Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54986.1
JCVISYN3A_0824
Excinuclease ABC subunit A.
M. mycoides homolog: Q6MS39.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.
Statistics
Total GO Annotation: 247
Unique PROST Go: 2
Unique BLAST Go: 200
Unique Foldseek Go: 6
Total Homologs: 1561
Unique PROST Homologs: 4
Unique BLAST Homologs: 1082
Unique Foldseek Homologs: 271
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q98PL2
(UvrABC system protein A) with a FATCAT P-Value: 0 and RMSD of 1.78 angstrom. The sequence alignment identity is 55.1%.
Structural alignment shown in left. Query protein AVX54986.1 colored as red in alignment, homolog Q98PL2 colored as blue.
Query protein AVX54986.1 is also shown in right top, homolog Q98PL2 showed in right bottom. They are colored based on secondary structures.
AVX54986.1 MS-TDKIIIKGAREHNLKNIDLELPKNKLIVFTGLSGSGKSSLAFSTIYQEGRRRYIESLSAYARQFLGGNEKPDVDSIEGLSPAISIDQKTTSHNPRST 99 Q98PL2 MSKVDFLHIKGARENNLKNVELTIPKNKLVIFTGLSGSGKSSLAFNTIYEEGRRRYVDSLSSYARQFLGGTSKPDVDSIEGLSPAISIEQKTTHNNPRST 100 AVX54986.1 VGTVTEIYDYLRLLYARIGQPYCINNHGQIK--AVSIKEIVENI----KQSTSDGEQIHILSPVIRDKKGTHIDILEKLRNDGFIRVIVDDQLRML-DD- 191 Q98PL2 VGTVTEIYDYLRLLYARIGKPFC-PKH-KIKIEGKTTKLIIEGIVDFPKNS-----KLIILSPVVELEKGTHQKLIAKLKTEGFLRLKINNEIVSLSDDK 193 AVX54986.1 QINLEKNQRHNIDIVVDRIIYHNNDEINSRIFTAVEMGLKYSNNLIKIAFPNSNKQE-KLFSTSFSCKVCDFVVPELEPRLFSFNAPLGACELCNGLGVS 290 Q98PL2 EINLDKNKRHSIDIVVDRIVL--NEEKKLEISEAISIALEYGKGIVKVE--NVETGEIKIFSSNHSCPKGDFEMPKIETRLFSFNSPYGMCQNCKGLGVQ 289 AVX54986.1 LEPDINLILPDLKLSINQGGVVYYKNFMHTKNIEWQKFRILCDYYYIDLNTPLKDLTQKQRDIILWGSDREIDIKIVTENNNKYEKYDFIEGNAALI-K- 388 Q98PL2 LRGDYNLLVPDQNLSISEGAIKIFESTVNSSNQEWQEFEALLNYYGIDKNIPMRKLSESDRQIIKYGSKEEIDY-IIKSQSNKFKRTKRIEG---IIDKV 385 AVX54986.1 -RRYFESKSEEARKWYSKFMSSKICKQCKGSRLNDIALSVKINEKSIFDYTNMSISEQLDFLLNIDLTPTQATIAKLVLDEIISRTNFLNEVGLGYLNLS 487 Q98PL2 ERKYLETSSEGIRTWIKRYMSEFICNMCKGSRLNEHALAVKINGLNIWEISSLSINDVYEQSINLNLSDYEREITTLLISELTSRLSFLVDVGLDYLTLN 485 AVX54986.1 RTATTLSGGESQRIRLAKQIGSQLTGILYVLDEPSIGLHQKDNDKLIKTLKHLRDLGNTLIVVEHDEDTMKSSDWIVDIGPRAGEYGGEITFSGTYQDIL 587 Q98PL2 RMAESLSGGEAQRIRLATQIGSNLTGVLYVLDEPSIGLHQKDNERLIKTLRKMVEIGNTLIVVEHDEDTMRASDFIVDIGPKAGSHGGEIVALGSVEDII 585 AVX54986.1 KSD-TITGRYLSRKEG---IVVPKTRRGGNGKKIEIIGASENNLKNINVTIPLNKFITITGVSGSGKSTLLEDIVY----KGI-----HNNLSKEYLPIG 674 Q98PL2 KNPISITGKYLS---GEWQNATPKSRRSGSGNVIKITGASQNNIKKLDFKIPLGKFIGVTGVSGSGKSTLINQVLVNAIEKGIARDFSHDK-NKNY---- 677 AVX54986.1 KVKEIKGIENINKAIYISQEPIGKTPRSNPATYTSVFDDIRDLFTNLPEAKIRGYKKGRFSFNVSGGRCEHCQGDGVITISMQFMPSVEVVCEICEGKRY 774 Q98PL2 --EKIEGLLYIDKLIKISQSPIGRTPRSNPATYSSLFDDIREIFSNVPEAKARGYQKGRFSFNVPGGRCEKCSGDGSIKIEMFFLPNVYITCDHCDGKRY 775 AVX54986.1 NDETLTVKYKNKSIADVLNMSVSEAYVFFEN--IPQIKQKLETILEVGLGYIKLGQNATTLSGGESQRIKLSTYLLKKQTGNTMFLLDEPTTGLHVDDVK 872 Q98PL2 NEETLQIKYRSKSISDVLDMTVSDALAFFENRLI--VKNKLQTLEDVGLGYIKLGQSSTTLSGGEAQRVKLASHLLKKSTGKTLYVLDEPTTGLHSHDVS 873 AVX54986.1 RLIGVLNKLVDLGNTVLCIEHNLDFIKVSDHIIDLGPDGGEYGGQVVVTGTPEQIINHPTSYTAKYLKDYIIND 946 Q98PL2 LLLKVLNRLVDKGDTVIVIEHNLDVIKNCDYLIDLGPGGGVNGGKIIATGTPEQVAQIEKSYTGEFLKRVL--- 944
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0009432 | SOS response |
| 1. PBF | GO:0008270 | zinc ion binding |
| 1. PBF | GO:0009381 | excinuclease ABC activity |
| 1. PBF | GO:0006289 | nucleotide-excision repair |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0042626 | ATPase-coupled transmembrane transporter activity |
| 1. PBF | GO:0009380 | excinuclease repair complex |
| 1. PBF | GO:0046872 | metal ion binding |
| 2. PF | GO:0003677 | DNA binding |
| 3. BF | GO:0042882 | L-arabinose transmembrane transport |
| 3. BF | GO:0005886 | plasma membrane |
| 3. BF | GO:0046677 | response to antibiotic |
| 3. BF | GO:0015612 | ABC-type L-arabinose transporter activity |
| 3. BF | GO:1990961 | xenobiotic detoxification by transmembrane export across the plasma membrane |
| 3. BF | GO:0015633 | ABC-type zinc transporter activity |
| 3. BF | GO:0015562 | efflux transmembrane transporter activity |
| 3. BF | GO:0015415 | ATPase-coupled phosphate ion transmembrane transporter activity |
| 3. BF | GO:0006824 | cobalt ion transport |
| 3. BF | GO:0005315 | inorganic phosphate transmembrane transporter activity |
| 3. BF | GO:0015752 | D-ribose transmembrane transport |
| 3. BF | GO:0015594 | ABC-type putrescine transporter activity |
| 3. BF | GO:0089705 | protein localization to outer membrane |
| 3. BF | GO:0015416 | ABC-type phosphonate transporter activity |
| 3. BF | GO:0034040 | ATPase-coupled lipid transmembrane transporter activity |
| 3. BF | GO:0008559 | ABC-type xenobiotic transporter activity |
| 3. BF | GO:0015420 | ABC-type vitamin B12 transporter activity |
| 3. BF | GO:0015833 | peptide transport |
| 3. BF | GO:0015611 | ABC-type D-ribose transporter activity |
| 3. BF | GO:1905887 | autoinducer AI-2 transmembrane transport |
| 3. BF | GO:0044873 | lipoprotein localization to membrane |
| 3. BF | GO:0015439 | ABC-type heme transporter activity |
| 3. BF | GO:0043211 | ABC-type carbohydrate transporter activity |
| 3. BF | GO:0043190 | ATP-binding cassette (ABC) transporter complex |
| 3. BF | GO:0140306 | lipoprotein releasing activity |
| 3. BF | GO:0042953 | lipoprotein transport |
| 4. PB | GO:0005737 | cytoplasm |
| 4. PB | GO:0045900 | negative regulation of translational elongation |
| 4. PB | GO:0060543 | negative regulation of strand invasion |
| 4. PB | GO:0016021 | integral component of membrane |
| 5. P | GO:0043022 | ribosome binding |
| 5. P | GO:0140603 | obsolete ATP hydrolysis activity |
| 6. F | GO:0042883 | cysteine transport |
| 6. F | GO:0015413 | ABC-type nickel transporter activity |
| 6. F | GO:0004518 | nuclease activity |
| 6. F | GO:0017004 | cytochrome complex assembly |
| 6. F | GO:0140394 | ABC-type azole transporter activity |
| 6. F | GO:0015410 | ABC-type manganese transporter activity |
| 7. B | GO:0042910 | xenobiotic transmembrane transporter activity |
| 7. B | GO:1900721 | positive regulation of uterine smooth muscle relaxation |
| 7. B | GO:0005829 | cytosol |
| 7. B | GO:0010315 | auxin efflux |
| 7. B | GO:0008282 | inward rectifying potassium channel |
| 7. B | GO:0042824 | MHC class I peptide loading complex |
| 7. B | GO:0010540 | basipetal auxin transport |
| 7. B | GO:0033231 | carbohydrate export |
| 7. B | GO:0033212 | iron import into cell |
| 7. B | GO:1904478 | regulation of intestinal absorption |
| 7. B | GO:0010044 | response to aluminum ion |
| 7. B | GO:0032218 | riboflavin transport |
| 7. B | GO:1903785 | L-valine transmembrane transport |
| 7. B | GO:0015847 | putrescine transport |
| 7. B | GO:0120189 | positive regulation of bile acid secretion |
| 7. B | GO:0010043 | response to zinc ion |
| 7. B | GO:0010329 | auxin efflux transmembrane transporter activity |
| 7. B | GO:0015614 | ABC-type D-xylose transporter activity |
| 7. B | GO:1905039 | carboxylic acid transmembrane transport |
| 7. B | GO:0015430 | ABC-type glycerol-3-phosphate transporter activity |
| 7. B | GO:0009640 | photomorphogenesis |
| 7. B | GO:0015893 | |
| 7. B | GO:1990963 | establishment of blood-retinal barrier |
| 7. B | GO:0009639 | response to red or far red light |
| 7. B | GO:0061843 | Sertoli cell barrier remodeling |
| 7. B | GO:0046865 | terpenoid transport |
| 7. B | GO:0048443 | stamen development |
| 7. B | GO:0097254 | renal tubular secretion |
| 7. B | GO:0032376 | positive regulation of cholesterol transport |
