Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54979.1

JCVISYN3A_0817

Uncharacterized DNA-binding protein.
M. mycoides homolog: Q6MS46.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 21
Unique PROST Go: 0
Unique BLAST Go: 0
Unique Foldseek Go: 14

Total Homologs: 248
Unique PROST Homologs: 2
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 35

Literature

Danchin and Fang [1]: involved in an early stage of cell division. localizes at the nucleoid|no indication that YvcL functions as a transcription factor; insertions in gtaB and pgcA restored normal cell division of the double mutant
Yang and Tsui [2]: Putative sporulation transcription regulator WhiA
Antczak et al. [3]: whiA; Sporulation transcription regulator WhiA
Zhang et al. [4]: GO:0043937|regulation of sporulation
Bianchi et al. [5]: whiA-like transcription factor

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was B7JFI0 (Probable cell division protein WhiA) with a FATCAT P-Value: 0 and RMSD of 1.91 angstrom. The sequence alignment identity is 35.6%.
Structural alignment shown in left. Query protein AVX54979.1 colored as red in alignment, homolog B7JFI0 colored as blue. Query protein AVX54979.1 is also shown in right top, homolog B7JFI0 showed in right bottom. They are colored based on secondary structures.

  AVX54979.1 MSFALEVKEEIVMHSFNDEQK----LAYLSGFIRYSSDIIFSNNTSKIRFSTISN-KIAR---TLLSFCRHIFDGQVEISIIQSQV-LKKHKSFVLTLIG 91
      B7JFI0 MSFASETKKELT----NLEMKECCEKAELSALLRMNGSLSFSNRRLSIDIQT-ENAAIARRIYTLL---KKGYDVTVEL-LVRKKMRLKKNNVYIVRLVE 91

  AVX54979.1 DTNKFLQKLRIY-DQNNQKVYGF--KVSSEIKDKTSILRAYIAGIFTAIGSVNSPKTSNYHLDL--QFKNKIDANYFIDLTNDLGFEF--KLLERNANRF 184
      B7JFI0 KSREILADLHIVRDD-----FSFIRNISQELIEKKCCKRSYLRGAFLAGGSVNNPETSSYHLEIFSLYKEHNDA--ICELMN--GFDLNSKTLERRKG-Y 181

  AVX54979.1 ICYIKKSIMVSDFLKLIDASNSVMQFENERISRDVYNSINRVNNFDISNQTKTLVTGQ--KQIETINYLKQTNQFHLLSKKAQVLANLRLEYPDYSYNEL 282
      B7JFI0 ITYLKEAEKITEFLNIIGAHNALLRFEDIRIVRDMRNSVNRLVNCETANLNKTI--GAALRQIENIRYIDETVGLDILPDKLREIAQLRRDYQDVTLKEL 279

  AVX54979.1 VEEMKKV-GYEITKSGISN-LFKT--I-EKL--G------ 309
      B7JFI0 -GEM--VSGGKISKSGINHRLRKIDDIAEKLRAGETVAKK 316

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0003677	DNA binding
1. PBF	GO:0043937	regulation of sporulation
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0004519	endonuclease activity
1. PBF	GO:0051301	cell division
1. PBF	GO:0007049	cell cycle
4. PB	GO:0005886	plasma membrane
6. F	GO:0006314	intron homing
6. F	GO:0034335	DNA negative supercoiling activity
6. F	GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
6. F	GO:0016021	integral component of membrane
6. F	GO:0004527	exonuclease activity
6. F	GO:0016539	intein-mediated protein splicing
6. F	GO:1990077	primosome complex
6. F	GO:0005524	ATP binding
6. F	GO:0015990	electron transport coupled proton transport
6. F	GO:0003887	DNA-directed DNA polymerase activity
