidoreductase	3.49e-02	7.69e-06	NA	NA
5. P	Q8Y7K1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.41e-01	2.19e-02	NA	NA
5. P	P37906	Gamma-glutamylputrescine oxidoreductase	1.56e-02	1.32e-10	NA	NA
5. P	B1YG64	Probable malate:quinone oxidoreductase	3.09e-02	1.31e-04	NA	NA
5. P	Q1BKI8	Probable malate:quinone oxidoreductase	6.61e-02	9.40e-05	NA	NA
5. P	Q0T5X2	N-methyl-L-tryptophan oxidase	9.31e-02	5.92e-09	NA	NA
5. P	B7HLG5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.79e-01	4.10e-02	NA	NA
5. P	Q31ZN0	D-amino acid dehydrogenase	1.21e-02	3.58e-13	NA	NA
5. P	A1KRK7	D-amino acid dehydrogenase	1.30e-02	4.22e-14	NA	NA
5. P	A9WVT6	D-amino acid dehydrogenase	5.90e-03	8.98e-12	NA	NA
5. P	P72449	Carotenoid phi-ring synthase	1.38e-04	1.05e-21	NA	NA
5. P	B7NSJ1	Nitric oxide reductase FlRd-NAD(+) reductase	5.48e-01	1.37e-02	NA	NA
5. P	Q6LSE4	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	4.94e-01	4.96e-08	NA	NA
5. P	Q3YZW4	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.23e-01	2.45e-06	NA	NA
5. P	A0QVL2	Probable malate:quinone oxidoreductase	3.55e-02	1.83e-04	NA	NA
5. P	Q81WK3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.68e-01	3.17e-02	NA	NA
5. P	Q8D7Y4	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.42e-01	2.37e-06	NA	NA
5. P	Q8Y0W7	D-amino acid dehydrogenase 1	8.02e-03	3.02e-13	NA	NA
5. P	Q5NAI7	Polyamine oxidase 1	4.53e-03	3.67e-06	NA	NA
5. P	Q32CL7	Nitric oxide reductase FlRd-NAD(+) reductase	6.29e-01	3.92e-02	NA	NA
5. P	A9N5Q2	N-methyl-L-tryptophan oxidase	3.54e-02	6.72e-10	NA	NA
5. P	F8G0M4	6-hydroxy-3-succinoylpyridine 3-monooxygenase HspB	6.51e-02	3.69e-02	NA	NA
5. P	P44732	Probable oxidoreductase OrdL	6.38e-03	6.89e-10	NA	NA
5. P	B4SIE4	D-amino acid dehydrogenase	7.59e-03	2.56e-14	NA	NA
5. P	B4EAP1	D-amino acid dehydrogenase	6.32e-03	1.35e-12	NA	NA
5. P	A8GNK2	Ferredoxin--NADP reductase	1.73e-01	4.13e-02	NA	NA
5. P	B7MG07	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	4.24e-01	9.48e-07	NA	NA
5. P	A0RHK5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.36e-01	3.96e-02	NA	NA
5. P	A1JIB0	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.56e-01	3.29e-08	NA	NA
5. P	Q8J2V8	Pyranose 2-oxidase	1.11e-01	3.79e-06	NA	NA
5. P	B7UQ73	D-amino acid dehydrogenase	1.27e-02	1.18e-13	NA	NA
5. P	B2T612	D-amino acid dehydrogenase	7.23e-03	3.70e-12	NA	NA
5. P	Q4ULM2	Ferredoxin--NADP reductase	1.72e-01	2.80e-02	NA	NA
5. P	C4LEV7	Probable malate:quinone oxidoreductase	1.14e-01	1.75e-06	NA	NA
5. P	Q2YIL0	D-amino acid dehydrogenase	5.27e-03	4.37e-12	NA	NA
5. P	Q19910	Uncharacterized protein F30B5.4	6.94e-01	9.25e-03	NA	NA
5. P	Q59159	Opine oxidase subunit B	4.88e-02	3.00e-12	NA	NA
5. P	Q54IT3	Probable flavin-containing monoamine oxidase A	5.06e-05	7.25e-17	NA	NA
5. P	A4WCM3	Probable malate:quinone oxidoreductase	5.38e-02	1.02e-02	NA	NA
5. P	P00371	D-amino-acid oxidase	7.98e-02	5.41e-06	NA	NA
5. P	Q6G669	Probable malate:quinone oxidoreductase 2	3.10e-02	2.16e-04	NA	NA
5. P	Q48A14	Soluble pyridine nucleotide transhydrogenase	2.75e-01	1.69e-02	NA	NA
5. P	Q9V8W3	Rab proteins geranylgeranyltransferase component A	2.20e-03	7.40e-05	NA	NA
5. P	Q54DT8	Protoporphyrinogen oxidase	2.33e-04	7.47e-19	NA	NA
5. P	Q2GGH5	Ferredoxin--NADP reductase	1.76e-01	3.75e-02	NA	NA
5. P	B1LLJ4	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.03e-01	9.70e-07	NA	NA
5. P	A8AE07	Probable malate:quinone oxidoreductase	6.76e-02	4.28e-02	NA	NA
5. P	D2E9W9	FAD-dependent monooxygenase DEP4	4.05e-01	1.00e-03	NA	NA
5. P	A7MKD3	D-amino acid dehydrogenase	1.57e-02	9.07e-13	NA	NA
5. P	Q7X809	Polyamine oxidase 3	3.56e-04	2.47e-05	NA	NA
5. P	Q1C7V0	D-amino acid dehydrogenase	1.59e-02	2.40e-12	NA	NA
5. P	O60112	Uncharacterized Rab geranylgeranyltransferase C15C4.03	6.61e-03	5.47e-08	NA	NA
5. P	B1JHH1	N-methyl-L-tryptophan oxidase	3.27e-02	1.23e-09	NA	NA
5. P	Q1BAA7	Probable malate:quinone oxidoreductase	3.94e-02	9.34e-04	NA	NA
5. P	P19643	Amine oxidase [flavin-containing] B	5.09e-04	3.42e-03	NA	NA
5. P	B7NAT4	N-methyl-L-tryptophan oxidase	9.20e-02	3.12e-09	NA	NA
5. P	Q8Z687	D-amino acid dehydrogenase	1.24e-02	1.36e-13	NA	NA
5. P	P37339	L-2-hydroxyglutarate dehydrogenase	1.49e-02	4.58e-06	NA	NA
5. P	Q556K4	Probable flavin-containing monoamine oxidase C	4.59e-04	1.54e-14	NA	NA
5. P	Q2SRN2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 2	2.45e-01	9.34e-03	NA	NA
5. P	Q03ZE9	Ferredoxin--NADP reductase	2.46e-01	9.17e-03	NA	NA
5. P	Q8ZNG4	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.99e-01	1.58e-08	NA	NA
5. P	P65423	Probable malate:quinone oxidoreductase 1	3.39e-02	1.16e-06	NA	NA
5. P	Q9HYF4	Probable malate:quinone oxidoreductase 1	4.02e-02	6.31e-06	NA	NA
5. P	Q9PET6	Probable malate:quinone oxidoreductase	5.19e-02	7.98e-04	NA	NA
5. P	B7MK86	D-amino acid dehydrogenase	1.24e-02	4.71e-13	NA	NA
5. P	C0Q330	D-amino acid dehydrogenase	1.29e-02	1.19e-13	NA	NA