| 7. B | GO:1903714 | isoleucine transmembrane transport |
| 7. B | GO:0008272 | sulfate transport |
| 7. B | GO:0016324 | apical plasma membrane |
| 7. B | GO:0005576 | extracellular region |
| 7. B | GO:1903818 | positive regulation of voltage-gated potassium channel activity |
| 7. B | GO:0031004 | potassium ion-transporting ATPase complex |
| 7. B | GO:0015126 | canalicular bile acid transmembrane transporter activity |
| 7. B | GO:1903805 | L-valine import across plasma membrane |
| 7. B | GO:2001025 | positive regulation of response to drug |
| 7. B | GO:0140328 | floppase activity |
| 7. B | GO:0015675 | nickel cation transport |
| 7. B | GO:0098849 | cellular detoxification of cadmium ion |
| 7. B | GO:0048770 | pigment granule |
| 7. B | GO:0042908 | xenobiotic transport |
| 7. B | GO:1902602 | aluminum ion transmembrane transport |
| 7. B | GO:0070633 | transepithelial transport |
| 7. B | GO:0071217 | cellular response to external biotic stimulus |
| 7. B | GO:0014045 | establishment of endothelial blood-brain barrier |
| 7. B | GO:0070505 | pollen coat |
| 7. B | GO:0061092 | positive regulation of phospholipid translocation |
| 7. B | GO:0015421 | ABC-type oligopeptide transporter activity |
| 7. B | GO:0015768 | maltose transport |
| 7. B | GO:0061855 | negative regulation of neuroblast migration |
| 7. B | GO:0015441 | ABC-type beta-glucan transporter activity |
| 7. B | GO:0032782 | bile acid secretion |
| 7. B | GO:2001140 | positive regulation of phospholipid transport |
| 7. B | GO:0098662 | inorganic cation transmembrane transport |
| 7. B | GO:0140466 | iron-sulfur cluster export from the mitochondrion |
| 7. B | GO:0005887 | integral component of plasma membrane |
| 7. B | GO:0015440 | ABC-type peptide transporter activity |
| 7. B | GO:0055088 | lipid homeostasis |
| 7. B | GO:0015721 | bile acid and bile salt transport |
| 7. B | GO:0071716 | leukotriene transport |
| 7. B | GO:0019829 | ATPase-coupled cation transmembrane transporter activity |
| 7. B | GO:0099038 | ceramide floppase activity |
| 7. B | GO:0098655 | cation transmembrane transport |
| 7. B | GO:0046943 | carboxylic acid transmembrane transporter activity |
| 7. B | GO:0043225 | ATPase-coupled inorganic anion transmembrane transporter activity |
| 7. B | GO:0015433 | ABC-type peptide antigen transporter activity |
| 7. B | GO:2001225 | regulation of chloride transport |
| 7. B | GO:0042441 | eye pigment metabolic process |
| 7. B | GO:0047484 | regulation of response to osmotic stress |
| 7. B | GO:0045332 | phospholipid translocation |
| 7. B | GO:1990962 | xenobiotic transport across blood-brain barrier |
| 7. B | GO:0019885 | antigen processing and presentation of endogenous peptide antigen via MHC class I |
| 7. B | GO:0010217 | cellular aluminum ion homeostasis |
| 7. B | GO:0042941 | D-alanine transport |
| 7. B | GO:0000049 | tRNA binding |
| 7. B | GO:0006932 | substrate-dependent cell migration, cell contraction |
| 7. B | GO:0015423 | ABC-type maltose transporter activity |
| 7. B | GO:0034514 | mitochondrial unfolded protein response |
| 7. B | GO:0008558 | ABC-type guanine transporter activity |
| 7. B | GO:0090691 | formation of plant organ boundary |
| 7. B | GO:0006727 | ommochrome biosynthetic process |
| 7. B | GO:0031460 | glycine betaine transport |
| 7. B | GO:0046581 | intercellular canaliculus |
| 7. B | GO:0090374 | oligopeptide export from mitochondrion |
| 7. B | GO:0015599 | ATPase-coupled L-glutamine transmembrane transporter activity |
| 7. B | GO:0005267 | potassium channel activity |
| 7. B | GO:0005291 | high-affinity L-histidine transmembrane transporter activity |
| 7. B | GO:1904446 | positive regulation of establishment of Sertoli cell barrier |
| 7. B | GO:0006865 | amino acid transport |
| 7. B | GO:0061337 | cardiac conduction |
| 7. B | GO:0010989 | negative regulation of low-density lipoprotein particle clearance |
| 7. B | GO:0006855 | xenobiotic transmembrane transport |
| 7. B | GO:0098656 | anion transmembrane transport |
| 7. B | GO:0015722 | canalicular bile acid transport |
| 7. B | GO:1990196 | MacAB-TolC complex |
| 7. B | GO:0006879 | cellular iron ion homeostasis |
| 7. B | GO:0046978 | TAP1 binding |
| 7. B | GO:0006518 | peptide metabolic process |
| 7. B | GO:0032217 | riboflavin transmembrane transporter activity |
| 7. B | GO:0033232 | ABC-type D-methionine transporter activity |
| 7. B | GO:0017085 | response to insecticide |
| 7. B | GO:0015437 | lipopolysaccharide floppase activity |
| 7. B | GO:0015803 | branched-chain amino acid transport |
| 7. B | GO:0036246 | phytochelatin 2 import into vacuole |
| 7. B | GO:0015412 | ABC-type molybdate transporter activity |
| 7. B | GO:0090554 | phosphatidylcholine floppase activity |
| 7. B | GO:1903413 | cellular response to bile acid |
| 7. B | GO:0015164 | glucuronoside transmembrane transporter activity |
| 7. B | GO:0140359 | ABC-type transporter activity |
| 7. B | GO:0062157 | mitochondrial ATP-gated potassium channel complex |
| 7. B | GO:0036249 | cadmium ion import into vacuole |
| 7. B | GO:0015419 | ABC-type sulfate transporter activity |
| 7. B | GO:0044604 | ABC-type phytochelatin transporter activity |
| 7. B | GO:0055072 | iron ion homeostasis |
| 7. B | GO:0043214 | ABC-type bacteriocin transporter activity |
| 7. B | GO:0009926 | auxin polar transport |
| 7. B | GO:0009958 | positive gravitropism |
| 7. B | GO:0055085 | transmembrane transport |
| 7. B | GO:0015808 | L-alanine transport |
| 7. B | GO:0043481 | anthocyanin accumulation in tissues in response to UV light |
| 7. B | GO:0015842 | aminergic neurotransmitter loading into synaptic vesicle |
| 7. B | GO:0072089 | stem cell proliferation |
| 7. B | GO:0001407 | glycerophosphodiester transmembrane transport |
| 7. B | GO:0061045 | negative regulation of wound healing |
| 7. B | GO:0046985 | positive regulation of hemoglobin biosynthetic process |
| 7. B | GO:0071996 | glutathione transmembrane import into vacuole |
| 7. B | GO:0090740 | integral component of pigment granule membrane |
| 7. B | GO:0071805 | potassium ion transmembrane transport |
| 7. B | GO:0015431 | ABC-type glutathione S-conjugate transporter activity |
| 7. B | GO:0010541 | acropetal auxin transport |
| 7. B | GO:0070455 | positive regulation of heme biosynthetic process |
| 7. B | GO:0005919 | pleated septate junction |
| 7. B | GO:1990060 | maltose transport complex |
| 7. B | GO:0015658 | branched-chain amino acid transmembrane transporter activity |
| 7. B | GO:0044874 | lipoprotein localization to outer membrane |
| 7. B | GO:0022857 | transmembrane transporter activity |
| 7. B | GO:0006412 | translation |
| 7. B | GO:0031459 | ABC-type glycine betaine transporter activity |
| 7. B | GO:0015188 | L-isoleucine transmembrane transporter activity |
| 7. B | GO:1901238 | ABC-type tungstate transporter activity |
| 7. B | GO:1901529 | positive regulation of anion channel activity |
| 7. B | GO:1904176 | carbon phosphorus lyase complex |
| 7. B | GO:0008643 | carbohydrate transport |
| 7. B | GO:0070297 | regulation of phosphorelay signal transduction system |
| 7. B | GO:0009268 | response to pH |
| 7. B | GO:0140115 | export across plasma membrane |
| 7. B | GO:0102025 | ABC-type thiosulfate transporter activity |
| 7. B | GO:0000770 | peptide pheromone export |
| 7. B | GO:0010328 | auxin influx transmembrane transporter activity |
| 7. B | GO:1903806 | L-isoleucine import across plasma membrane |