6. F	GO:0008452	RNA ligase activity
6. F	GO:0006265	DNA topological change
6. F	GO:0046872	metal ion binding
6. F	GO:0006269	DNA replication, synthesis of RNA primer

Uniprot GO Annotations

GO	Description
GO:0043937	regulation of sporulation
GO:0051301	cell division
GO:0003677	DNA binding
GO:0007049	cell cycle

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	A0ALF6	Probable cell division protein WhiA	0.00e+00	5.00e-32	2.57e-40	0.912
1. PBF	A7WZR7	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.9016
1. PBF	Q03L08	Probable cell division protein WhiA	0.00e+00	1.07e-47	2.10e-29	0.8719
1. PBF	C1B4L5	Probable cell division protein WhiA	0.00e+00	8.33e-21	0.023	0.8096
1. PBF	Q8DTM9	Probable cell division protein WhiA	0.00e+00	1.79e-46	9.71e-24	0.8857
1. PBF	Q7U040	Probable cell division protein WhiA	0.00e+00	1.62e-21	0.001	0.813
1. PBF	B9MN06	Probable cell division protein WhiA	0.00e+00	1.93e-29	6.02e-27	0.8527
1. PBF	Q8NQ58	Probable cell division protein WhiA	0.00e+00	9.87e-24	3.99e-08	0.7334
1. PBF	B9J4Q7	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9197
1. PBF	A8FHQ0	Probable cell division protein WhiA	0.00e+00	1.30e-41	1.14e-41	0.9175
1. PBF	A0RKU0	Probable cell division protein WhiA	0.00e+00	2.21e-44	2.98e-42	0.9207
1. PBF	A0PYB7	Probable cell division protein WhiA	0.00e+00	1.45e-31	1.37e-28	0.8776
1. PBF	B8FXW4	Probable cell division protein WhiA	0.00e+00	2.75e-38	1.12e-34	0.8939
1. PBF	C4Z4T8	Probable cell division protein WhiA	0.00e+00	3.34e-35	2.56e-20	0.8423
1. PBF	A7Z951	Probable cell division protein WhiA	0.00e+00	2.29e-41	4.24e-41	0.9201
1. PBF	Q631K0	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9228
1. PBF	Q24MW0	Probable cell division protein WhiA	0.00e+00	2.43e-38	8.43e-34	0.9
1. PBF	B1MXG8	Probable cell division protein WhiA	0.00e+00	9.04e-26	2.47e-33	0.8865
1. PBF	B1IFW1	Probable cell division protein WhiA	0.00e+00	3.58e-37	1.49e-31	0.873
1. PBF	A0PPM4	Probable cell division protein WhiA	0.00e+00	7.53e-22	2.97e-04	0.8156
1. PBF	B1I0X5	Probable cell division protein WhiA	0.00e+00	2.87e-42	8.33e-26	0.8905
1. PBF	Q03AL2	Probable cell division protein WhiA	0.00e+00	1.10e-40	8.22e-43	0.8865
1. PBF	Q8Y4H0	Probable cell division protein WhiA	0.00e+00	8.36e-31	1.60e-39	0.9138
1. PBF	A5IQX1	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.9027
1. PBF	Q03GX4	Probable cell division protein WhiA	0.00e+00	1.56e-45	6.83e-37	0.8951
1. PBF	Q1GB32	Probable cell division protein WhiA	0.00e+00	1.14e-44	6.97e-34	0.904
1. PBF	Q0SW34	Probable cell division protein WhiA	0.00e+00	5.72e-31	1.54e-30	0.8916
1. PBF	Q6AF47	Probable cell division protein WhiA	0.00e+00	1.14e-22	1.71e-05	0.8123
1. PBF	Q04GA9	Probable cell division protein WhiA	0.00e+00	6.23e-39	1.48e-27	0.8729
1. PBF	A1UFN5	Probable cell division protein WhiA	0.00e+00	1.06e-20	0.025	0.807