5. P	Q7VPC3	Probable malate:quinone oxidoreductase	2.45e-02	7.03e-04	NA	NA
5. P	B4SFQ3	Ferredoxin--NADP reductase	2.09e-01	1.42e-02	NA	NA
5. P	Q0T2N9	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.15e-01	1.46e-06	NA	NA
5. P	Q1R9H5	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.00e-01	9.48e-07	NA	NA
5. P	Q5EA45	FAD-dependent oxidoreductase domain-containing protein 1	4.50e-02	9.25e-06	NA	NA
5. P	C4L056	Probable malate:quinone oxidoreductase	2.34e-02	4.92e-05	NA	NA
5. P	Q6Q873	Thioredoxin reductase sirT	2.25e-01	2.09e-02	NA	NA
5. P	B2GFJ0	Probable malate:quinone oxidoreductase	2.95e-02	6.72e-07	NA	NA
5. P	A7Z8C1	Ferredoxin--NADP reductase 2	1.88e-01	4.71e-02	NA	NA
5. P	O24653	Guanosine nucleotide diphosphate dissociation inhibitor 2	1.14e-03	2.69e-13	NA	NA
5. P	Q5VYX0	Renalase	4.49e-03	1.36e-10	NA	NA
5. P	P0A0E8	Dihydrolipoyl dehydrogenase	3.84e-01	1.16e-02	NA	NA
5. P	Q8VPD4	L-amino acid oxidase	3.37e-03	4.09e-07	NA	NA
5. P	P79371	Peroxisomal sarcosine oxidase	2.44e-02	1.88e-09	NA	NA
5. P	Q8FEN4	Nitric oxide reductase FlRd-NAD(+) reductase	6.95e-01	3.72e-02	NA	NA
5. P	B5EYX0	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.90e-01	1.56e-08	NA	NA
5. P	A6VKT7	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.63e-01	1.47e-07	NA	NA
5. P	P73735	Demethylphylloquinone reductase NdbB	3.50e-01	3.65e-02	NA	NA
5. P	A7ZKW0	D-amino acid dehydrogenase	1.24e-02	5.59e-13	NA	NA
5. P	O25597	D-amino acid dehydrogenase	1.64e-02	7.31e-16	NA	NA
5. P	Q5URB2	Uncharacterized protein R188	NA	1.13e-10	NA	NA
5. P	B7HDV5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.89e-01	3.65e-02	NA	NA
5. P	Q0TJ15	N-methyl-L-tryptophan oxidase	9.13e-02	8.40e-09	NA	NA
5. P	Q479B1	D-amino acid dehydrogenase	1.46e-02	1.45e-14	NA	NA
5. P	B2FLQ1	D-amino acid dehydrogenase	7.54e-03	1.99e-14	NA	NA
5. P	B8F6F3	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.22e-01	1.52e-08	NA	NA
5. P	A4VGT8	D-amino acid dehydrogenase	4.76e-03	3.38e-13	NA	NA
5. P	Q96CU9	FAD-dependent oxidoreductase domain-containing protein 1	4.18e-02	5.99e-07	NA	NA
5. P	P0A6J5	D-amino acid dehydrogenase	1.20e-02	5.59e-13	NA	NA
5. P	P80324	D-amino-acid oxidase	1.47e-01	4.34e-05	NA	NA
5. P	Q87AK0	D-amino acid dehydrogenase	6.21e-03	1.43e-14	NA	NA
5. P	B5FSZ2	Nitric oxide reductase FlRd-NAD(+) reductase	5.06e-01	1.70e-02	NA	NA
5. P	B4SYV7	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.59e-01	1.58e-08	NA	NA
5. P	B7MYL1	Nitric oxide reductase FlRd-NAD(+) reductase	6.35e-01	3.92e-02	NA	NA
5. P	Q5UR19	Uncharacterized protein R656	NA	7.78e-16	NA	NA
5. P	B4RQQ5	Probable malate:quinone oxidoreductase	4.87e-02	1.11e-05	NA	NA
5. P	B7MTW7	D-amino acid dehydrogenase	1.35e-02	4.71e-13	NA	NA
5. P	Q6QHF9	Peroxisomal N(1)-acetyl-spermine/spermidine oxidase	4.85e-03	3.58e-08	NA	NA
5. P	Q31X75	Nitric oxide reductase FlRd-NAD(+) reductase	6.28e-01	2.66e-02	NA	NA
5. P	B7LMB2	Probable malate:quinone oxidoreductase	4.91e-02	6.40e-03	NA	NA
5. P	O01739	D-aspartate oxidase 3	1.20e-01	1.04e-06	NA	NA
5. P	Q5HDJ0	Probable malate:quinone oxidoreductase 1	3.61e-02	1.04e-06	NA	NA
5. P	Q7MND7	D-amino acid dehydrogenase	1.04e-02	7.65e-13	NA	NA
5. P	C5DAE0	Probable malate:quinone oxidoreductase	2.69e-02	2.09e-03	NA	NA
5. P	Q9UHG3	Prenylcysteine oxidase 1	5.05e-05	2.17e-14	NA	NA
5. P	A5UHH2	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.39e-01	5.15e-08	NA	NA
5. P	P11959	Dihydrolipoyl dehydrogenase	3.88e-01	1.72e-03	NA	NA
5. P	B7LT77	N-methyl-L-tryptophan oxidase	3.88e-02	4.67e-09	NA	NA
5. P	Q0BH74	D-amino acid dehydrogenase	6.70e-03	2.68e-12	NA	NA
5. P	Q720E5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.54e-01	9.51e-03	NA	NA
5. P	Q6MTM6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 1	2.56e-01	3.06e-02	NA	NA
5. P	Q2FV57	4,4'-diaponeurosporene oxygenase	4.65e-04	1.43e-05	NA	NA
5. P	B3CMJ8	Ferredoxin--NADP reductase	1.61e-01	9.60e-03	NA	NA
5. P	B1IY62	Probable malate:quinone oxidoreductase	5.79e-02	7.28e-03	NA	NA
5. P	Q4L5V3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.75e-01	6.52e-03	NA	NA
5. P	C3L795	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.85e-01	3.17e-02	NA	NA
5. P	P40859	Monomeric sarcosine oxidase	5.96e-02	3.37e-08	NA	NA
5. P	A7ZKG4	N-methyl-L-tryptophan oxidase	9.15e-02	7.32e-09	NA	NA
5. P	A7SMW7	L-2-hydroxyglutarate dehydrogenase, mitochondrial	3.00e-02	1.15e-06	NA	NA
5. P	Q8BW75	Amine oxidase [flavin-containing] B	5.01e-04	4.41e-04	NA	NA
5. P	Q3AWX1	Probable malate:quinone oxidoreductase	3.90e-02	5.59e-07	NA	NA
5. P	D4APQ6	Probable thioredoxin reductase ARB_06224	3.60e-01	4.63e-02	NA	NA
5. P	Q6AGY2	Probable malate:quinone oxidoreductase	3.32e-02	5.88e-05	NA	NA
5. P	G3XD12	Hydrogen cyanide synthase subunit HcnC	8.86e-03	2.40e-08	NA	NA
5. P	P21396	Amine oxidase [flavin-containing] A	4.84e-04	2.64e-05	NA	NA
5. P	Q96254	Guanosine nucleotide diphosphate dissociation inhibitor 1	1.80e-03	3.65e-12	NA	NA
5. P	Q5HL19	Probable malate:quinone oxidoreductase 4	5.27e-02	1.45e-04	NA	NA