| 7. B | GO:0060919 | auxin influx |
| 7. B | GO:0071995 | phytochelatin import into vacuole |
| 7. B | GO:0006856 | eye pigment precursor transport |
| 7. B | GO:0006811 | ion transport |
| 7. B | GO:0015087 | cobalt ion transmembrane transporter activity |
| 7. B | GO:0055052 | ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing |
| 7. B | GO:0140481 | ABC-type iron-sulfur cluster transporter activity |
| 7. B | GO:0015192 | L-phenylalanine transmembrane transporter activity |
| 7. B | GO:0098713 | leucine import across plasma membrane |
| 7. B | GO:0015823 | phenylalanine transport |
| 7. B | GO:0015807 | L-amino acid transport |
| 7. B | GO:0015418 | ABC-type quaternary ammonium compound transporting activity |
| 7. B | GO:0005304 | L-valine transmembrane transporter activity |
| 7. B | GO:0015190 | L-leucine transmembrane transporter activity |
| 7. B | GO:0000324 | fungal-type vacuole |
| 7. B | GO:0015625 | ABC-type ferric hydroxamate transporter activity |
| 7. B | GO:0019843 | rRNA binding |
| 7. B | GO:0015424 | ABC-type amino acid transporter activity |
| 7. B | GO:0015432 | ABC-type bile acid transporter activity |
| 7. B | GO:1905075 | positive regulation of tight junction disassembly |
| 7. B | GO:0030256 | type I protein secretion system complex |
| 7. B | GO:0042401 | cellular biogenic amine biosynthetic process |
| 7. B | GO:0016787 | hydrolase activity |
| 7. B | GO:0098591 | external side of apical plasma membrane |
| 7. B | GO:0071714 | icosanoid transmembrane transporter activity |
| 7. B | GO:0042888 | molybdenum ion transmembrane transporter activity |
| 7. B | GO:1905948 | ABC-type 3',5'-cyclic GMP transmembrane transporter activity |
| 7. B | GO:0005275 | amine transmembrane transporter activity |
| 7. B | GO:0033198 | response to ATP |
| 7. B | GO:0015408 | ABC-type ferric iron transporter activity |
| 7. B | GO:1905604 | negative regulation of blood-brain barrier permeability |
| 7. B | GO:0051539 | 4 iron, 4 sulfur cluster binding |
| 7. B | GO:0030253 | protein secretion by the type I secretion system |
| 7. B | GO:0071627 | integral component of fungal-type vacuolar membrane |
| 7. B | GO:0015417 | ABC-type polyamine transporter activity |
| 7. B | GO:0099040 | ceramide translocation |
| 7. B | GO:1901557 | response to fenofibrate |
| 7. B | GO:0070731 | cGMP transport |
| 7. B | GO:0031409 | pigment binding |
| 7. B | GO:1903810 | L-histidine import across plasma membrane |
| 7. B | GO:1901656 | glycoside transport |
| 7. B | GO:0060253 | negative regulation of glial cell proliferation |
| 7. B | GO:0034041 | ABC-type sterol transporter activity |
| 7. B | GO:0015620 | ferric-enterobactin transmembrane transporter activity |
| 7. B | GO:0015083 | aluminum ion transmembrane transporter activity |
| 7. B | GO:0008281 | sulfonylurea receptor activity |
| 7. B | GO:0015689 | molybdate ion transport |
| 7. B | GO:0090555 | phosphatidylethanolamine flippase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0003677 | DNA binding |
| GO:0009432 | SOS response |
| GO:0090305 | nucleic acid phosphodiester bond hydrolysis |
| GO:0008270 | zinc ion binding |
| GO:0009381 | excinuclease ABC activity |
| GO:0006281 | DNA repair |
| GO:0006289 | nucleotide-excision repair |
| GO:0016887 | ATP hydrolysis activity |
| GO:0005737 | cytoplasm |
| GO:0004518 | nuclease activity |
| GO:0005524 | ATP binding |
| GO:0006974 | cellular response to DNA damage stimulus |
| GO:0009380 | excinuclease repair complex |
| GO:0046872 | metal ion binding |
| GO:0000166 | nucleotide binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | O51777 | UvrABC system protein A | 0.00e+00 | 1.39e-84 | 0.0 | 0.9197 |
| 1. PBF | P47660 | UvrABC system protein A | 0.00e+00 | 5.88e-85 | 0.0 | 0.9367 |
| 1. PBF | Q8NXL9 | UvrABC system protein A | 0.00e+00 | 1.19e-81 | 0.0 | 0.956 |
| 1. PBF | Q92G31 | UvrABC system protein A | 0.00e+00 | 6.51e-77 | 0.0 | 0.9522 |
| 1. PBF | Q2YPX5 | UvrABC system protein A | 0.00e+00 | 1.22e-71 | 0.0 | 0.9335 |
| 1. PBF | O31151 | UvrABC system protein A | 0.00e+00 | 8.91e-74 | 0.0 | 0.9362 |
| 1. PBF | P56899 | UvrABC system protein A | 0.00e+00 | 1.21e-72 | 0.0 | 0.9222 |
| 1. PBF | Q8YHC4 | UvrABC system protein A | 0.00e+00 | 3.59e-71 | 0.0 | 0.9404 |
| 1. PBF | Q928A5 | UvrABC system protein A | 0.00e+00 | 5.52e-77 | 0.0 | 0.953 |
| 1. PBF | Q88QK7 | UvrABC system protein A | 0.00e+00 | 3.69e-73 | 0.0 | 0.9447 |
| 1. PBF | Q1RK71 | UvrABC system protein A | 0.00e+00 | 4.72e-80 | 0.0 | 0.9558 |
| 1. PBF | Q8G0I9 | UvrABC system protein A | 0.00e+00 | 2.45e-71 | 0.0 | 0.9355 |
| 1. PBF | Q72RM8 | UvrABC system protein A | 0.00e+00 | 4.49e-83 | 0.0 | 0.8779 |
| 1. PBF | Q99Y84 | UvrABC system protein A | 0.00e+00 | 3.49e-76 | 0.0 | 0.9534 |
| 1. PBF | Q6GIN2 | UvrABC system protein A | 0.00e+00 | 3.51e-81 | 0.0 | 0.9569 |
| 1. PBF | Q50968 | UvrABC system protein A | 0.00e+00 | 7.53e-72 | 0.0 | 0.9582 |
| 1. PBF | Q9WYV0 | UvrABC system protein A | 0.00e+00 | 1.15e-74 | 0.0 | 0.9225 |
| 1. PBF | O34863 | UvrABC system protein A | 0.00e+00 | 1.07e-76 | 0.0 | 0.9508 |
| 1. PBF | Q8DCJ3 | UvrABC system protein A | 0.00e+00 | 5.39e-80 | 0.0 | 0.9445 |
| 1. PBF | Q98M36 | UvrABC system protein A | 0.00e+00 | 2.09e-72 | 0.0 | 0.9391 |
| 1. PBF | Q89L46 | UvrABC system protein A | 0.00e+00 | 1.43e-68 | 0.0 | 0.9337 |
| 1. PBF | Q5HHQ9 | UvrABC system protein A | 0.00e+00 | 1.19e-81 | 0.0 | 0.8639 |
| 1. PBF | P0A196 | UvrABC system protein A | 0.00e+00 | 1.75e-76 | 0.0 | 0.8794 |
| 1. PBF | Q9KUW5 | UvrABC system protein A | 0.00e+00 | 5.52e-77 | 0.0 | 0.9523 |
| 1. PBF | Q9HWG0 | UvrABC system protein A | 0.00e+00 | 2.37e-78 | 0.0 | 0.9378 |
| 1. PBF | Q9ZLD6 | UvrABC system protein A | 0.00e+00 | 1.13e-82 | 0.0 | 0.9056 |
| 1. PBF | Q88YI7 | UvrABC system protein A | 0.00e+00 | 1.87e-78 | 0.0 | 0.951 |
| 1. PBF | Q5HQW9 | UvrABC system protein A | 0.00e+00 | 3.78e-86 | 0.0 | 0.9566 |
| 1. PBF | Q5XA89 | UvrABC system protein A | 0.00e+00 | 3.59e-77 | 0.0 | 0.9587 |
| 1. PBF | Q8FB02 | UvrABC system protein A | 0.00e+00 | 6.41e-78 | 0.0 | 0.9502 |
| 1. PBF | P44410 | UvrABC system protein A | 0.00e+00 | 5.61e-82 | 0.0 | 0.9462 |
| 1. PBF | P9WQK6 | UvrABC system protein A | 0.00e+00 | 1.40e-74 | 0.0 | 0.8775 |
| 1. PBF | P0CZ41 | UvrABC system protein A | 0.00e+00 | 2.85e-77 | 0.0 | 0.9452 |
| 1. PBF | P63382 | UvrABC system protein A | 0.00e+00 | 6.22e-82 | 0.0 | 0.8606 |
| 1. PBF | Q87BK9 | UvrABC system protein A | 0.00e+00 | 6.36e-71 | 0.0 | 0.9288 |
| 1. PBF | Q9K6Y0 | UvrABC system protein A | 0.00e+00 | 9.97e-76 | 0.0 | 0.8567 |
| 1. PBF | Q9ZCC3 | UvrABC system protein A | 0.00e+00 | 5.08e-78 | 0.0 | 0.9581 |
| 1. PBF | P52087 | UvrABC system protein A (Fragment) | 1.11e-16 | 5.79e-13 | 1.45e-83 | 0.7203 |
| 1. PBF | Q8Y4F6 | UvrABC system protein A | 0.00e+00 | 2.96e-76 | 0.0 | 0.9566 |
| 1. PBF | Q8PN26 | UvrABC system protein A | 0.00e+00 | 1.09e-51 | 0.0 | 0.9299 |
| 1. PBF | P63381 | UvrABC system protein A | 0.00e+00 | 1.40e-74 | 0.0 | 0.9412 |
| 1. PBF | P0A195 | UvrABC system protein A | 0.00e+00 | 1.75e-76 | 0.0 | 0.9542 |
| 1. PBF | P72481 | UvrABC system protein A | 0.00e+00 | 8.74e-81 | 0.0 | 0.9561 |
| 1. PBF | Q8UF86 | UvrABC system protein A | 0.00e+00 | 2.42e-73 | 0.0 | 0.8388 |
| 1. PBF | Q8PBH3 | UvrABC system protein A | 0.00e+00 | 1.81e-50 | 0.0 | 0.92 |
| 1. PBF | Q87LA0 | UvrABC system protein A | 0.00e+00 | 4.76e-78 | 0.0 | 0.9549 |