1. PBF	Q9Z515	Probable cell division protein WhiA	0.00e+00	2.20e-19	0.048	0.813
1. PBF	Q180P5	Probable cell division protein WhiA	0.00e+00	6.25e-37	2.93e-34	0.8612
1. PBF	A0JWP5	Probable cell division protein WhiA	0.00e+00	1.04e-20	3.50e-10	0.82
1. PBF	A9VQ67	Probable cell division protein WhiA	0.00e+00	3.18e-47	1.45e-42	0.9213
1. PBF	Q812J8	Probable cell division protein WhiA	0.00e+00	3.64e-47	6.52e-44	0.9219
1. PBF	Q928C1	Probable cell division protein WhiA	0.00e+00	9.44e-32	2.52e-40	0.9118
1. PBF	Q6HBD6	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9208
1. PBF	Q8ENL5	Probable cell division protein WhiA	0.00e+00	5.54e-44	6.81e-33	0.9161
1. PBF	B5XKL2	Probable cell division protein WhiA	0.00e+00	1.33e-45	3.49e-25	0.8509
1. PBF	Q5YTQ2	Probable cell division protein WhiA	0.00e+00	2.86e-22	0.003	0.8158
1. PBF	Q97PN9	Probable cell division protein WhiA	0.00e+00	2.67e-48	1.77e-25	0.8682
1. PBF	P0DH42	Probable cell division protein WhiA	0.00e+00	3.83e-44	1.11e-25	0.8618
1. PBF	A8YUD8	Probable cell division protein WhiA	0.00e+00	6.42e-47	8.45e-37	0.8983
1. PBF	Q47NB8	Probable cell division protein WhiA	0.00e+00	7.02e-24	0.017	0.8362
1. PBF	B2GAL2	Probable cell division protein WhiA	0.00e+00	7.82e-42	1.51e-34	0.905
1. PBF	Q7A6Q6	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.8995
1. PBF	B1VDQ2	Probable cell division protein WhiA	0.00e+00	2.62e-20	7.97e-08	0.8053
1. PBF	Q03Z55	Probable cell division protein WhiA	0.00e+00	1.37e-28	1.06e-32	0.8883
1. PBF	Q1JHS3	Probable cell division protein WhiA	0.00e+00	3.83e-44	1.11e-25	0.8617
1. PBF	Q9A0R6	Probable cell division protein WhiA	0.00e+00	3.32e-46	5.87e-25	0.8607
1. PBF	C3LEC2	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9212
1. PBF	Q74K85	Probable cell division protein WhiA	0.00e+00	1.09e-49	1.22e-35	0.9056
1. PBF	B2UZY1	Probable cell division protein WhiA	0.00e+00	2.75e-39	1.07e-28	0.8803
1. PBF	Q7A2U9	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.8885
1. PBF	Q3AFD7	Probable cell division protein WhiA	0.00e+00	3.72e-36	2.80e-26	0.8819
1. PBF	B2TQR9	Probable cell division protein WhiA	0.00e+00	2.75e-39	1.07e-28	0.8836
1. PBF	Q97LP1	Probable cell division protein WhiA	0.00e+00	1.16e-38	1.68e-31	0.8973
1. PBF	Q890Y9	Probable cell division protein WhiA	0.00e+00	5.88e-38	2.54e-38	0.8942
1. PBF	Q0TU86	Probable cell division protein WhiA	0.00e+00	5.72e-31	1.54e-30	0.8941
1. PBF	B8DBN9	Probable cell division protein WhiA	0.00e+00	8.36e-31	1.60e-39	0.9103
1. PBF	B1L268	Probable cell division protein WhiA	0.00e+00	3.58e-37	1.49e-31	0.8946
1. PBF	A7FYW9	Probable cell division protein WhiA	0.00e+00	3.58e-37	1.49e-31	0.8713
1. PBF	B8H7M2	Probable cell division protein WhiA	0.00e+00	3.66e-23	3.14e-09	0.8127
1. PBF	Q9K707	Probable cell division protein WhiA	0.00e+00	1.52e-38	8.20e-37	0.9098
1. PBF	O06975	Probable cell division protein WhiA	0.00e+00	3.52e-39	3.26e-41	0.9225