5. P	Q2W3H2	D-amino acid dehydrogenase	1.10e-02	3.53e-13	NA	NA
5. P	B2IHR5	Ferredoxin--NADP reductase	2.00e-01	1.73e-02	NA	NA
5. P	B6I1A8	Probable malate:quinone oxidoreductase	5.57e-02	6.34e-03	NA	NA
5. P	Q6NUM9	All-trans-retinol 13,14-reductase	6.15e-04	3.83e-06	NA	NA
5. P	P32864	Rab proteins geranylgeranyltransferase component A	6.92e-03	1.01e-02	NA	NA
5. P	P56954	Probable malate:quinone oxidoreductase	1.48e-02	9.77e-10	NA	NA
5. P	Q38893	Zeta-carotene desaturase, chloroplastic/chromoplastic	2.83e-04	9.89e-12	NA	NA
5. P	B0RWG2	D-amino acid dehydrogenase	5.55e-03	4.29e-14	NA	NA
5. P	B5R2W7	D-amino acid dehydrogenase	1.23e-02	1.82e-13	NA	NA
5. P	C4ZRZ9	N-methyl-L-tryptophan oxidase	9.15e-02	4.85e-09	NA	NA
5. P	A0A1U9YHZ1	Thioredoxin reductase verT	3.01e-01	1.37e-02	NA	NA
5. P	Q83RT9	N-methyl-L-tryptophan oxidase	9.29e-02	5.92e-09	NA	NA
5. P	B1LKV7	Probable malate:quinone oxidoreductase	5.41e-02	1.93e-02	NA	NA
5. P	B2TV25	Probable malate:quinone oxidoreductase	4.56e-02	9.00e-03	NA	NA
5. P	Q9Z302	D-amino-acid oxidase	1.00e-01	1.41e-06	NA	NA
5. P	P58526	N-methyl-L-tryptophan oxidase	3.83e-02	1.23e-09	NA	NA
5. P	B2U036	Nitric oxide reductase FlRd-NAD(+) reductase	5.92e-01	4.13e-02	NA	NA
5. P	B5YX02	Probable malate:quinone oxidoreductase	7.82e-02	1.05e-02	NA	NA
5. P	Q865R1	Peroxisomal N(1)-acetyl-spermine/spermidine oxidase	4.56e-03	3.44e-05	NA	NA
5. P	P31225	Corticosteroid-binding protein	1.00e-03	7.75e-13	NA	NA
5. P	Q6GAB8	Dihydrolipoyl dehydrogenase	3.80e-01	1.16e-02	NA	NA
5. P	B0U4V3	D-amino acid dehydrogenase	6.75e-03	1.52e-14	NA	NA
5. P	A1V6K0	D-amino acid dehydrogenase	6.42e-03	1.71e-12	NA	NA
5. P	Q0T5L2	D-amino acid dehydrogenase	1.24e-02	3.58e-13	NA	NA
5. P	B7MTJ0	N-methyl-L-tryptophan oxidase	9.12e-02	3.54e-09	NA	NA
5. P	Q1CV68	Probable malate:quinone oxidoreductase	1.09e-02	2.61e-09	NA	NA
5. P	Q6D4N9	D-amino acid dehydrogenase	1.35e-02	9.07e-13	NA	NA
5. P	Q48PZ1	D-amino acid dehydrogenase	1.90e-02	1.55e-13	NA	NA
5. P	Q92XP5	Opine oxidase subunit B	3.76e-02	7.20e-12	NA	NA
5. P	Q5FT88	Ferredoxin--NADP reductase	1.23e-01	1.54e-02	NA	NA
5. P	A1KWH2	Probable malate:quinone oxidoreductase	2.28e-02	1.25e-05	NA	NA
5. P	C3PH30	Probable malate:quinone oxidoreductase	3.01e-02	1.54e-05	NA	NA
5. P	A1R7M9	Probable malate:quinone oxidoreductase	2.68e-02	1.35e-05	NA	NA
5. P	A3PY62	Probable malate:quinone oxidoreductase	5.04e-02	9.34e-04	NA	NA
5. P	Q31CB9	Probable malate:quinone oxidoreductase	3.56e-02	2.81e-06	NA	NA
5. P	Q8PGC9	D-amino acid dehydrogenase	6.29e-03	2.27e-14	NA	NA
5. P	Q19564	D-aspartate oxidase 2	4.34e-02	2.43e-06	NA	NA
5. P	Q5R748	Prenylcysteine oxidase	5.41e-05	7.40e-15	NA	NA
5. P	P25264	Modification methylase HgiCII	7.80e-01	1.47e-02	NA	NA
5. P	Q3YS71	Ferredoxin--NADP reductase	1.94e-01	3.47e-02	NA	NA
5. P	A8FH11	Ferredoxin--NADP reductase 2	1.81e-01	2.61e-02	NA	NA
5. P	B5Z372	Nitric oxide reductase FlRd-NAD(+) reductase	5.95e-01	3.69e-02	NA	NA
5. P	A1UEQ5	Probable malate:quinone oxidoreductase	5.14e-02	9.34e-04	NA	NA
5. P	Q95XG9	D-amino-acid oxidase	5.43e-02	7.80e-07	NA	NA
5. P	Q6G6V5	Probable malate:quinone oxidoreductase 1	3.50e-02	1.16e-06	NA	NA
5. P	A0A0P0XM10	Polyamine oxidase 6	2.63e-03	1.19e-06	NA	NA
5. P	A9R633	N-methyl-L-tryptophan oxidase	4.06e-02	1.23e-09	NA	NA
5. P	Q6GE66	Probable malate:quinone oxidoreductase 1	6.62e-02	1.09e-06	NA	NA
5. P	P40873	Monomeric sarcosine oxidase	3.66e-02	4.97e-09	NA	NA
5. P	A5EZR7	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.61e-01	1.51e-06	NA	NA
5. P	Q3YAT3	2-methyl-1,2-propanediol dehydrogenase	1.36e-01	2.01e-03	NA	NA
5. P	B4TSS2	N-methyl-L-tryptophan oxidase	3.55e-02	6.14e-10	NA	NA
5. P	Q5E0X7	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	4.16e-01	5.03e-09	NA	NA
5. P	Q9AGP3	Sarcosine oxidase subunit beta	8.80e-03	6.79e-08	NA	NA
5. P	A3KEZ1	D-amino acid dehydrogenase	1.33e-02	7.20e-16	NA	NA
5. P	Q9AL95	NADH-rubredoxin oxidoreductase	4.54e-01	2.43e-02	NA	NA
5. P	A5UE48	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.72e-01	1.68e-08	NA	NA
5. P	Q7U5L7	Probable malate:quinone oxidoreductase	3.52e-02	7.45e-07	NA	NA
5. P	A0A142C7A5	Oxidoreductase phnG	5.30e-01	4.59e-02	NA	NA
5. P	A1U1Y5	Soluble pyridine nucleotide transhydrogenase	2.29e-01	1.91e-02	NA	NA
5. P	Q8CQE8	Probable malate:quinone oxidoreductase 3	7.48e-02	7.04e-06	NA	NA
5. P	B5YVS9	N-methyl-L-tryptophan oxidase	9.08e-02	6.38e-09	NA	NA
5. P	C4ZU53	Probable malate:quinone oxidoreductase	6.79e-02	1.67e-02	NA	NA
5. P	B1J4P3	D-amino acid dehydrogenase	6.55e-03	1.14e-13	NA	NA
5. P	C4ZU83	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.05e-01	2.45e-06	NA	NA
5. P	Q9S3Q5	Probable malate:quinone oxidoreductase	3.87e-02	1.03e-03	NA	NA
5. P	B1XWQ5	Ferredoxin--NADP reductase	2.72e-01	4.21e-02	NA	NA
5. P	Q32I11	Probable malate:quinone oxidoreductase	5.10e-02	9.60e-03	NA	NA
5. P	B7UFQ3	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.15e-01	1.29e-06	NA	NA