| 1. PBF | Q8XNI5 | UvrABC system protein A | 0.00e+00 | 9.21e-83 | 0.0 | 0.9544 |
| 1. PBF | P0CZ40 | UvrABC system protein A | 0.00e+00 | 2.85e-77 | 0.0 | 0.9582 |
| 1. PBF | O83527 | UvrABC system protein A | 0.00e+00 | 4.09e-74 | 0.0 | 0.9086 |
| 1. PBF | Q4UJW4 | UvrABC system protein A | 0.00e+00 | 1.20e-77 | 0.0 | 0.9535 |
| 1. PBF | Q890X9 | UvrABC system protein A | 0.00e+00 | 4.93e-88 | 0.0 | 0.9607 |
| 1. PBF | P13567 | UvrABC system protein A | 0.00e+00 | 1.58e-57 | 0.0 | 0.8585 |
| 1. PBF | Q6GB71 | UvrABC system protein A | 0.00e+00 | 1.19e-81 | 0.0 | 0.8603 |
| 1. PBF | P73412 | UvrABC system protein A | 0.00e+00 | 1.45e-74 | 0.0 | 0.9222 |
| 1. PBF | Q8NZJ2 | UvrABC system protein A | 0.00e+00 | 4.25e-76 | 0.0 | 0.9574 |
| 1. PBF | Q71WU0 | UvrABC system protein A | 0.00e+00 | 4.38e-77 | 0.0 | 0.9546 |
| 1. PBF | P56474 | UvrABC system protein A | 0.00e+00 | 7.64e-81 | 0.0 | 0.9273 |
| 1. PBF | Q8F435 | UvrABC system protein A | 0.00e+00 | 4.49e-83 | 0.0 | 0.8793 |
| 1. PBF | P57979 | UvrABC system protein A | 0.00e+00 | 2.14e-79 | 0.0 | 0.9435 |
| 1. PBF | P63385 | UvrABC system protein A | 0.00e+00 | 9.67e-82 | 0.0 | 0.9582 |
| 1. PBF | Q56242 | UvrABC system protein A | 0.00e+00 | 3.84e-74 | 0.0 | 0.9308 |
| 1. PBF | O66911 | UvrABC system protein A | 0.00e+00 | 1.73e-71 | 0.0 | 0.9505 |
| 1. PBF | Q9PR42 | UvrABC system protein A | 0.00e+00 | 4.82e-84 | 0.0 | 0.9578 |
| 1. PBF | Q829X3 | UvrABC system protein A | 0.00e+00 | 6.97e-39 | 0.0 | 0.8456 |
| 1. PBF | Q97LQ1 | UvrABC system protein A | 0.00e+00 | 6.41e-78 | 0.0 | 0.9599 |
| 1. PBF | P63384 | UvrABC system protein A | 0.00e+00 | 9.67e-82 | 0.0 | 0.9591 |
| 1. PBF | Q9PAR9 | UvrABC system protein A | 0.00e+00 | 1.90e-68 | 0.0 | 0.9066 |
| 1. PBF | Q9Z507 | UvrABC system protein A | 0.00e+00 | 1.05e-33 | 0.0 | 0.815 |
| 1. PBF | Q7VLW2 | UvrABC system protein A | 0.00e+00 | 2.33e-75 | 0.0 | 0.963 |
| 1. PBF | O26543 | UvrABC system protein A | 0.00e+00 | 1.87e-73 | 0.0 | 0.9578 |
| 1. PBF | Q9CC24 | UvrABC system protein A | 0.00e+00 | 3.49e-72 | 0.0 | 0.8333 |
| 1. PBF | Q9CEL9 | UvrABC system protein A | 0.00e+00 | 3.73e-82 | 0.0 | 0.9638 |
| 1. PBF | P0C0Z2 | UvrABC system protein A | 0.00e+00 | 1.22e-71 | 0.0 | 0.9353 |
| 1. PBF | Q98PL2 | UvrABC system protein A | 0.00e+00 | 3.04e-85 | 0.0 | 0.9698 |
| 1. PBF | Q8ENJ6 | UvrABC system protein A | 0.00e+00 | 3.69e-75 | 0.0 | 0.8599 |
| 1. PBF | Q68Y12 | UvrABC system protein A | 0.00e+00 | 3.77e-78 | 0.0 | 0.9644 |
| 1. PBF | P0A699 | UvrABC system protein A | 0.00e+00 | 2.79e-78 | 0.0 | 0.9576 |
| 1. PBF | Q8EUL1 | UvrABC system protein A | 0.00e+00 | 2.49e-75 | 0.0 | 0.9109 |
| 1. PBF | Q46577 | UvrABC system protein A | 0.00e+00 | 1.01e-58 | 0.0 | 0.9443 |
| 1. PBF | Q9JZP1 | UvrABC system protein A | 0.00e+00 | 8.25e-70 | 0.0 | 0.9499 |
| 1. PBF | Q7MHB5 | UvrABC system protein A | 0.00e+00 | 9.55e-80 | 0.0 | 0.9577 |
| 1. PBF | Q8CPY9 | UvrABC system protein A | 0.00e+00 | 1.00e-85 | 0.0 | 0.9342 |
| 1. PBF | Q8X5U9 | UvrABC system protein A | 0.00e+00 | 1.39e-78 | 0.0 | 0.9568 |
| 1. PBF | Q9JUS4 | UvrABC system protein A | 0.00e+00 | 1.76e-74 | 0.0 | 0.9536 |
| 1. PBF | P75176 | UvrABC system protein A | 0.00e+00 | 4.88e-80 | 0.0 | 0.8626 |
| 1. PBF | Q8ZJ07 | UvrABC system protein A | 0.00e+00 | 9.35e-77 | 0.0 | 0.9537 |
| 1. PBF | P63383 | UvrABC system protein A | 0.00e+00 | 6.22e-82 | 0.0 | 0.9556 |
| 3. BF | Q2EHL8 | Macrolide export ATP-binding/permease protein MacB | 3.79e-01 | NA | 7.87e-04 | 0.4694 |
| 3. BF | Q3SI20 | Lipoprotein-releasing system ATP-binding protein LolD | 3.17e-02 | NA | 0.007 | 0.5343 |
| 3. BF | Q160G4 | Hemin import ATP-binding protein HmuV | 2.22e-02 | NA | 0.001 | 0.5257 |
| 3. BF | Q32AY3 | Hemin import ATP-binding protein HmuV | 3.22e-02 | NA | 0.002 | 0.6249 |
| 3. BF | Q8D7T7 | Ribose import ATP-binding protein RbsA | 5.73e-04 | NA | 0.001 | 0.4177 |
| 3. BF | Q7MEV1 | Ribose import ATP-binding protein RbsA | 5.44e-04 | NA | 0.001 | 0.4131 |
| 3. BF | B5BA33 | Vitamin B12 import ATP-binding protein BtuD | 4.89e-03 | NA | 7.39e-05 | 0.6584 |
| 3. BF | Q0T4R9 | Vitamin B12 import ATP-binding protein BtuD | 6.53e-03 | NA | 2.18e-04 | 0.6178 |
| 3. BF | P42360 | Manganese import ATP-binding protein ScaC | 5.45e-03 | NA | 2.80e-04 | 0.626 |
| 3. BF | Q87JM4 | Macrolide export ATP-binding/permease protein MacB | 2.69e-01 | NA | 3.42e-06 | 0.3993 |
| 3. BF | Q8E7N9 | Ribose import ATP-binding protein RbsA | 1.74e-03 | NA | 0.012 | 0.4475 |
| 3. BF | Q321G6 | Vitamin B12 import ATP-binding protein BtuD | 6.93e-03 | NA | 0.001 | 0.6047 |
| 3. BF | Q9PBK0 | Phosphate import ATP-binding protein PstB | 2.97e-02 | NA | 0.015 | 0.5722 |
| 3. BF | Q66EY9 | Autoinducer 2 import ATP-binding protein LsrA | 2.43e-03 | NA | 0.017 | 0.4299 |
| 3. BF | Q2G7G7 | Lipoprotein-releasing system ATP-binding protein LolD | 3.69e-02 | NA | 0.037 | 0.5781 |
| 3. BF | Q3K3R2 | Ribose import ATP-binding protein RbsA | 1.29e-03 | NA | 0.004 | 0.4669 |
| 3. BF | P0AAG1 | Dipeptide transport ATP-binding protein DppD | 4.46e-02 | NA | 0.003 | 0.4692 |
| 3. BF | Q9Z985 | UvrABC system protein A | 1.89e-15 | NA | 2.98e-169 | 0.7468 |
| 3. BF | B7N547 | Vitamin B12 import ATP-binding protein BtuD | 6.52e-03 | NA | 2.18e-04 | 0.618 |
| 3. BF | Q7C1M3 | Vitamin B12 import ATP-binding protein BtuD | 6.60e-03 | NA | 2.18e-04 | 0.6178 |
| 3. BF | A0R6H8 | Mycobactin import ATP-binding/permease protein IrtA | 5.50e-02 | NA | 0.005 | 0.2718 |
| 3. BF | Q3JHZ1 | Ribose import ATP-binding protein RbsA 2 | 9.90e-04 | NA | 0.001 | 0.4282 |
| 3. BF | Q8FH28 | Vitamin B12 import ATP-binding protein BtuD | 6.60e-03 | NA | 2.36e-04 | 0.6118 |
| 3. BF | Q1CJW8 | Macrolide export ATP-binding/permease protein MacB 1 | 3.38e-01 | NA | 0.002 | 0.3436 |
| 3. BF | Q31KE8 | Phosphate import ATP-binding protein PstB | 2.78e-02 | NA | 0.027 | 0.5769 |
| 3. BF | B7NTS2 | Vitamin B12 import ATP-binding protein BtuD | 6.59e-03 | NA | 2.18e-04 | 0.6088 |
| 3. BF | Q87VF3 | ATP-dependent lipid A-core flippase | 1.92e-02 | NA | 4.61e-04 | 0.3106 |
| 3. BF | Q8E281 | Ribose import ATP-binding protein RbsA | 2.83e-03 | NA | 0.021 | 0.4419 |
| 3. BF | Q8XKQ2 | Galactose/methyl galactoside import ATP-binding protein MglA | 8.78e-04 | NA | 0.046 | 0.4488 |
| 3. BF | Q6N999 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 3.24e-02 | NA | 0.001 | 0.5217 |
| 3. BF | Q825P1 | Ribose import ATP-binding protein RbsA 2 | 1.03e-03 | NA | 0.008 | 0.4205 |
| 3. BF | Q0THB9 | Vitamin B12 import ATP-binding protein BtuD | 6.55e-03 | NA | 2.36e-04 | 0.6121 |
| 3. BF | Q5F6V6 | Macrolide export ATP-binding/permease protein MacB | 2.18e-01 | NA | 0.021 | 0.3979 |
| 3. BF | B1IPL8 | Vitamin B12 import ATP-binding protein BtuD | 6.57e-03 | NA | 2.18e-04 | 0.6177 |
| 3. BF | Q52666 | Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD | 2.22e-02 | NA | 8.97e-06 | 0.5652 |
| 3. BF | Q1R597 | Hemin import ATP-binding protein HmuV | 2.19e-02 | NA | 0.002 | 0.6252 |
| 3. BF | B4TGI0 | Vitamin B12 import ATP-binding protein BtuD | 1.17e-02 | NA | 7.39e-05 | 0.6815 |
| 3. BF | Q1CE65 | Hemin import ATP-binding protein HmuV | 3.35e-02 | NA | 1.93e-04 | 0.5335 |
| 3. BF | Q668L6 | Macrolide export ATP-binding/permease protein MacB 2 | 1.93e-01 | NA | 0.002 | 0.3551 |
| 3. BF | Q65WJ1 | Arabinose import ATP-binding protein AraG | 6.44e-04 | NA | 0.012 | 0.3977 |