1. PBF	Q6GIM4	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.9045
1. PBF	A5I7A0	Probable cell division protein WhiA	0.00e+00	3.58e-37	1.49e-31	0.8731
1. PBF	B8I4X0	Probable cell division protein WhiA	0.00e+00	1.09e-35	2.04e-29	0.8453
1. PBF	Q04JI4	Probable cell division protein WhiA	0.00e+00	7.74e-48	4.46e-25	0.8807
1. PBF	Q88YI2	Probable cell division protein WhiA	0.00e+00	7.82e-42	6.61e-34	0.8955
1. PBF	A5U2C5	Probable cell division protein WhiA	0.00e+00	3.34e-22	5.36e-04	0.8251
1. PBF	B8ZUN8	Probable cell division protein WhiA	0.00e+00	8.78e-22	0.002	0.8061
1. PBF	B7HW81	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9226
1. PBF	A2RLG3	Probable cell division protein WhiA	0.00e+00	8.10e-43	3.40e-23	0.8638
1. PBF	B2GH83	Probable cell division protein WhiA	0.00e+00	7.58e-21	5.07e-09	0.8142
1. PBF	B8DUH3	Probable cell division protein WhiA	0.00e+00	1.71e-30	0.016	0.5933
1. PBF	B0TGK8	Probable cell division protein WhiA	0.00e+00	9.81e-34	8.16e-36	0.8959
1. PBF	A4VTZ9	Probable cell division protein WhiA	0.00e+00	3.27e-40	1.23e-32	0.8797
1. PBF	Q1WT80	Probable cell division protein WhiA	0.00e+00	1.95e-37	5.52e-36	0.898
1. PBF	B2G611	Probable cell division protein WhiA	0.00e+00	1.29e-42	2.30e-33	0.8655
1. PBF	Q9CCN8	Probable cell division protein WhiA	0.00e+00	8.78e-22	0.002	0.8078
1. PBF	B9DJL1	Probable cell division protein WhiA	0.00e+00	1.37e-41	1.33e-35	0.9008
1. PBF	Q5M4R7	Probable cell division protein WhiA	0.00e+00	1.07e-47	2.10e-29	0.8712
1. PBF	Q02ZN6	Probable cell division protein WhiA	0.00e+00	8.10e-43	3.40e-23	0.864
1. PBF	Q2YSG0	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.9046
1. PBF	B8ZLS6	Probable cell division protein WhiA	0.00e+00	2.90e-48	5.30e-25	0.8876
1. PBF	A0LTX5	Probable cell division protein WhiA	0.00e+00	1.03e-23	1.10e-06	0.8327
1. PBF	P9WF44	Probable cell division protein WhiA	0.00e+00	3.34e-22	5.36e-04	0.826
1. PBF	Q2JCI0	Probable cell division protein WhiA	0.00e+00	5.62e-20	0.001	0.839
1. PBF	A2RFM2	Probable cell division protein WhiA	0.00e+00	1.50e-43	6.05e-25	0.8669
1. PBF	Q8FT63	Probable cell division protein WhiA	0.00e+00	3.83e-22	5.49e-10	0.7825
1. PBF	B4U278	Probable cell division protein WhiA	0.00e+00	2.09e-44	5.51e-29	0.8828
1. PBF	Q2RLU4	Probable cell division protein WhiA	0.00e+00	1.79e-21	5.02e-22	0.779
1. PBF	C5BV37	Probable cell division protein WhiA	0.00e+00	1.86e-21	3.83e-06	0.8156
1. PBF	C0Z6N8	Probable cell division protein WhiA	0.00e+00	8.28e-40	1.71e-40	0.9032
1. PBF	Q48UH3	Probable cell division protein WhiA	0.00e+00	1.33e-45	3.49e-25	0.8601
1. PBF	A1R6G8	Probable cell division protein WhiA	0.00e+00	5.19e-21	3.13e-10	0.8216
1. PBF	Q5HHQ1	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.9082
1. PBF	Q5FL56	Probable cell division protein WhiA	0.00e+00	1.99e-46	5.16e-36	0.901
1. PBF	B0K6K7	Probable cell division protein WhiA	0.00e+00	2.09e-38	1.83e-31	0.8888