5. P	Q3YYF3	Nitric oxide reductase FlRd-NAD(+) reductase	5.52e-01	4.88e-02	NA	NA
5. P	B0V6N4	D-amino acid dehydrogenase	6.86e-03	3.39e-14	NA	NA
5. P	B2TTL2	N-methyl-L-tryptophan oxidase	9.27e-02	4.27e-09	NA	NA
5. P	P31228	D-aspartate oxidase	9.37e-02	2.32e-06	NA	NA
5. P	Q9NWM0	Spermine oxidase	3.45e-03	2.89e-09	NA	NA
5. P	B7LGU9	D-amino acid dehydrogenase	1.18e-02	5.59e-13	NA	NA
5. P	P18894	D-amino-acid oxidase	9.49e-02	1.10e-07	NA	NA
5. P	Q31Z33	Probable malate:quinone oxidoreductase	5.84e-02	9.00e-03	NA	NA
5. P	B1IV43	N-methyl-L-tryptophan oxidase	9.26e-02	5.10e-09	NA	NA
5. P	Q1CJ86	D-amino acid dehydrogenase	1.58e-02	2.40e-12	NA	NA
5. P	Q9KTV1	D-amino acid dehydrogenase	1.07e-02	3.64e-15	NA	NA
5. P	Q5PF36	Nitric oxide reductase FlRd-NAD(+) reductase	5.01e-01	2.33e-02	NA	NA
5. P	Q9CF34	Ferredoxin--NADP reductase	2.33e-01	3.44e-02	NA	NA
5. P	P43783	Glutathione reductase	4.81e-01	3.85e-02	NA	NA
5. P	A7ZQE0	Nitric oxide reductase FlRd-NAD(+) reductase	6.84e-01	3.47e-02	NA	NA
5. P	Q9HTK9	Rubredoxin-NAD(+) reductase	4.44e-01	4.39e-02	NA	NA
5. P	Q5F5W1	D-amino acid dehydrogenase	7.29e-03	3.43e-15	NA	NA
5. P	P9WP26	Probable D-amino-acid oxidase	1.10e-01	1.07e-06	NA	NA
5. P	A4WBF2	D-amino acid dehydrogenase	1.59e-02	3.53e-13	NA	NA
5. P	Q8C7K6	Prenylcysteine oxidase-like	1.99e-05	3.43e-13	NA	NA
5. P	P27338	Amine oxidase [flavin-containing] B	6.15e-04	1.20e-03	NA	NA
5. P	Q58883	Uncharacterized protein MJ1488	2.95e-05	7.23e-22	NA	NA
5. P	B5BI50	D-amino acid dehydrogenase	1.26e-02	1.09e-13	NA	NA
5. P	Q8NTE1	Dihydrolipoyl dehydrogenase	3.01e-01	4.88e-02	NA	NA
5. P	A9MP60	D-amino acid dehydrogenase	1.36e-02	1.38e-13	NA	NA
5. P	B7VMK8	D-amino acid dehydrogenase	1.05e-02	3.87e-14	NA	NA
5. P	B2I8Y3	D-amino acid dehydrogenase	6.49e-03	1.43e-14	NA	NA
5. P	O31616	Glycine oxidase	5.44e-02	2.00e-09	NA	NA
5. P	Q1LU84	Probable malate:quinone oxidoreductase	3.40e-02	7.64e-05	NA	NA
5. P	B4T2Z2	N-methyl-L-tryptophan oxidase	4.02e-02	3.69e-10	NA	NA
5. P	P23342	Monomeric sarcosine oxidase	6.09e-02	1.08e-09	NA	NA
5. P	P13033	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.10e-01	2.45e-06	NA	NA
5. P	Q5G234	Pyranose 2-oxidase	3.60e-01	4.53e-05	NA	NA
5. P	P65421	Probable malate:quinone oxidoreductase 1	6.91e-02	1.16e-06	NA	NA
5. P	P99115	Probable malate:quinone oxidoreductase 2	2.84e-02	2.16e-04	NA	NA
5. P	C6DAM1	Probable malate:quinone oxidoreductase	4.20e-02	3.82e-05	NA	NA
5. P	Q1RD98	N-methyl-L-tryptophan oxidase	9.17e-02	8.40e-09	NA	NA
5. P	Q3TQB2	FAD-dependent oxidoreductase domain-containing protein 1	5.06e-02	3.28e-06	NA	NA
5. P	A8A2A7	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.18e-01	2.19e-06	NA	NA
5. P	Q6CZI7	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	4.72e-01	3.20e-09	NA	NA
5. P	Q99489	D-aspartate oxidase	7.95e-02	2.58e-05	NA	NA
5. P	Q9CL07	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.12e-01	7.36e-10	NA	NA
5. P	A1WQW2	Ferredoxin--NADP reductase	1.35e-01	2.66e-02	NA	NA
5. P	Q55GI5	L-2-hydroxyglutarate dehydrogenase, mitochondrial	1.69e-02	2.62e-06	NA	NA
5. P	Q0J954	Polyamine oxidase 5	2.81e-04	1.10e-06	NA	NA
5. P	Q0TFN1	Probable malate:quinone oxidoreductase	4.92e-02	8.06e-03	NA	NA
5. P	Q8CN91	Probable malate:quinone oxidoreductase 1	3.89e-02	1.01e-05	NA	NA
5. P	Q9Z1M5	D-amino-acid oxidase	7.78e-02	1.75e-06	NA	NA
5. P	Q3MA89	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.14e-01	4.10e-02	NA	NA
5. P	B5YX30	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.30e-01	4.92e-07	NA	NA
5. P	Q7VM49	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.89e-01	5.56e-09	NA	NA
5. P	B2JN27	Ferredoxin--NADP reductase	2.27e-01	1.39e-02	NA	NA
5. P	P9WN80	Glycerol-3-phosphate dehydrogenase 1	4.56e-02	2.19e-02	NA	NA
5. P	P57681	Farnesylcysteine lyase	8.07e-05	2.88e-10	NA	NA
5. P	Q390Q5	Probable malate:quinone oxidoreductase	7.32e-02	6.67e-05	NA	NA
5. P	A7Z1S7	Uncharacterized oxidoreductase CzcO	6.93e-01	9.43e-04	NA	NA
5. P	B9M5T8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.29e-01	3.32e-02	NA	NA
5. P	Q4ZZW4	D-amino acid dehydrogenase	6.39e-03	1.55e-13	NA	NA
5. P	B1IXU6	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.08e-01	2.45e-06	NA	NA
5. P	P51175	Protoporphyrinogen oxidase	4.27e-05	3.92e-18	NA	NA
5. P	Q1CNF8	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.69e-01	2.71e-08	NA	NA
5. P	B2HJU4	Probable malate:quinone oxidoreductase	3.14e-02	1.32e-05	NA	NA
5. P	Q483W3	Ferredoxin--NADP reductase	1.32e-01	3.82e-02	NA	NA
5. P	P06715	Glutathione reductase	4.06e-01	1.32e-02	NA	NA
5. P	P42454	Rubredoxin-NAD(+) reductase	4.02e-01	4.79e-02	NA	NA
5. P	Q88IS4	Probable malate:quinone oxidoreductase 3	4.12e-02	1.55e-03	NA	NA
5. P	Q7NBE9	Ferredoxin--NADP reductase	2.07e-01	3.82e-02	NA	NA
5. P	B5QY05	N-methyl-L-tryptophan oxidase	3.56e-02	1.44e-09	NA	NA
5. P	A0A0M9ER62	FAD-dependent monooxygenase DEP4	5.81e-01	5.82e-04	NA	NA