| 3. BF | A1ABP5 | Vitamin B12 import ATP-binding protein BtuD | 1.20e-02 | NA | 2.36e-04 | 0.612 |
| 3. BF | B1XG16 | Vitamin B12 import ATP-binding protein BtuD | 6.99e-03 | NA | 2.18e-04 | 0.6178 |
| 3. BF | B5QVV9 | Vitamin B12 import ATP-binding protein BtuD | 7.90e-03 | NA | 7.39e-05 | 0.6805 |
| 3. BF | A4TQL5 | Autoinducer 2 import ATP-binding protein LsrA | 3.91e-03 | NA | 0.041 | 0.4221 |
| 3. BF | C4ZYH1 | Vitamin B12 import ATP-binding protein BtuD | 6.58e-03 | NA | 2.18e-04 | 0.618 |
| 3. BF | Q6LH11 | Ribose import ATP-binding protein RbsA | 6.17e-04 | NA | 0.038 | 0.3877 |
| 3. BF | A7FMJ7 | Autoinducer 2 import ATP-binding protein LsrA | 3.63e-03 | NA | 0.040 | 0.4033 |
| 3. BF | A1JPQ1 | Vitamin B12 import ATP-binding protein BtuD | 6.12e-03 | NA | 0.005 | 0.623 |
| 3. BF | Q2W4W1 | Zinc import ATP-binding protein ZnuC | 2.26e-02 | NA | 5.86e-06 | 0.6245 |
| 3. BF | Q08518 | UvrABC system protein A (Fragment) | 0.00e+00 | NA | 0.0 | 0.9567 |
| 3. BF | Q8X5W0 | Vitamin B12 import ATP-binding protein BtuD | 6.50e-03 | NA | 5.63e-05 | 0.6181 |
| 3. BF | Q88D92 | ATP-dependent lipid A-core flippase | 5.86e-02 | NA | 0.001 | 0.3113 |
| 3. BF | Q9X0Y8 | Phosphate import ATP-binding protein PstB | 1.32e-02 | NA | 0.002 | 0.5818 |
| 3. BF | Q7CJG3 | Macrolide export ATP-binding/permease protein MacB 2 | 3.24e-01 | NA | 0.002 | 0.3498 |
| 3. BF | P28009 | UvrABC system protein A (Fragment) | 1.40e-05 | NA | 3.76e-57 | 0.9376 |
| 3. BF | Q66A01 | Vitamin B12 import ATP-binding protein BtuD | 6.07e-03 | NA | 0.004 | 0.6118 |
| 3. BF | Q9KN37 | Ribose import ATP-binding protein RbsA | 4.98e-04 | NA | 1.74e-05 | 0.4085 |
| 3. BF | Q57PU4 | Vitamin B12 import ATP-binding protein BtuD | 4.90e-03 | NA | 7.39e-05 | 0.6804 |
| 3. BF | B6I8R4 | Vitamin B12 import ATP-binding protein BtuD | 6.55e-03 | NA | 2.18e-04 | 0.6182 |
| 3. BF | B5YPZ7 | Vitamin B12 import ATP-binding protein BtuD | 6.54e-03 | NA | 5.63e-05 | 0.6179 |
| 3. BF | Q3SQ65 | Hemin import ATP-binding protein HmuV | 2.34e-02 | NA | 0.001 | 0.5733 |
| 3. BF | A9R074 | Autoinducer 2 import ATP-binding protein LsrA | 4.30e-03 | NA | 0.041 | 0.4143 |
| 3. BF | Q1J255 | Hemin import ATP-binding protein HmuV | 4.59e-02 | NA | 0.001 | 0.5844 |
| 3. BF | Q0BQ80 | Molybdenum import ATP-binding protein ModC | 1.50e-01 | NA | 7.48e-04 | 0.4619 |
| 3. BF | Q5E4V6 | Ribose import ATP-binding protein RbsA | 5.36e-04 | NA | 2.68e-04 | 0.3856 |
| 3. BF | B2U358 | Vitamin B12 import ATP-binding protein BtuD | 6.55e-03 | NA | 2.18e-04 | 0.618 |
| 3. BF | A7ZMH7 | Vitamin B12 import ATP-binding protein BtuD | 6.53e-03 | NA | 2.18e-04 | 0.6178 |
| 3. BF | Q987E7 | Ribose import ATP-binding protein RbsA 2 | 7.76e-04 | NA | 0.018 | 0.3941 |
| 3. BF | Q63P06 | Ribose import ATP-binding protein RbsA | 2.13e-03 | NA | 0.001 | 0.4527 |
| 3. BF | Q87H79 | Ribose import ATP-binding protein RbsA | 5.09e-04 | NA | 5.88e-05 | 0.4112 |
| 3. BF | Q1C5W7 | Macrolide export ATP-binding/permease protein MacB 2 | 2.06e-01 | NA | 0.002 | 0.3484 |
| 3. BF | B2K3G1 | Autoinducer 2 import ATP-binding protein LsrA | 1.96e-03 | NA | 0.017 | 0.4152 |
| 3. BF | P63352 | Vitamin B12 import ATP-binding protein BtuD | 7.96e-03 | NA | 7.39e-05 | 0.6801 |
| 3. BF | Q3AXX4 | Phosphate import ATP-binding protein PstB | 3.81e-02 | NA | 0.044 | 0.5334 |
| 3. BF | O70014 | Hemin import ATP-binding protein HmuV | 3.39e-02 | NA | 0.002 | 0.6058 |
| 3. BF | Q0WJP9 | Autoinducer 2 import ATP-binding protein LsrA | 1.21e-02 | NA | 0.041 | 0.4211 |
| 3. BF | Q3Z257 | Vitamin B12 import ATP-binding protein BtuD | 6.54e-03 | NA | 2.18e-04 | 0.6179 |
| 3. BF | B7US48 | Vitamin B12 import ATP-binding protein BtuD | 6.58e-03 | NA | 2.36e-04 | 0.6121 |
| 3. BF | A8A0Q1 | Vitamin B12 import ATP-binding protein BtuD | 6.58e-03 | NA | 2.18e-04 | 0.618 |
| 3. BF | Q1QX69 | ATP-dependent lipid A-core flippase | 1.87e-02 | NA | 0.008 | 0.3223 |
| 3. BF | A8AHA1 | Vitamin B12 import ATP-binding protein BtuD | 7.22e-03 | NA | 4.75e-04 | 0.6132 |
| 3. BF | Q8UCM5 | Hemin import ATP-binding protein HmuV | 2.09e-02 | NA | 0.026 | 0.5621 |
| 3. BF | Q56993 | Hemin import ATP-binding protein HmuV | 8.58e-03 | NA | 1.93e-04 | 0.5546 |
| 3. BF | B7MV91 | Vitamin B12 import ATP-binding protein BtuD | 6.55e-03 | NA | 2.36e-04 | 0.612 |
| 3. BF | Q1RB86 | Vitamin B12 import ATP-binding protein BtuD | 6.51e-03 | NA | 2.36e-04 | 0.612 |
| 3. BF | Q7NUJ3 | Macrolide export ATP-binding/permease protein MacB | 2.61e-01 | NA | 0.001 | 0.3962 |
| 3. BF | O84337 | UvrABC system protein A | 0.00e+00 | NA | 5.17e-166 | 0.7388 |
| 3. BF | Q8PM59 | Phosphate import ATP-binding protein PstB | 1.71e-02 | NA | 0.046 | 0.5976 |
| 3. BF | P97998 | ATP-dependent permease MDL1 | 2.49e-01 | NA | 9.17e-06 | 0.314 |
| 3. BF | B7L6I2 | Vitamin B12 import ATP-binding protein BtuD | 6.57e-03 | NA | 2.18e-04 | 0.6179 |
| 3. BF | B1LE21 | Vitamin B12 import ATP-binding protein BtuD | 6.59e-03 | NA | 2.18e-04 | 0.618 |
| 3. BF | Q1C138 | Autoinducer 2 import ATP-binding protein LsrA | 1.12e-02 | NA | 0.041 | 0.3977 |
| 3. BF | Q9KXJ6 | Putative ABC transporter ATP-binding protein SCO2324 | 8.25e-05 | NA | 2.19e-06 | 0.4723 |
| 3. BF | Q1AVD3 | Ribose import ATP-binding protein RbsA 2 | 9.14e-04 | NA | 0.011 | 0.4473 |
| 3. BF | P63351 | Vitamin B12 import ATP-binding protein BtuD | 4.87e-03 | NA | 7.39e-05 | 0.6796 |
| 3. BF | Q8ZDX6 | Vitamin B12 import ATP-binding protein BtuD | 7.54e-03 | NA | 0.004 | 0.6086 |
| 3. BF | Q5HAV5 | Phosphate import ATP-binding protein PstB | 1.08e-02 | NA | 0.008 | 0.5629 |
| 3. BF | B7M1B8 | Vitamin B12 import ATP-binding protein BtuD | 6.97e-03 | NA | 2.18e-04 | 0.6091 |
| 3. BF | Q5PH81 | Vitamin B12 import ATP-binding protein BtuD | 1.74e-02 | NA | 7.39e-05 | 0.6593 |
| 3. BF | Q31DV4 | Phosphonates import ATP-binding protein PhnC | 2.85e-02 | NA | 0.009 | 0.5418 |
| 3. BF | P25735 | UvrABC system protein A (Fragment) | 1.11e-03 | NA | 4.94e-29 | 0.9554 |
| 3. BF | Q5N1G5 | Phosphate import ATP-binding protein PstB | 3.02e-02 | NA | 0.026 | 0.5735 |
| 3. BF | Q9PK60 | UvrABC system protein A | 7.66e-15 | NA | 1.33e-159 | 0.7486 |
| 3. BF | B1JLQ0 | Autoinducer 2 import ATP-binding protein LsrA | 1.30e-02 | NA | 0.021 | 0.4209 |
| 3. BF | Q1CN15 | Autoinducer 2 import ATP-binding protein LsrA | 5.86e-03 | NA | 0.041 | 0.4202 |
| 3. BF | Q87C88 | Phosphate import ATP-binding protein PstB | 2.85e-02 | NA | 0.023 | 0.549 |
| 3. BF | Q32FJ0 | Vitamin B12 import ATP-binding protein BtuD | 6.54e-03 | NA | 2.18e-04 | 0.6179 |
| 3. BF | B7MAS0 | Vitamin B12 import ATP-binding protein BtuD | 6.61e-03 | NA | 2.36e-04 | 0.6119 |
| 4. PB | A0A0H2VFI8 | Energy-dependent translational throttle protein EttA | 2.87e-03 | 1.28e-02 | 9.59e-05 | NA |
| 4. PB | P9WQK2 | Energy-dependent translational throttle protein EttA | 1.62e-03 | 9.27e-03 | 0.015 | NA |
| 4. PB | P0A9W5 | Energy-dependent translational throttle protein EttA | 2.16e-03 | 1.52e-02 | 9.59e-05 | NA |
| 4. PB | P9WQK7 | UvrABC system protein A | 0.00e+00 | 1.40e-74 | 0.0 | NA |
| 4. PB | P9WQK3 | Energy-dependent translational throttle protein EttA | 9.71e-04 | 9.27e-03 | 0.015 | NA |
| 4. PB | P0A9W4 | Energy-dependent translational throttle protein EttA | 2.27e-03 | 1.52e-02 | 9.59e-05 | NA |
| 4. PB | P0A9W3 | Energy-dependent translational throttle protein EttA | 2.04e-03 | 1.52e-02 | 9.59e-05 | NA |
| 4. PB | P0A698 | UvrABC system protein A | 0.00e+00 | 2.79e-78 | 0.0 | NA |