1. PBF	Q1JMN0	Probable cell division protein WhiA	0.00e+00	1.33e-45	3.49e-25	0.8629
1. PBF	Q5HQW1	Probable cell division protein WhiA	0.00e+00	2.48e-40	1.05e-34	0.9079
1. PBF	Q8E6I5	Probable cell division protein WhiA	0.00e+00	1.45e-47	9.22e-27	0.8835
1. PBF	A4FBM2	Probable cell division protein WhiA	0.00e+00	1.90e-22	8.04e-09	0.8247
1. PBF	Q03SM4	Probable cell division protein WhiA	0.00e+00	5.64e-43	1.02e-33	0.8891
1. PBF	Q5XD17	Probable cell division protein WhiA	0.00e+00	1.50e-43	6.05e-25	0.8671
1. PBF	A9WT66	Probable cell division protein WhiA	0.00e+00	2.00e-21	3.26e-07	0.8057
1. PBF	Q81X61	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9193
1. PBF	A8AWT7	Probable cell division protein WhiA	0.00e+00	1.26e-47	3.38e-22	0.8819
1. PBF	A4ISQ4	Probable cell division protein WhiA	0.00e+00	1.09e-39	9.97e-39	0.9174
1. PBF	P47349	Probable cell division protein WhiA	0.00e+00	2.45e-35	4.75e-06	0.6947
1. PBF	Q4L4J4	Probable cell division protein WhiA	0.00e+00	1.11e-42	1.81e-37	0.9134
1. PBF	B7JFI0	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9227
1. PBF	A6M2Y1	Probable cell division protein WhiA	0.00e+00	6.03e-38	5.31e-29	0.8872
1. PBF	C3P0C0	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9226
1. PBF	A6WC57	Probable cell division protein WhiA	0.00e+00	2.33e-19	4.49e-05	0.8325
1. PBF	A3CM38	Probable cell division protein WhiA	0.00e+00	4.26e-44	2.29e-25	0.8703
1. PBF	B7GQU6	Probable cell division protein WhiA	0.00e+00	7.81e-36	5.12e-04	0.6257
1. PBF	B3DRV8	Probable cell division protein WhiA	0.00e+00	4.30e-36	7.21e-04	0.6431
1. PBF	A4XDR5	Probable cell division protein WhiA	0.00e+00	3.15e-24	1.01e-05	0.852
1. PBF	B7HEF4	Probable cell division protein WhiA	0.00e+00	3.64e-47	6.52e-44	0.922
1. PBF	B2IR82	Probable cell division protein WhiA	0.00e+00	2.90e-48	5.30e-25	0.8787
1. PBF	B0REJ5	Probable cell division protein WhiA	0.00e+00	2.46e-23	1.66e-05	0.8165
1. PBF	Q71WV5	Probable cell division protein WhiA	0.00e+00	9.44e-32	2.77e-40	0.9119
1. PBF	A5VII3	Probable cell division protein WhiA	0.00e+00	1.29e-42	2.30e-33	0.8647
1. PBF	B2A6Z7	Probable cell division protein WhiA	0.00e+00	6.05e-28	4.36e-22	0.898
1. PBF	Q8CTE1	Probable cell division protein WhiA	0.00e+00	2.48e-40	1.05e-34	0.9075
1. PBF	A4J8U4	Probable cell division protein WhiA	0.00e+00	1.48e-34	4.20e-24	0.8649
1. PBF	B3WCR0	Probable cell division protein WhiA	0.00e+00	8.80e-41	1.41e-42	0.8908
1. PBF	C5D7N1	Probable cell division protein WhiA	0.00e+00	2.10e-37	2.74e-38	0.9194
1. PBF	Q7A1F7	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.9068
1. PBF	Q8R909	Probable cell division protein WhiA	0.00e+00	1.32e-40	8.65e-33	0.8769
1. PBF	A1KIL2	Probable cell division protein WhiA	0.00e+00	1.62e-21	0.001	0.8145
1. PBF	B8CYG6	Probable cell division protein WhiA	0.00e+00	3.35e-42	4.45e-23	0.8741
1. PBF	Q9X234	Probable cell division protein WhiA	0.00e+00	4.25e-29	2.57e-06	0.8186