5. P	P18487	Protein anon-37Cs	9.48e-04	9.36e-11	NA	NA
5. P	O32159	Uncharacterized oxidoreductase YurR	2.10e-02	3.08e-10	NA	NA
5. P	P9WKP7	Uncharacterized protein Rv0897c	3.55e-03	3.21e-06	NA	NA
5. P	P99084	Dihydrolipoyl dehydrogenase	3.90e-01	1.16e-02	NA	NA
5. P	Q8KFK3	Carotenoid phi-ring synthase	3.52e-03	1.49e-04	NA	NA
5. P	Q5L055	Probable malate:quinone oxidoreductase	2.65e-02	1.99e-04	NA	NA
5. P	Q9FVQ0	Probable indole-3-pyruvate monooxygenase YUCCA10	5.67e-01	6.64e-03	NA	NA
5. P	A9H9C9	Ferredoxin--NADP reductase	3.07e-01	1.55e-02	NA	NA
5. P	Q7WI07	D-amino acid dehydrogenase	1.63e-02	6.73e-13	NA	NA
5. P	P40854	Monomeric sarcosine oxidase	2.95e-02	4.55e-10	NA	NA
5. P	Q7MBG6	Probable malate:quinone oxidoreductase	4.85e-02	7.10e-05	NA	NA
5. P	A7ZP32	Probable malate:quinone oxidoreductase	5.41e-02	7.84e-03	NA	NA
5. P	B7LXA3	D-amino acid dehydrogenase	1.25e-02	5.59e-13	NA	NA
5. P	A1AEQ1	Nitric oxide reductase FlRd-NAD(+) reductase	5.84e-01	4.13e-02	NA	NA
5. P	Q64133	Amine oxidase [flavin-containing] A	4.34e-04	2.08e-05	NA	NA
5. P	Q9SKX5	Polyamine oxidase 2	6.73e-04	1.60e-06	NA	NA
5. P	Q07356	15-cis-phytoene desaturase, chloroplastic/chromoplastic	1.54e-04	4.14e-06	NA	NA
5. P	Q6GHY9	Dihydrolipoyl dehydrogenase	4.32e-01	1.16e-02	NA	NA
5. P	Q2IZZ7	D-amino acid dehydrogenase	4.21e-03	1.97e-12	NA	NA
5. P	A1AD94	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.20e-01	9.48e-07	NA	NA
5. P	C3P5N4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.28e-01	3.17e-02	NA	NA
5. P	B5FNS6	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.94e-01	1.92e-08	NA	NA
5. P	B5RBE0	N-methyl-L-tryptophan oxidase	3.57e-02	1.44e-09	NA	NA
5. P	Q60151	Glutathione reductase	4.00e-01	1.63e-02	NA	NA
5. P	Q2FV60	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	3.56e-06	1.23e-05	NA	NA
5. P	Q6FFR5	D-amino acid dehydrogenase	1.74e-02	6.35e-13	NA	NA
5. P	Q95KC9	Prenylcysteine oxidase	6.38e-05	1.29e-14	NA	NA
5. P	Q4UQB4	D-amino acid dehydrogenase	5.93e-03	3.81e-14	NA	NA
5. P	Q045M0	Ferredoxin--NADP reductase	9.63e-02	4.32e-02	NA	NA
5. P	P50336	Protoporphyrinogen oxidase	4.33e-05	1.09e-18	NA	NA
5. P	Q73VU0	Probable malate:quinone oxidoreductase	2.98e-02	7.86e-06	NA	NA
5. P	P65424	Probable malate:quinone oxidoreductase 2	2.77e-02	2.16e-04	NA	NA
5. P	Q0TFK1	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	3.09e-01	1.22e-06	NA	NA
5. P	Q9Y236	Oxidative stress-induced growth inhibitor 2	6.65e-01	1.34e-02	NA	NA
5. P	O64411	Polyamine oxidase 1	2.89e-03	2.19e-06	NA	NA
5. P	Q4L975	4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming)	NA	9.07e-04	NA	NA
5. P	P55826	Protoporphyrinogen oxidase 1, chloroplastic	1.10e-05	2.27e-10	NA	NA
5. P	P55582	Uncharacterized GMC-type oxidoreductase y4nJ	4.70e-02	5.41e-03	NA	NA
5. P	B7NN59	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.24e-01	1.06e-06	NA	NA
5. P	Q8NUM4	Probable malate:quinone oxidoreductase 2	3.35e-02	1.99e-04	NA	NA
5. P	A9M485	Probable malate:quinone oxidoreductase	2.39e-02	1.87e-05	NA	NA
5. P	B6I9D6	N-methyl-L-tryptophan oxidase	9.15e-02	4.27e-09	NA	NA
5. P	Q9K1H5	D-amino acid dehydrogenase	7.56e-03	1.69e-14	NA	NA
5. P	P50396	Rab GDP dissociation inhibitor alpha	1.45e-03	3.06e-13	NA	NA
5. P	Q1QXY5	D-amino acid dehydrogenase	5.04e-03	3.10e-13	NA	NA
5. P	B7UP73	N-methyl-L-tryptophan oxidase	9.16e-02	9.39e-09	NA	NA
5. P	P31150	Rab GDP dissociation inhibitor alpha	1.45e-03	2.85e-13	NA	NA
5. P	A2V9Y8	D-amino-acid oxidase	7.88e-02	7.12e-07	NA	NA
5. P	P50736	Uncharacterized protein YpdA	5.18e-01	2.68e-02	NA	NA
5. P	A4VMU6	Soluble pyridine nucleotide transhydrogenase	2.52e-01	4.06e-02	NA	NA
5. P	A9N0E0	Nitric oxide reductase FlRd-NAD(+) reductase	4.59e-01	2.17e-02	NA	NA
5. P	A8ADX8	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	2.47e-01	1.35e-06	NA	NA
5. P	Q9KLJ6	Anaerobic glycerol-3-phosphate dehydrogenase subunit B	4.07e-01	1.20e-06	NA	NA
6. F	P10331	Protein FixC	8.52e-02	NA	NA	0.4255
6. F	B7M2Z5	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.67e-01	NA	NA	0.4056
6. F	Q5ATH0	FAD-dependent monooxygenase apdD	1.05e-01	NA	NA	0.403
6. F	Q12YW2	Digeranylgeranylglycerophospholipid reductase 1	9.37e-02	NA	NA	0.3674
6. F	Q13QI0	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.34e-01	NA	NA	0.3705
6. F	P27138	2,4-dichlorophenol 6-monooxygenase	1.42e-01	NA	NA	0.3872
6. F	Q8PPG8	Oxygen-dependent choline dehydrogenase	2.09e-01	NA	NA	0.2844
6. F	Q2NER9	Digeranylgeranylglycerophospholipid reductase 3	1.27e-01	NA	NA	0.4193
6. F	Q2YWJ5	Oxygen-dependent choline dehydrogenase	3.56e-01	NA	NA	0.2623
6. F	O48651	Squalene monooxygenase SE1	9.36e-02	NA	NA	0.3915
6. F	A8A6F0	Protein CbrA	6.11e-02	NA	NA	0.3943
6. F	A0QB57	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.27e-01	NA	NA	0.3972
6. F	A2S6N9	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	6.91e-02	NA	NA	0.3481
6. F	Q3L243	Pyranose dehydrogenase 2	1.32e-01	NA	NA	0.2607