| 4. PB | P45127 | Energy-dependent translational throttle protein EttA | 4.01e-03 | 2.33e-02 | 2.23e-04 | NA |
| 5. P | P9WQI6 | Uncharacterized ABC transporter ATP-binding protein MT2388 | 7.60e-03 | 2.93e-02 | NA | NA |
| 5. P | P9WQI7 | Uncharacterized ABC transporter ATP-binding protein Rv2326c | 2.59e-02 | 2.93e-02 | NA | NA |
| 5. P | O31716 | Uncharacterized ABC transporter ATP-binding protein YkpA | 1.28e-02 | 2.69e-02 | NA | NA |
| 5. P | P63400 | Uncharacterized ABC transporter ATP-binding protein Mb2353c | 1.66e-02 | 2.93e-02 | NA | NA |
| 6. F | Q927Z7 | Phosphate import ATP-binding protein PstB 2 | 1.80e-02 | NA | NA | 0.5025 |
| 6. F | Q1GAD3 | Phosphate import ATP-binding protein PstB | 1.53e-02 | NA | NA | 0.5589 |
| 6. F | Q9AML4 | Phosphate import ATP-binding protein PstB | 2.11e-02 | NA | NA | 0.5668 |
| 6. F | F2SG60 | ABC multidrug transporter MDR3 | 9.31e-02 | NA | NA | 0.2674 |
| 6. F | O51236 | Phosphate import ATP-binding protein PstB | 2.55e-02 | NA | NA | 0.5915 |
| 6. F | Q68XI5 | DNA repair protein RecN | 2.90e-02 | NA | NA | 0.2884 |
| 6. F | Q3BV68 | Phosphate import ATP-binding protein PstB | 2.42e-02 | NA | NA | 0.5686 |
| 6. F | Q2FTF8 | Phosphate import ATP-binding protein PstB | 2.10e-02 | NA | NA | 0.5508 |
| 6. F | Q8XAW7 | Ribose import ATP-binding protein RbsA 1 | 4.97e-04 | NA | NA | 0.414 |
| 6. F | Q168E3 | Lipoprotein-releasing system ATP-binding protein LolD | 3.37e-02 | NA | NA | 0.5459 |
| 6. F | B1XEA1 | Autoinducer 2 import ATP-binding protein LsrA | 6.36e-03 | NA | NA | 0.418 |
| 6. F | Q73GK9 | Zinc import ATP-binding protein ZnuC | 1.90e-02 | NA | NA | 0.6067 |
| 6. F | Q8E9I8 | Phosphate import ATP-binding protein PstB 2 | 1.04e-02 | NA | NA | 0.5864 |
| 6. F | Q64SM5 | Phosphate import ATP-binding protein PstB | 1.40e-02 | NA | NA | 0.5721 |
| 6. F | Q6FZX3 | Lipoprotein-releasing system ATP-binding protein LolD | 2.28e-02 | NA | NA | 0.5483 |
| 6. F | Q8RHK9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.53e-03 | NA | NA | 0.5817 |
| 6. F | Q49588 | Phosphate import ATP-binding protein PstB | 1.50e-02 | NA | NA | 0.5771 |
| 6. F | P63366 | Phosphate import ATP-binding protein PstB | 2.04e-02 | NA | NA | 0.5867 |
| 6. F | A9MZG1 | Autoinducer 2 import ATP-binding protein LsrA | 1.15e-03 | NA | NA | 0.4345 |
| 6. F | P0AAH3 | Phosphate import ATP-binding protein PstB | 1.84e-02 | NA | NA | 0.6027 |
| 6. F | Q834B4 | Phosphate import ATP-binding protein PstB 1 | 1.59e-02 | NA | NA | 0.574 |
| 6. F | Q9YG51 | Phosphate import ATP-binding protein PstB | 1.95e-02 | NA | NA | 0.5801 |
| 6. F | P25256 | Tylosin resistance ATP-binding protein TlrC | 7.19e-04 | NA | NA | 0.3525 |
| 6. F | Q8R9I2 | Phosphate import ATP-binding protein PstB 2 | 9.82e-03 | NA | NA | 0.5616 |
| 6. F | Q87Q38 | Vitamin B12 import ATP-binding protein BtuD | 8.25e-03 | NA | NA | 0.5458 |
| 6. F | P63370 | Phosphate import ATP-binding protein PstB 2 | 8.81e-03 | NA | NA | 0.5291 |
| 6. F | Q8REE1 | Galactose/methyl galactoside import ATP-binding protein MglA | 7.66e-04 | NA | NA | 0.4653 |
| 6. F | Q8XAY7 | Autoinducer 2 import ATP-binding protein LsrA | 3.20e-03 | NA | NA | 0.4038 |
| 6. F | Q9A6Z7 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 3.77e-02 | NA | NA | 0.5474 |
| 6. F | Q3AKM8 | Phosphonates import ATP-binding protein PhnC | 2.32e-02 | NA | NA | 0.5873 |
| 6. F | Q4A5Q4 | Spermidine/putrescine import ATP-binding protein PotA | 1.34e-01 | NA | NA | 0.4267 |
| 6. F | P0AAH2 | Phosphate import ATP-binding protein PstB | 2.07e-02 | NA | NA | 0.6031 |
| 6. F | Q87UH7 | Taurine import ATP-binding protein TauB | 4.21e-02 | NA | NA | 0.539 |
| 6. F | Q0T4L9 | Autoinducer 2 import ATP-binding protein LsrA | 3.44e-03 | NA | NA | 0.4176 |
| 6. F | Q5V225 | Phosphate import ATP-binding protein PstB 1 | 2.86e-02 | NA | NA | 0.4772 |
| 6. F | Q634R8 | Phosphate import ATP-binding protein PstB | 2.20e-02 | NA | NA | 0.5155 |
| 6. F | Q7U6R4 | Phosphate import ATP-binding protein PstB | 3.87e-02 | NA | NA | 0.5848 |
| 6. F | Q6FCW7 | Phosphate import ATP-binding protein PstB | 1.07e-02 | NA | NA | 0.5008 |
| 6. F | Q31UX2 | Phosphate import ATP-binding protein PstB | 2.13e-02 | NA | NA | 0.5841 |
| 6. F | Q4ZLA7 | Phosphate import ATP-binding protein PstB 2 | 1.05e-02 | NA | NA | 0.5423 |
| 6. F | Q2YNH6 | Lipoprotein-releasing system ATP-binding protein LolD | 4.06e-02 | NA | NA | 0.5792 |
| 6. F | Q5E0B3 | Lipoprotein-releasing system ATP-binding protein LolD | 2.01e-02 | NA | NA | 0.5396 |
| 6. F | Q1MAL7 | Cytochrome c biogenesis ATP-binding export protein CcmA | 7.07e-02 | NA | NA | 0.5574 |
| 6. F | Q9CF44 | Ribose import ATP-binding protein RbsA | 2.28e-03 | NA | NA | 0.4451 |
| 6. F | Q1LFZ8 | Cytochrome c biogenesis ATP-binding export protein CcmA 2 | 2.67e-02 | NA | NA | 0.5794 |
| 6. F | Q329R2 | Phosphate import ATP-binding protein PstB | 1.52e-02 | NA | NA | 0.5903 |
| 6. F | Q5LBQ4 | Phosphate import ATP-binding protein PstB | 1.42e-02 | NA | NA | 0.5764 |
| 6. F | Q31J97 | Hemin import ATP-binding protein HmuV | 3.70e-02 | NA | NA | 0.545 |
| 6. F | P0C886 | Autoinducer 2 import ATP-binding protein LsrA | 1.11e-03 | NA | NA | 0.4172 |
| 6. F | Q664G2 | Ribose import ATP-binding protein RbsA | 1.11e-03 | NA | NA | 0.4117 |
| 6. F | Q8GDV4 | Phosphate import ATP-binding protein PstB (Fragment) | 1.38e-02 | NA | NA | 0.5494 |
| 6. F | Q3YVL7 | Phosphate import ATP-binding protein PstB | 2.05e-02 | NA | NA | 0.5862 |
| 6. F | Q51546 | Phosphate import ATP-binding protein PstB | 1.33e-02 | NA | NA | 0.5311 |
| 6. F | Q5LS19 | Phosphate import ATP-binding protein PstB | 9.36e-03 | NA | NA | 0.5644 |
| 6. F | Q28M30 | Lipoprotein-releasing system ATP-binding protein LolD | 4.62e-02 | NA | NA | 0.5547 |
| 6. F | P0DJA1 | Lipoprotein-releasing system ATP-binding protein LolD | 3.99e-02 | NA | NA | 0.5537 |
| 6. F | Q55196 | Phosphate import ATP-binding protein PstB 1 | 4.85e-02 | NA | NA | 0.512 |
| 6. F | Q8UAK2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 3.38e-03 | NA | NA | 0.4468 |
| 6. F | Q9CP98 | Ribose import ATP-binding protein RbsA 1 | 6.69e-04 | NA | NA | 0.39 |
| 6. F | Q1JBJ4 | Phosphate import ATP-binding protein PstB 2 | 7.95e-03 | NA | NA | 0.5121 |
| 6. F | Q3MA91 | Phosphate import ATP-binding protein PstB 3 | 3.02e-02 | NA | NA | 0.5496 |
| 6. F | Q3YVK8 | Ribose import ATP-binding protein RbsA | 5.46e-04 | NA | NA | 0.3971 |
| 6. F | A8A066 | Autoinducer 2 import ATP-binding protein LsrA | 5.31e-03 | NA | NA | 0.3909 |
| 6. F | Q0TKS1 | Taurine import ATP-binding protein TauB | 4.18e-02 | NA | NA | 0.535 |
| 6. F | A0B297 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 7.01e-04 | NA | NA | 0.4274 |
| 6. F | Q4FLF6 | Phosphate import ATP-binding protein PstB | 1.19e-02 | NA | NA | 0.5847 |
| 6. F | Q4X006 | ABC multidrug transporter A-2 | 1.11e-01 | NA | NA | 0.2858 |
| 6. F | O34631 | Uncharacterized ABC transporter ATP-binding protein YvrA | 9.82e-02 | NA | NA | 0.4383 |
| 6. F | Q3K8M7 | Arabinose import ATP-binding protein AraG | 3.20e-04 | NA | NA | 0.4236 |
| 6. F | Q7MNI7 | Phosphate import ATP-binding protein PstB 1 | 2.41e-02 | NA | NA | 0.5539 |
| 6. F | Q2YL69 | Nickel import ATP-binding protein NikE | 1.77e-01 | NA | NA | 0.5754 |
| 6. F | Q1IGM2 | Taurine import ATP-binding protein TauB | 4.18e-02 | NA | NA | 0.522 |
| 6. F | Q39HA1 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 2.02e-03 | NA | NA | 0.4543 |