1. PBF	A1SJP8	Probable cell division protein WhiA	0.00e+00	6.11e-23	3.22e-07	0.8323
1. PBF	P75530	Probable cell division protein WhiA	0.00e+00	3.43e-39	1.23e-11	0.8094
1. PBF	B1YLE8	Probable cell division protein WhiA	0.00e+00	4.80e-42	2.14e-38	0.9033
1. PBF	Q042E7	Probable cell division protein WhiA	0.00e+00	2.16e-46	2.09e-36	0.907
1. PBF	B7IPR7	Probable cell division protein WhiA	0.00e+00	7.96e-48	3.01e-43	0.92
1. PBF	A9KSS5	Probable cell division protein WhiA	0.00e+00	5.79e-43	4.02e-25	0.8278
1. PBF	B1MC89	Probable cell division protein WhiA	0.00e+00	8.80e-25	0.020	0.8166
1. PBF	B1ICY4	Probable cell division protein WhiA	0.00e+00	6.57e-48	2.44e-25	0.8853
1. PBF	A7GUT5	Probable cell division protein WhiA	0.00e+00	2.73e-45	3.68e-43	0.9227
1. PBF	B0K7U2	Probable cell division protein WhiA	0.00e+00	7.51e-38	4.11e-31	0.8678
1. PBF	B2HP75	Probable cell division protein WhiA	0.00e+00	2.20e-21	7.85e-04	0.8112
1. PBF	Q8XNH7	Probable cell division protein WhiA	0.00e+00	6.25e-31	9.95e-31	0.8901
1. PBF	C1KYN9	Probable cell division protein WhiA	0.00e+00	9.44e-32	2.77e-40	0.9141
1. PBF	A4W090	Probable cell division protein WhiA	0.00e+00	3.27e-40	1.23e-32	0.8462
1. PBF	B9EAG4	Probable cell division protein WhiA	0.00e+00	1.31e-38	1.91e-34	0.9056
1. PBF	Q5M056	Probable cell division protein WhiA	0.00e+00	1.07e-47	2.10e-29	0.8827
1. PBF	P0DH43	Probable cell division protein WhiA	0.00e+00	3.83e-44	1.11e-25	0.8591
1. PBF	Q837R3	Probable cell division protein WhiA	0.00e+00	1.05e-42	4.59e-48	0.9049
1. PBF	C1EZD4	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9185
1. PBF	A8LW20	Probable cell division protein WhiA	0.00e+00	3.70e-24	6.60e-06	0.8438
1. PBF	A5CRT9	Probable cell division protein WhiA	0.00e+00	1.69e-23	7.92e-06	0.805
1. PBF	A4XIN2	Probable cell division protein WhiA	0.00e+00	4.57e-31	8.97e-27	0.8641
1. PBF	Q1JCQ4	Probable cell division protein WhiA	0.00e+00	1.33e-45	3.49e-25	0.8633
1. PBF	Q3K2D9	Probable cell division protein WhiA	0.00e+00	1.45e-47	9.22e-27	0.8896
1. PBF	A4TC18	Probable cell division protein WhiA	0.00e+00	1.11e-20	0.024	0.8135
1. PBF	Q49VW5	Probable cell division protein WhiA	0.00e+00	1.91e-41	2.01e-34	0.8962
1. PBF	Q04BH8	Probable cell division protein WhiA	0.00e+00	6.25e-43	1.16e-34	0.899
1. PBF	Q8G6D7	Probable cell division protein WhiA	0.00e+00	4.30e-36	7.21e-04	0.6415
1. PBF	Q6A9J5	Probable cell division protein WhiA	0.00e+00	2.33e-18	3.19e-09	0.835
1. PBF	Q5KVD7	Probable cell division protein WhiA	0.00e+00	1.39e-36	5.88e-39	0.9189
1. PBF	Q8P1T6	Probable cell division protein WhiA	0.00e+00	1.50e-43	6.05e-25	0.8667
1. PBF	A4QEG3	Probable cell division protein WhiA	0.00e+00	3.66e-23	2.31e-07	0.7669
1. PBF	A6QF75	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.9035
1. PBF	Q4JVJ1	Probable cell division protein WhiA	0.00e+00	2.97e-22	1.65e-04	0.8025
1. PBF	A3PZ96	Probable cell division protein WhiA	0.00e+00	1.06e-20	0.025	0.8174