6. F	A6VJ23	Digeranylgeranylglycerophospholipid reductase	9.22e-02	NA	NA	0.4158
6. F	Q31JE7	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	4.88e-02	NA	NA	0.3199
6. F	B1LIN2	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.09e-01	NA	NA	0.3959
6. F	Q0TKW1	Oxygen-dependent choline dehydrogenase	1.43e-01	NA	NA	0.2823
6. F	B2TCJ8	Oxygen-dependent choline dehydrogenase	1.53e-01	NA	NA	0.2654
6. F	Q3BXK8	Oxygen-dependent choline dehydrogenase	1.70e-01	NA	NA	0.3492
6. F	G3KLH4	FAD-dependent monooxygenase adaC	9.12e-02	NA	NA	0.3951
6. F	A7I9P9	Digeranylgeranylglycerophospholipid reductase	7.87e-02	NA	NA	0.3906
6. F	Q6GDJ1	Oxygen-dependent choline dehydrogenase	3.55e-01	NA	NA	0.2636
6. F	B7N8Q4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.72e-01	NA	NA	0.418
6. F	B0KTW1	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	6.90e-02	NA	NA	0.2832
6. F	A6UWL1	Digeranylgeranylglycerophospholipid reductase	7.10e-02	NA	NA	0.3664
6. F	Q1CFR7	Oxygen-dependent choline dehydrogenase	1.75e-01	NA	NA	0.2863
6. F	A8JHB7	Fatty acid photodecarboxylase, chloroplastic	2.32e-01	NA	NA	0.2649
6. F	A0A248QE08	Fatty acid photodecarboxylase, chloroplastic	3.94e-01	NA	NA	0.2616
6. F	O65726	Squalene monooxygenase 1,2	2.53e-01	NA	NA	0.3919
6. F	Q47944	L-sorbose 1-dehydrogenase	1.46e-01	NA	NA	0.2698
6. F	Q5X531	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	5.75e-02	NA	NA	0.3919
6. F	B1XBJ4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.97e-01	NA	NA	0.414
6. F	P26484	Protein FixC	8.93e-02	NA	NA	0.4386
6. F	A0ST45	Monooxygenase CTB7	1.29e-01	NA	NA	0.4001
6. F	Q4WR24	3-ketosteroid 1-dehydrogenase helE	1.90e-01	NA	NA	0.3278
6. F	P53572	Protein FixC	3.02e-02	NA	NA	0.3946
6. F	P32009	Aklavinone 12-hydroxylase DnrF	2.24e-01	NA	NA	0.4035
6. F	Q0W349	Digeranylgeranylglycerophospholipid reductase	6.28e-02	NA	NA	0.3832
6. F	Q0SFL5	Probable NADH-specific resorcinol 4-hydroxylase	1.75e-01	NA	NA	0.3854
6. F	Q8PU50	Digeranylgeranylglycerophospholipid reductase	1.47e-01	NA	NA	0.3991
6. F	A7ZI50	Oxygen-dependent choline dehydrogenase	1.35e-01	NA	NA	0.2636
6. F	B1J0W6	Oxygen-dependent choline dehydrogenase	1.35e-01	NA	NA	0.275
6. F	Q8NUM0	Oxygen-dependent choline dehydrogenase	3.76e-01	NA	NA	0.263
6. F	Q1IG70	Oxygen-dependent choline dehydrogenase	1.63e-01	NA	NA	0.249
6. F	A4SNE3	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	4.83e-02	NA	NA	0.3969
6. F	A6TAC9	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.64e-01	NA	NA	0.3999
6. F	A0B573	Digeranylgeranylglycerophospholipid reductase	8.49e-02	NA	NA	0.395
6. F	Q47XJ9	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.06e-01	NA	NA	0.3958
6. F	Q8X680	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.89e-01	NA	NA	0.3958
6. F	Q5ZVA8	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	6.08e-02	NA	NA	0.3508
6. F	B6HZX3	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.04e-01	NA	NA	0.4122
6. F	Q1B5E2	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.40e-01	NA	NA	0.3768
6. F	Q7AHT0	Protein FixC	4.74e-02	NA	NA	0.4345
6. F	Q0SYN3	Protein CbrA	5.87e-02	NA	NA	0.4225
6. F	Q8XNE2	L-aspartate oxidase	6.67e-02	NA	NA	0.3144
6. F	P52707	(R)-mandelonitrile lyase 3	1.75e-01	NA	NA	0.2878
6. F	M2Y151	Versicolorin B synthase	3.29e-01	NA	NA	0.2541
6. F	Q945K2	(R)-mandelonitrile lyase 2	1.03e-01	NA	NA	0.2962
6. F	Q5WWF9	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	6.83e-02	NA	NA	0.3728
6. F	Q97K95	L-aspartate oxidase	1.11e-01	NA	NA	0.3202
6. F	A0KE38	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.88e-01	NA	NA	0.3952
6. F	Q6YQV5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	2.84e-01	NA	NA	0.342
6. F	Q8Z9K9	Protein FixC	4.78e-02	NA	NA	0.427
6. F	B7NK08	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.17e-01	NA	NA	0.4167
6. F	Q13NG7	Oxygen-dependent choline dehydrogenase	2.13e-01	NA	NA	0.274
6. F	A7ZI94	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.08e-01	NA	NA	0.3826
6. F	Q4L9D7	Oxygen-dependent choline dehydrogenase	1.74e-01	NA	NA	0.26
6. F	Q9L4K0	Oxygen-dependent choline dehydrogenase	1.46e-01	NA	NA	0.2717
6. F	A0LA84	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.14e-01	NA	NA	0.3451
6. F	B2JS89	Oxygen-dependent choline dehydrogenase	1.26e-01	NA	NA	0.2741
6. F	P64264	Uncharacterized GMC-type oxidoreductase Mb1310	1.70e-01	NA	NA	0.2393
6. F	Q47C51	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.13e-01	NA	NA	0.3671
6. F	A1UJP4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.58e-01	NA	NA	0.3968
6. F	Q54530	Aklavinone 12-hydroxylase RdmE	1.48e-01	NA	NA	0.4001
6. F	Q7D5C1	3-oxosteroid 1-dehydrogenase	2.03e-01	NA	NA	0.3288
6. F	A3CST9	Digeranylgeranylglycerophospholipid reductase	8.08e-02	NA	NA	0.397
6. F	P09820	Protein FixC	8.24e-02	NA	NA	0.4115
6. F	B7L439	Oxygen-dependent choline dehydrogenase	1.44e-01	NA	NA	0.2749
6. F	O65837	Lycopene epsilon cyclase, chloroplastic	2.81e-01	NA	NA	0.4046
6. F	O06489	Putative oxidoreductase YetM	5.99e-02	NA	NA	0.368