| 6. F | Q2JKC2 | Phosphate import ATP-binding protein PstB 2 | 4.04e-02 | NA | NA | 0.5322 |
| 6. F | Q5FT15 | Phosphate import ATP-binding protein PstB | 2.43e-02 | NA | NA | 0.5365 |
| 6. F | Q6G4T6 | Phosphate import ATP-binding protein PstB | 1.41e-02 | NA | NA | 0.5435 |
| 6. F | Q9PAP0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.11e-01 | NA | NA | 0.4963 |
| 6. F | Q83L12 | Autoinducer 2 import ATP-binding protein LsrA | 2.96e-03 | NA | NA | 0.422 |
| 6. F | Q2KCV5 | Phosphate import ATP-binding protein PstB | 1.10e-02 | NA | NA | 0.5405 |
| 6. F | Q1MIN0 | Phosphate import ATP-binding protein PstB 2 | 2.70e-02 | NA | NA | 0.5584 |
| 6. F | Q48BP8 | Phosphate import ATP-binding protein PstB 2 | 1.01e-02 | NA | NA | 0.5082 |
| 6. F | Q215F6 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 6.38e-02 | NA | NA | 0.5695 |
| 6. F | Q8FBS3 | Ribose import ATP-binding protein RbsA | 4.50e-04 | NA | NA | 0.4067 |
| 6. F | Q4QK92 | Phosphate import ATP-binding protein PstB | 1.82e-02 | NA | NA | 0.5483 |
| 6. F | P42064 | Oligopeptide transport ATP-binding protein AppD | 7.66e-02 | NA | NA | 0.4764 |
| 6. F | Q6D2D5 | Phosphate import ATP-binding protein PstB 1 | 2.27e-02 | NA | NA | 0.5471 |
| 6. F | Q8FMN9 | Phosphate import ATP-binding protein PstB | 4.41e-02 | NA | NA | 0.5502 |
| 6. F | Q5SLN1 | Phosphate import ATP-binding protein PstB | 1.84e-02 | NA | NA | 0.5565 |
| 6. F | Q1MAA2 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 2.78e-03 | NA | NA | 0.44 |
| 6. F | Q4UT63 | Phosphate import ATP-binding protein PstB | 1.67e-02 | NA | NA | 0.5835 |
| 6. F | Q5PJX5 | Ribose import ATP-binding protein RbsA | 4.64e-04 | NA | NA | 0.4079 |
| 6. F | Q8U3E0 | Putative ABC transporter ATP-binding protein PF0528 | 1.02e-02 | NA | NA | 0.5677 |
| 6. F | Q75EV6 | Elongation factor 3 | 6.96e-02 | NA | NA | 0.4481 |
| 6. F | Q2YNU0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 6.37e-02 | NA | NA | 0.5858 |
| 6. F | Q3IS07 | Phosphate import ATP-binding protein PstB 1 | 9.66e-03 | NA | NA | 0.5333 |
| 6. F | Q51719 | Putative ABC transporter ATP-binding protein in cobA 5'region | 1.17e-02 | NA | NA | 0.5145 |
| 6. F | Q1GZH6 | Lipoprotein-releasing system ATP-binding protein LolD | 3.69e-02 | NA | NA | 0.5655 |
| 6. F | Q21TG3 | Lipoprotein-releasing system ATP-binding protein LolD | 3.01e-02 | NA | NA | 0.5478 |
| 6. F | Q2P2Y5 | Phosphate import ATP-binding protein PstB | 2.60e-02 | NA | NA | 0.5935 |
| 6. F | Q0TAW0 | Ribose import ATP-binding protein RbsA | 4.84e-04 | NA | NA | 0.4021 |
| 6. F | Q0SNU4 | Phosphate import ATP-binding protein PstB | 1.25e-02 | NA | NA | 0.5721 |
| 6. F | Q1AXG5 | Ribose import ATP-binding protein RbsA 1 | 6.31e-04 | NA | NA | 0.4096 |
| 6. F | Q92TS8 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 4.08e-03 | NA | NA | 0.4498 |
| 6. F | Q3SVB5 | Phosphate import ATP-binding protein PstB | 1.70e-02 | NA | NA | 0.5285 |
| 6. F | Q2RU16 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 6.44e-02 | NA | NA | 0.5724 |
| 6. F | Q7CG00 | Ribose import ATP-binding protein RbsA | 1.02e-03 | NA | NA | 0.4185 |
| 6. F | Q2RS21 | Nickel import ATP-binding protein NikD | 8.99e-03 | NA | NA | 0.5641 |
| 6. F | Q6G0L7 | Phosphate import ATP-binding protein PstB | 1.33e-02 | NA | NA | 0.5586 |
| 6. F | Q92W60 | Ribose import ATP-binding protein RbsA 2 | 1.11e-03 | NA | NA | 0.4454 |
| 6. F | Q4WDD4 | ABC multidrug transporter atrF | 7.29e-02 | NA | NA | 0.2711 |
| 6. F | Q0HH38 | Phosphate import ATP-binding protein PstB | 2.08e-02 | NA | NA | 0.5089 |
| 6. F | Q1R9L8 | Cytochrome c biogenesis ATP-binding export protein CcmA | 1.16e-01 | NA | NA | 0.6125 |
| 6. F | C3LLU1 | Vitamin B12 import ATP-binding protein BtuD | 8.71e-03 | NA | NA | 0.5747 |
| 6. F | Q895Y0 | Phosphate import ATP-binding protein PstB | 1.11e-02 | NA | NA | 0.5206 |
| 6. F | P63368 | Phosphate import ATP-binding protein PstB 1 | 1.24e-02 | NA | NA | 0.5343 |
| 6. F | C5BKM1 | DNA replication and repair protein RecF | 4.81e-01 | NA | NA | 0.3329 |
| 6. F | Q2YQT8 | Phosphate import ATP-binding protein PstB | 2.51e-02 | NA | NA | 0.5406 |
| 6. F | Q0B775 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 | 7.48e-04 | NA | NA | 0.3642 |
| 6. F | Q2K353 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 | 2.52e-03 | NA | NA | 0.4352 |
| 6. F | Q4WWW3 | ABC multidrug transporter atrI | 3.92e-02 | NA | NA | 0.2815 |
| 6. F | B6HV31 | ABC-type transporter adrC | 1.78e-01 | NA | NA | 0.2547 |
| 6. F | Q084V3 | Phosphate import ATP-binding protein PstB | 2.12e-02 | NA | NA | 0.5132 |
| 6. F | Q92CK1 | Putative ABC transporter ATP-binding protein lin1170 | 9.07e-03 | NA | NA | 0.5502 |
| 6. F | P63367 | Phosphate import ATP-binding protein PstB 1 | 1.12e-02 | NA | NA | 0.533 |
| 6. F | Q98EA4 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.90e-02 | NA | NA | 0.6291 |
| 6. F | Q3KJQ7 | Taurine import ATP-binding protein TauB | 3.07e-02 | NA | NA | 0.5188 |
| 6. F | Q8ZKQ4 | Autoinducer 2 import ATP-binding protein LsrA | 1.71e-03 | NA | NA | 0.4412 |
| 6. F | Q7M9G3 | Phosphate import ATP-binding protein PstB | 1.37e-02 | NA | NA | 0.5393 |
| 6. F | Q8DEW5 | Phosphate import ATP-binding protein PstB 1 | 2.41e-02 | NA | NA | 0.5492 |
| 6. F | P0A2V8 | Phosphate import ATP-binding protein PstB 3 | 2.34e-02 | NA | NA | 0.5356 |
| 6. F | Q6D664 | Lipoprotein-releasing system ATP-binding protein LolD | 2.27e-02 | NA | NA | 0.576 |
| 6. F | Q6XYT0 | Phosphate import ATP-binding protein PstB | 1.30e-02 | NA | NA | 0.5479 |
| 6. F | Q6N5P8 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 6.48e-02 | NA | NA | 0.5782 |
| 6. F | Q02XM9 | Ribose import ATP-binding protein RbsA | 2.35e-03 | NA | NA | 0.4654 |
| 6. F | P44735 | Ribose import ATP-binding protein RbsA | 6.87e-04 | NA | NA | 0.4109 |
| 6. F | Q6CYN3 | Phosphate import ATP-binding protein PstB 2 | 1.98e-02 | NA | NA | 0.5663 |
| 6. F | Q7W025 | Hemin import ATP-binding protein HmuV | 8.17e-03 | NA | NA | 0.5635 |
| 6. F | Q8DU23 | Phosphate import ATP-binding protein PstB 2 | 1.28e-02 | NA | NA | 0.5267 |
| 6. F | Q5WET7 | Phosphate import ATP-binding protein PstB 2 | 2.26e-02 | NA | NA | 0.4948 |
| 6. F | Q7V1X3 | Phosphate import ATP-binding protein PstB | 2.51e-02 | NA | NA | 0.5944 |
| 6. F | Q47L96 | Phosphate import ATP-binding protein PstB | 3.36e-02 | NA | NA | 0.5825 |
| 6. F | Q2SJ99 | Ribose import ATP-binding protein RbsA | 7.37e-04 | NA | NA | 0.3971 |
| 6. F | Q6G0V9 | Cytochrome c biogenesis ATP-binding export protein CcmA | 8.98e-02 | NA | NA | 0.5756 |
| 6. F | Q8PVF6 | Phosphate import ATP-binding protein PstB | 8.97e-03 | NA | NA | 0.5774 |
| 6. F | P71009 | Putative ABC transporter ATP-binding protein AlbC | 9.02e-03 | NA | NA | 0.553 |
| 6. F | Q3IM36 | Phosphate import ATP-binding protein PstB 3 | 2.37e-02 | NA | NA | 0.5341 |
| 6. F | Q180A5 | Phosphate import ATP-binding protein PstB | 1.28e-02 | NA | NA | 0.5477 |
| 6. F | Q1CI46 | Lipoprotein-releasing system ATP-binding protein LolD | 3.48e-02 | NA | NA | 0.5349 |
| 6. F | Q9HML8 | Phosphate import ATP-binding protein PstB 2 | 3.52e-02 | NA | NA | 0.4446 |
| 6. F | Q07733 | Oligopeptide transport ATP-binding protein OppD | 4.71e-02 | NA | NA | 0.4839 |
| 6. F | P63362 | Phosphate import ATP-binding protein PstB | 2.57e-02 | NA | NA | 0.4943 |
| 6. F | Q6DB87 | Ribose import ATP-binding protein RbsA | 5.57e-04 | NA | NA | 0.4275 |