1. PBF	C5CBP2	Probable cell division protein WhiA	0.00e+00	2.00e-27	4.33e-04	0.8432
1. PBF	A8Z044	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.8876
1. PBF	Q9CGX9	Probable cell division protein WhiA	0.00e+00	3.11e-40	3.31e-24	0.8662
1. PBF	Q0RH03	Probable cell division protein WhiA	0.00e+00	1.09e-19	1.31e-04	0.8399
1. PBF	Q65EH2	Probable cell division protein WhiA	0.00e+00	3.02e-42	1.04e-40	0.9202
1. PBF	Q72XW6	Probable cell division protein WhiA	0.00e+00	8.88e-47	4.60e-43	0.9222
1. PBF	C4L5I7	Probable cell division protein WhiA	0.00e+00	1.81e-42	6.41e-43	0.9043
1. PBF	Q6GB63	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.9039
1. PBF	Q1J7K2	Probable cell division protein WhiA	0.00e+00	1.33e-45	3.49e-25	0.85
1. PBF	B7GL36	Probable cell division protein WhiA	0.00e+00	2.92e-34	2.39e-40	0.9127
1. PBF	A3DBM8	Probable cell division protein WhiA	0.00e+00	1.85e-36	8.47e-29	0.8865
1. PBF	Q1B9C8	Probable cell division protein WhiA	0.00e+00	1.06e-20	0.025	0.8154
1. PBF	A0QWV9	Probable cell division protein WhiA	0.00e+00	2.39e-20	0.009	0.8194
1. PBF	Q38Y99	Probable cell division protein WhiA	0.00e+00	2.74e-48	3.75e-45	0.9012
1. PBF	B1HVQ8	Probable cell division protein WhiA	0.00e+00	4.02e-43	8.97e-41	0.9245
1. PBF	Q8DP12	Probable cell division protein WhiA	0.00e+00	7.74e-48	4.46e-25	0.8706
1. PBF	Q0B092	Probable cell division protein WhiA	0.00e+00	1.56e-41	3.46e-23	0.8782
1. PBF	C1AN68	Probable cell division protein WhiA	0.00e+00	1.62e-21	0.001	0.8128
1. PBF	A6TZP6	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	0.9068
1. PBF	Q5WDJ2	Probable cell division protein WhiA	0.00e+00	6.18e-38	1.60e-39	0.9115
1. PBF	Q8E130	Probable cell division protein WhiA	0.00e+00	1.45e-47	9.22e-27	0.8893
1. PBF	A6TVF1	Probable cell division protein WhiA	0.00e+00	2.89e-35	2.92e-25	0.8784
1. PBF	A1T8K7	Probable cell division protein WhiA	0.00e+00	3.22e-20	0.028	0.8144
1. PBF	Q741E2	Probable cell division protein WhiA	0.00e+00	4.12e-23	0.001	0.8093
1. PBF	A7GIX1	Probable cell division protein WhiA	0.00e+00	3.58e-37	1.49e-31	0.8727
1. PBF	A5CYP3	Probable cell division protein WhiA	0.00e+00	5.75e-42	3.15e-27	0.8964
1. PBF	Q0S0J6	Probable cell division protein WhiA	0.00e+00	8.33e-21	0.023	0.8052
1. PBF	A8MLX3	Probable cell division protein WhiA	0.00e+00	9.60e-42	5.96e-31	0.8567
1. PBF	Q67T19	Probable cell division protein WhiA	0.00e+00	6.93e-36	3.05e-19	0.9057
1. PBF	Q2FIM6	Probable cell division protein WhiA	0.00e+00	9.47e-43	6.94e-36	0.9011
1. PBF	A0QI01	Probable cell division protein WhiA	0.00e+00	4.12e-23	0.001	0.8082
2. PF	F2RGQ4	Probable cell division protein WhiA	0.00e+00	1.04e-17	NA	0.8307
2. PF	Q6NH34	Probable cell division protein WhiA	0.00e+00	5.22e-23	NA	0.6423
2. PF	B1W0Z1	Probable cell division protein WhiA	0.00e+00	2.43e-20	NA	0.8396
2. PF	A8KYR3	Probable cell division protein WhiA	0.00e+00	4.74e-22	NA	0.8311