6. F	A2SQK1	Digeranylgeranylglycerophospholipid reductase	6.93e-02	NA	NA	0.3651
6. F	E1ACQ4	FAD-dependent monooxygenase notI	1.85e-01	NA	NA	0.32
6. F	B2K8U4	Oxygen-dependent choline dehydrogenase	1.35e-01	NA	NA	0.2865
6. F	A9AJC5	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	5.26e-02	NA	NA	0.3175
6. F	Q8KN28	2,4-dichlorophenol 6-monooxygenase	1.33e-01	NA	NA	0.4016
6. F	B1XE52	Oxygen-dependent choline dehydrogenase	1.33e-01	NA	NA	0.283
6. F	Q465Z7	Digeranylgeranylglycerophospholipid reductase	7.53e-02	NA	NA	0.4043
6. F	Q83SQ7	Protein FixC	4.45e-02	NA	NA	0.4162
6. F	O29786	Digeranylgeranylglycerophospholipid reductase	6.25e-02	NA	NA	0.3783
6. F	A0A0U1LQD9	FAD-dependent monooxygenase cctM	7.16e-02	NA	NA	0.3835
6. F	A7ZWZ4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.06e-01	NA	NA	0.4077
6. F	A0A2U8U2L4	FAD-dependent monooxygenase asL4	6.56e-02	NA	NA	0.4095
6. F	C8WLM1	Digoxin reductase	1.83e-01	NA	NA	0.2783
6. F	C3MIE4	Oxygen-dependent choline dehydrogenase	1.94e-01	NA	NA	0.277
6. F	A7FKL6	Oxygen-dependent choline dehydrogenase	1.77e-01	NA	NA	0.2609
6. F	Q12P60	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.34e-01	NA	NA	0.3911
6. F	Q83IZ5	Protein CbrA	6.10e-02	NA	NA	0.3967
6. F	A4JQH4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 2	1.97e-01	NA	NA	0.3386
6. F	B7L503	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.94e-01	NA	NA	0.4115
6. F	Q62FV6	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	6.89e-02	NA	NA	0.3734
6. F	Q65S61	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	5.60e-02	NA	NA	0.3426
6. F	Q3YWC2	Protein CbrA	5.72e-02	NA	NA	0.4163
6. F	Q1R4P6	Protein CbrA	5.95e-02	NA	NA	0.3778
6. F	Q8TQQ6	Digeranylgeranylglycerophospholipid reductase	1.33e-01	NA	NA	0.391
6. F	P72495	Aklavinone 12-hydroxylase DnrF	9.91e-02	NA	NA	0.4028
6. F	Q742Z1	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.19e-01	NA	NA	0.3945
6. F	A0A1L9WN49	GMC-type oxidoreductase acuG	3.15e-01	NA	NA	0.3406
6. F	A1AHM5	Protein CbrA	6.03e-02	NA	NA	0.4158
6. F	L7WR46	FAD-dependent monooxygenase notI'	2.56e-01	NA	NA	0.3591
6. F	A0R1T4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.72e-01	NA	NA	0.3573
6. F	Q40424	Lycopene beta cyclase, chloroplastic/chromoplastic	1.37e-01	NA	NA	0.4167
6. F	C3K3D3	Oxygen-dependent choline dehydrogenase	2.22e-01	NA	NA	0.2674
6. F	B5WWZ8	Long-chain-alcohol oxidase FAO1	3.78e-01	NA	NA	0.2847
6. F	A9A6R1	Digeranylgeranylglycerophospholipid reductase	9.40e-02	NA	NA	0.4088
6. F	M1WCF5	Monoogygenase CPUR_05431	1.20e-01	NA	NA	0.3712
6. F	Q49X94	Aerobic glycerol-3-phosphate dehydrogenase	7.15e-02	NA	NA	0.399
6. F	B0BPE2	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	4.02e-02	NA	NA	0.3803
6. F	A0A4P8GF19	Flavin-dependent monooxygenase eupH	8.00e-02	NA	NA	0.3966
6. F	Q2NFZ1	Digeranylgeranylglycerophospholipid reductase 1	9.17e-02	NA	NA	0.4159
6. F	A7ZWV4	Oxygen-dependent choline dehydrogenase	1.25e-01	NA	NA	0.2902
6. F	V5NC32	Pyranose dehydrogenase	1.90e-01	NA	NA	0.3026
6. F	A1SW96	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	4.64e-02	NA	NA	0.4085
6. F	F9UNH3	Urocanate reductase	1.73e-01	NA	NA	0.3674
6. F	D4GYI2	Anaerobic glycerol-3-phosphate dehydrogenase subunit A1	6.82e-02	NA	NA	0.3891
6. F	Q0KBK6	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	3.28e-02	NA	NA	0.3352
6. F	Q476N1	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.37e-01	NA	NA	0.4179
6. F	Q12WF0	Digeranylgeranylglycerophospholipid reductase 2	1.09e-01	NA	NA	0.3883
6. F	P21334	Phytoene desaturase	2.08e-04	NA	NA	0.522
6. F	B7M2V5	Oxygen-dependent choline dehydrogenase	1.42e-01	NA	NA	0.266
6. F	Q12062	Versicolorin B synthase	1.97e-01	NA	NA	0.2599
6. F	A0R4S9	3-oxosteroid 1-dehydrogenase	1.94e-01	NA	NA	0.3287
6. F	A5IC27	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	5.47e-02	NA	NA	0.4043
6. F	Q0I2W9	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.68e-01	NA	NA	0.3384
6. F	O27753	Digeranylgeranylglycerophospholipid reductase 2	9.70e-02	NA	NA	0.3832
6. F	A6T613	Oxygen-dependent choline dehydrogenase	1.17e-01	NA	NA	0.2722
6. F	Q4ZM63	Oxygen-dependent choline dehydrogenase	2.39e-01	NA	NA	0.2829
6. F	A4VMX4	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	8.51e-02	NA	NA	0.327
6. F	Q5HTJ5	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.09e-01	NA	NA	0.3695
6. F	P9WMV4	Uncharacterized GMC-type oxidoreductase MT1316	1.54e-01	NA	NA	0.2466
6. F	A6US00	Digeranylgeranylglycerophospholipid reductase	7.16e-02	NA	NA	0.3768
6. F	Q5B8A1	Dehydrogenase pkfF	2.73e-01	NA	NA	0.3205
6. F	P0DO29	Dehydrogenase eriK	1.35e-01	NA	NA	0.228
6. F	P52706	(R)-mandelonitrile lyase 1	9.51e-02	NA	NA	0.2718
6. F	Q0TB17	Protein CbrA	6.05e-02	NA	NA	0.3936
6. F	Q51363	L-aspartate oxidase	1.10e-01	NA	NA	0.3396
6. F	Q3L1D1	Pyranose dehydrogenase	1.54e-01	NA	NA	0.2897
6. F	Q02861	All-trans-zeta-carotene desaturase	3.28e-05	NA	NA	0.5357
6. F	Q988C9	4-pyridoxate dehydrogenase	1.65e-01	NA	NA	0.2472
6. F	B0KN19	Oxygen-dependent choline dehydrogenase	2.18e-01	NA	NA	0.2632
6. F	A4JPY1	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 1	2.45e-01	NA	NA	0.39
6. F	F2R776	Rifampicin monooxygenase	3.72e-01	NA	NA	0.3435
6. F	B5XRB0	NADH:fumarate oxidoreductase	4.12e-01	NA	NA	0.283
6. F	Q1BGA7	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.82e-01	NA	NA	0.3942
6. F	A1KVW0	Ubiquinone hydroxylase UbiM	7.99e-02	NA	NA	0.3368
6. F	A4XXB7	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	7.28e-02	NA	NA	0.334
6. F	Q53208	Protein FixC	8.30e-02	NA	NA	0.4278
6. F	Q9CNT7	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	6.53e-02	NA	NA	0.3318
6. F	Q48CM7	Oxygen-dependent choline dehydrogenase	2.37e-01	NA	NA	0.2727
6. F	Q8ZRW9	Protein FixC	4.83e-02	NA	NA	0.4187
6. F	Q88AE7	Oxygen-dependent choline dehydrogenase	1.41e-01	NA	NA	0.2801
6. F	Q329C3	Protein CbrA	8.19e-02	NA	NA	0.4337
6. F	A4UHS8	Versicolorin B synthase	3.35e-01	NA	NA	0.2595
6. F	Q9WWW2	Alcohol dehydrogenase [acceptor]	1.50e-01	NA	NA	0.2714
6. F	A3Q339	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.40e-01	NA	NA	0.3784
6. F	B5Z2Q2	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.05e-01	NA	NA	0.41
6. F	Q9KPA4	L-aspartate oxidase	1.81e-01	NA	NA	0.3519
6. F	B7MPB4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.11e-01	NA	NA	0.4058
6. F	O65727	Squalene monooxygenase 1,1	2.32e-01	NA	NA	0.3552
6. F	A1V8X2	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	6.87e-02	NA	NA	0.3732
6. F	Q7X2H8	Choline oxidase	8.42e-02	NA	NA	0.3096
6. F	Q4ZPZ9	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	8.53e-02	NA	NA	0.3258
6. F	A4FZB4	Digeranylgeranylglycerophospholipid reductase	8.84e-02	NA	NA	0.3714
6. F	Q8CVK0	Protein CbrA	5.91e-02	NA	NA	0.4058
6. F	B0UT85	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.92e-01	NA	NA	0.3351
6. F	Q2FUA4	Digeranylgeranylglycerophospholipid reductase	1.21e-01	NA	NA	0.4107
6. F	Q5W270	Oxidoreductase PigB	1.03e-03	NA	NA	0.5596
6. F	A8H2Z3	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	7.18e-02	NA	NA	0.3869
6. F	Q3Z585	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.13e-01	NA	NA	0.4135
6. F	A0A0E4AFH6	Probable 2-heptyl-3-hydroxy-4(1H)-quinolone synthase AqdB2	8.44e-02	NA	NA	0.3976
6. F	A0A2I6PIZ8	FAD-dependent monooxygenase nodY2	2.13e-01	NA	NA	0.394
6. F	Q5NY30	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	9.27e-02	NA	NA	0.3968
6. F	P48537	Phytoene desaturase	3.57e-04	NA	NA	0.5853
6. F	P60337	Oxygen-dependent choline dehydrogenase	3.58e-01	NA	NA	0.2626
6. F	Q88M24	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	7.20e-02	NA	NA	0.3076
6. F	B5XQI9	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.11e-01	NA	NA	0.4025
6. F	Q5HL11	Oxygen-dependent choline dehydrogenase	1.95e-01	NA	NA	0.2569
6. F	P38032	L-aspartate oxidase	1.02e-01	NA	NA	0.3189
6. F	P68645	Protein FixC	4.76e-02	NA	NA	0.4332
6. F	Q8CMY2	Oxygen-dependent choline dehydrogenase	1.92e-01	NA	NA	0.25
6. F	Q63KK7	Oxygen-dependent choline dehydrogenase	2.78e-01	NA	NA	0.2659
6. F	Q0R4L2	Pyranose dehydrogenase 3	1.38e-01	NA	NA	0.2889
6. F	B6I074	Oxygen-dependent choline dehydrogenase	1.40e-01	NA	NA	0.281
6. F	Q084S3	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.23e-01	NA	NA	0.3851
6. F	P74562	L-aspartate oxidase	9.71e-02	NA	NA	0.3347
6. F	Q4K4K7	Oxygen-dependent choline dehydrogenase	2.29e-01	NA	NA	0.2835
6. F	B7UJG4	Oxygen-dependent choline dehydrogenase	1.35e-01	NA	NA	0.2776
6. F	O82784	(R)-mandelonitrile lyase 4	9.98e-02	NA	NA	0.2738
6. F	Q0T7N0	Oxygen-dependent choline dehydrogenase	1.23e-01	NA	NA	0.281
6. F	A7ZTP5	Protein CbrA	5.36e-02	NA	NA	0.3994
6. F	O93831	Rab proteins geranylgeranyltransferase component A	1.41e-02	NA	NA	0.4398
6. F	D7PHZ9	FAD-dependent monooxygenase vrtH	9.76e-02	NA	NA	0.4199
6. F	B2FL98	Kynurenine 3-monooxygenase	1.67e-01	NA	NA	0.3819
6. F	Q58PK7	Anhydrotetracycline monooxygenase	1.29e-01	NA	NA	0.3021
6. F	Q6M083	Digeranylgeranylglycerophospholipid reductase	7.89e-02	NA	NA	0.3745
6. F	F8DIF2	Urocanate reductase	2.07e-01	NA	NA	0.3782
6. F	Q9S158	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.75e-01	NA	NA	0.401
6. F	Q5HCU1	Oxygen-dependent choline dehydrogenase	3.82e-01	NA	NA	0.2505
6. F	A8FTT1	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.06e-01	NA	NA	0.4109
6. F	O24243	(R)-mandelonitrile lyase 1	1.10e-01	NA	NA	0.261
6. F	Q8XBZ8	Protein CbrA	5.42e-02	NA	NA	0.414
6. F	Q88CW6	Oxygen-dependent choline dehydrogenase	1.62e-01	NA	NA	0.2731
6. F	Q3K5H3	Oxygen-dependent choline dehydrogenase	2.27e-01	NA	NA	0.2785
6. F	Q0CJ60	Cyclase atC	2.77e-01	NA	NA	0.3617
6. F	P9WM50	Uncharacterized protein MT1298	8.64e-02	NA	NA	0.4593
6. F	A4XPI5	Oxygen-dependent choline dehydrogenase	1.45e-01	NA	NA	0.2687
6. F	A5WA97	Oxygen-dependent choline dehydrogenase	1.30e-01	NA	NA	0.2544
6. F	O50048	(R)-mandelonitrile lyase 2	1.04e-01	NA	NA	0.2994