2. PF	Q83HP5	Probable cell division protein WhiA	1.22e-14	3.56e-32	NA	0.5792
2. PF	Q83MY5	Probable cell division protein WhiA	1.44e-15	3.56e-32	NA	0.577
2. PF	Q829W5	Probable cell division protein WhiA	0.00e+00	6.40e-20	NA	0.8353
2. PF	A1A1N4	Probable cell division protein WhiA	0.00e+00	1.06e-28	NA	0.6877
4. PB	P9WF45	Probable cell division protein WhiA	0.00e+00	3.34e-22	5.36e-04	NA
4. PB	Q2G037	Probable cell division protein WhiA	0.00e+00	2.80e-43	4.11e-36	NA
5. P	O21044	Intron-encoded DNA endonuclease ai2b	7.78e-08	4.24e-02	NA	NA
5. P	P94359	Uncharacterized protein YxkF	9.59e-02	2.19e-03	NA	NA
6. F	Q49608	DNA gyrase subunit A (Fragment)	2.14e-04	NA	NA	0.6335
6. F	P67126	UPF0051 protein Mb1496	6.75e-04	NA	NA	0.6305
6. F	Q9HH84	DNA polymerase	2.32e-01	NA	NA	0.5327
6. F	A9RAH6	Probable intron-encoded endonuclease aI3	2.17e-02	NA	NA	0.4919
6. F	P0CY43	Cytochrome b mRNA maturase bI3	3.47e-03	NA	NA	0.4544
6. F	Q8TUS2	RNA-splicing ligase RtcB	2.48e-03	NA	NA	0.4683
6. F	Q0H8Y2	Probable intron-encoded endonuclease aI7	1.45e-03	NA	NA	0.558
6. F	Q5JGR9	Probable translation initiation factor IF-2	3.07e-02	NA	NA	0.5205
6. F	Q2LCQ5	Probable intron-encoded endonuclease aI3	5.60e-05	NA	NA	0.5677
6. F	Q8YZA1	Replicative DNA helicase	7.44e-03	NA	NA	0.5883
6. F	Q6DN58	Probable intron-encoded endonuclease aI3	5.23e-05	NA	NA	0.4962
6. F	A9RAG8	Cytochrome b mRNA maturase bI2	3.29e-04	NA	NA	0.5394
6. F	Q9HH05	DNA polymerase (Fragment)	1.55e-01	NA	NA	0.5352
6. F	O33149	DNA gyrase subunit A (Fragment)	1.12e-04	NA	NA	0.655
6. F	P03880	Intron-encoded DNA endonuclease I-AniI	1.14e-03	NA	NA	0.4696
6. F	Q49166	DNA gyrase subunit A (Fragment)	2.38e-04	NA	NA	0.653
6. F	P74918	DNA polymerase	4.34e-02	NA	NA	0.5502
6. F	Q9V168	RNA-splicing ligase RtcB	1.69e-02	NA	NA	0.5501
6. F	P21505	Homing endonuclease I-DmoI	1.06e-09	NA	NA	0.6123
6. F	Q49467	DNA gyrase subunit A (Fragment)	1.64e-04	NA	NA	0.6617
6. F	P30317	DNA polymerase	2.01e-01	NA	NA	0.5751
6. F	O67475	Ribonucleoside-diphosphate reductase subunit beta	1.69e-03	NA	NA	0.5531
6. F	Q32001	DNA endonuclease I-ChuI	6.48e-08	NA	NA	0.5809
6. F	O73942	Homing endonuclease I-ApeI	6.87e-07	NA	NA	0.6493
6. F	Q9F414	Protein RecA (Fragment)	7.48e-04	NA	NA	0.501
6. F	Q55418	Replicative DNA helicase	4.80e-03	NA	NA	0.6042
6. F	Q8U0H4	RNA-splicing ligase RtcB	7.52e-04	NA	NA	0.463
6. F	P9WFP6	UPF0051 protein MT1508	6.65e-04	NA	NA	0.63
6. F	Q34807	Probable intron-encoded endonuclease 1	4.08e-06	NA	NA	0.5712
6. F	Q35136	Probable intron-encoded endonuclease 4	1.77e-04	NA	NA	0.4004
6. F	O63264	Probable intron-encoded endonuclease I-ZbiI	3.88e-06	NA	NA	0.5864
6. F	Q57532	DNA gyrase subunit A	3.53e-02	NA	NA	0.6614
6. F	Q9F407	Protein RecA (Fragment)	5.65e-04	NA	NA	0.5045
6. F	Q9V2G4	Replication factor C small subunit	3.60e-02	NA	NA	0.4705
6. F	O30477	Replicative DNA helicase	1.19e-02	NA	NA	0.617