| 6. F | Q9Z411 | Phosphate import ATP-binding protein PstB | 1.10e-02 | NA | NA | 0.538 |
| 6. F | Q5PKW4 | Phosphate import ATP-binding protein PstB | 2.05e-02 | NA | NA | 0.5862 |
| 6. F | P0A2V9 | Phosphate import ATP-binding protein PstB 3 | 2.48e-02 | NA | NA | 0.5365 |
| 6. F | Q47Y12 | Phosphate import ATP-binding protein PstB | 2.90e-02 | NA | NA | 0.5121 |
| 6. F | Q6LPK2 | Lipoprotein-releasing system ATP-binding protein LolD | 2.57e-02 | NA | NA | 0.5371 |
| 6. F | Q1C0A2 | Phosphate import ATP-binding protein PstB 2 | 1.69e-02 | NA | NA | 0.5831 |
| 6. F | Q5H002 | Phosphate import ATP-binding protein PstB | 1.63e-02 | NA | NA | 0.5991 |
| 6. F | Q53194 | Probable peptide ABC transporter ATP-binding protein y4tS | 1.55e-01 | NA | NA | 0.4572 |
| 6. F | Q5W274 | Pleiotropic drug resistance protein 3 | 2.00e-01 | NA | NA | 0.2972 |
| 6. F | A0A1Y0BRF0 | ABC-type transporter adrC | 2.62e-01 | NA | NA | 0.2531 |
| 6. F | B1IRU7 | Autoinducer 2 import ATP-binding protein LsrA | 1.50e-03 | NA | NA | 0.3941 |
| 6. F | Q6MD10 | Lipoprotein-releasing system ATP-binding protein LolD | 3.11e-02 | NA | NA | 0.5849 |
| 6. F | Q4ZRC6 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 7.85e-04 | NA | NA | 0.4304 |
| 6. F | Q4K3K9 | Phosphate import ATP-binding protein PstB | 1.11e-02 | NA | NA | 0.5678 |
| 6. F | Q8NMK1 | Phosphate import ATP-binding protein PstB | 4.75e-02 | NA | NA | 0.5728 |
| 6. F | Q4WDV4 | ABC multidrug transporter F | 1.07e-01 | NA | NA | 0.2905 |
| 6. F | Q9RYZ3 | Phosphate import ATP-binding protein PstB | 1.50e-02 | NA | NA | 0.5886 |
| 6. F | Q3K4F5 | Phosphate import ATP-binding protein PstB | 1.10e-02 | NA | NA | 0.5514 |
| 6. F | Q48C94 | Taurine import ATP-binding protein TauB | 4.68e-02 | NA | NA | 0.5519 |
| 6. F | Q8U949 | Ribose import ATP-binding protein RbsA 2 | 1.05e-03 | NA | NA | 0.4604 |
| 6. F | Q8D3X4 | Phosphate import ATP-binding protein PstB 2 | 9.84e-03 | NA | NA | 0.5537 |
| 6. F | Q0VR80 | Cytochrome c biogenesis ATP-binding export protein CcmA | 4.04e-02 | NA | NA | 0.6473 |
| 6. F | P45289 | Peptide transport system ATP-binding protein SapF | 1.08e-02 | NA | NA | 0.5791 |
| 6. F | P0CZ39 | Phosphate import ATP-binding protein PstB 2 | 8.11e-03 | NA | NA | 0.512 |
| 6. F | Q87U31 | Phosphate import ATP-binding protein PstB 2 | 1.03e-02 | NA | NA | 0.5284 |
| 6. F | Q28P50 | Ribose import ATP-binding protein RbsA | 7.84e-04 | NA | NA | 0.4183 |
| 6. F | P0A2U9 | Oligopeptide transport ATP-binding protein AmiE | 6.01e-02 | NA | NA | 0.4581 |
| 6. F | Q88C57 | Phosphate import ATP-binding protein PstB 2 | 1.11e-02 | NA | NA | 0.5306 |
| 6. F | Q1M360 | Ribose import ATP-binding protein RbsA 3 | 1.67e-03 | NA | NA | 0.4716 |
| 6. F | Q399X3 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 6.66e-04 | NA | NA | 0.4409 |
| 6. F | Q92SA1 | Phosphate import ATP-binding protein PstB | 1.20e-02 | NA | NA | 0.5143 |
| 6. F | Q31I88 | Phosphate import ATP-binding protein PstB | 1.11e-02 | NA | NA | 0.5644 |
| 6. F | Q4UMZ7 | Lipoprotein-releasing system ATP-binding protein LolD | 3.41e-02 | NA | NA | 0.5519 |
| 6. F | Q8Z2X5 | Autoinducer 2 import ATP-binding protein LsrA | 1.20e-03 | NA | NA | 0.4046 |
| 6. F | Q02V78 | DNA replication and repair protein RecF | 3.15e-01 | NA | NA | 0.343 |
| 6. F | Q92GP5 | Lipoprotein-releasing system ATP-binding protein LolD | 4.04e-02 | NA | NA | 0.5287 |
| 6. F | Q65HB9 | Phosphate import ATP-binding protein PstB 2 | 2.31e-02 | NA | NA | 0.5335 |
| 6. F | Q6MMH0 | Phosphate import ATP-binding protein PstB | 2.49e-02 | NA | NA | 0.5649 |
| 6. F | Q8Y003 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 2.09e-03 | NA | NA | 0.4301 |
| 6. F | A1JJ55 | Autoinducer 2 import ATP-binding protein LsrA | 2.26e-02 | NA | NA | 0.4053 |
| 6. F | Q1R4I3 | Ribose import ATP-binding protein RbsA | 4.80e-04 | NA | NA | 0.4145 |
| 6. F | Q83HT1 | Phosphate import ATP-binding protein PstB | 2.39e-02 | NA | NA | 0.5939 |
| 6. F | Q3YW48 | Nickel import ATP-binding protein NikE | 4.16e-02 | NA | NA | 0.3834 |
| 6. F | Q87ZE0 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 6.73e-04 | NA | NA | 0.4092 |
| 6. F | P9WEU3 | ABC multidrug transporter AFR2 | 1.00e-01 | NA | NA | 0.2638 |
| 6. F | Q4UJW5 | Zinc import ATP-binding protein ZnuC | 8.11e-02 | NA | NA | 0.6465 |
| 6. F | Q9HS13 | Phosphate import ATP-binding protein PstB 1 | 2.65e-02 | NA | NA | 0.4993 |
| 6. F | Q3J376 | Phosphate import ATP-binding protein PstB | 3.56e-02 | NA | NA | 0.5308 |
| 6. F | Q7U172 | Phosphate import ATP-binding protein PstB 1 | 4.51e-02 | NA | NA | 0.5886 |
| 6. F | Q0I3C2 | Lipoprotein-releasing system ATP-binding protein LolD | 2.84e-02 | NA | NA | 0.553 |
| 6. F | Q4WFQ4 | ABC multidrug transporter H | 6.57e-02 | NA | NA | 0.276 |
| 6. F | Q11CZ6 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.90e-02 | NA | NA | 0.569 |
| 6. F | P0AAH1 | Phosphate import ATP-binding protein PstB | 1.43e-02 | NA | NA | 0.5765 |
| 6. F | Q7N9U4 | Phosphate import ATP-binding protein PstB | 1.84e-02 | NA | NA | 0.5693 |
| 6. F | Q0TAY4 | Phosphate import ATP-binding protein PstB | 1.74e-02 | NA | NA | 0.5865 |
| 6. F | B1LFA2 | Autoinducer 2 import ATP-binding protein LsrA | 6.11e-03 | NA | NA | 0.3872 |
| 6. F | A0B1M7 | Ribose import ATP-binding protein RbsA 2 | 8.77e-04 | NA | NA | 0.4138 |
| 6. F | Q39HM4 | Phosphate import ATP-binding protein PstB | 2.80e-02 | NA | NA | 0.521 |
| 6. F | Q31BF6 | Phosphate import ATP-binding protein PstB | 4.38e-02 | NA | NA | 0.5873 |
| 6. F | Q1MCZ1 | Hemin import ATP-binding protein HmuV | 2.13e-02 | NA | NA | 0.54 |
| 6. F | A4WER4 | Autoinducer 2 import ATP-binding protein LsrA | 3.31e-03 | NA | NA | 0.4151 |
| 6. F | Q8ZKV9 | Ribose import ATP-binding protein RbsA | 5.03e-04 | NA | NA | 0.4112 |
| 6. F | Q1GHE5 | Ribose import ATP-binding protein RbsA | 2.80e-03 | NA | NA | 0.4643 |
| 6. F | Q9CP24 | Zinc import ATP-binding protein ZnuC | 5.07e-03 | NA | NA | 0.5933 |
| 6. F | Q2JMJ0 | Phosphate import ATP-binding protein PstB 1 | 2.56e-02 | NA | NA | 0.5653 |
| 6. F | Q2W7J9 | Phosphate import ATP-binding protein PstB 2 | 1.85e-02 | NA | NA | 0.5813 |
| 6. F | Q57AC2 | Phosphate import ATP-binding protein PstB | 2.63e-02 | NA | NA | 0.514 |
| 6. F | Q62J04 | Lipoprotein-releasing system ATP-binding protein LolD | 5.22e-02 | NA | NA | 0.5409 |
| 6. F | Q166A0 | Phosphate import ATP-binding protein PstB | 7.89e-03 | NA | NA | 0.5625 |
| 6. F | Q2W8B4 | Phosphate import ATP-binding protein PstB 1 | 1.34e-02 | NA | NA | 0.6027 |
| 6. F | Q3IZT1 | Lipoprotein-releasing system ATP-binding protein LolD | 3.00e-02 | NA | NA | 0.5763 |
| 6. F | Q0IAC3 | Phosphate import ATP-binding protein PstB | 4.94e-02 | NA | NA | 0.5495 |
| 6. F | Q9XBG1 | Phosphate import ATP-binding protein PstB | 3.61e-02 | NA | NA | 0.5632 |
| 6. F | P63361 | Phosphate import ATP-binding protein PstB | 2.24e-02 | NA | NA | 0.4943 |
| 6. F | Q87R20 | Lipoprotein-releasing system ATP-binding protein LolD | 4.22e-02 | NA | NA | 0.5425 |
| 6. F | Q97JB8 | Putative ABC transporter ATP-binding protein CA_C1368 | 3.74e-02 | NA | NA | 0.5529 |
| 6. F | Q5E4D8 | Phosphate import ATP-binding protein PstB 1 | 9.19e-03 | NA | NA | 0.5384 |
| 6. F | Q8KZR4 | Taurine import ATP-binding protein TauB | 2.71e-02 | NA | NA | 0.5358 |
| 6. F | Q8UA86 | Ribose import ATP-binding protein RbsA 1 | 1.08e-03 | NA | NA | 0.3767 |
| 6. F | Q8E3S6 | Putative ABC transporter ATP-binding protein gbs1680 | 3.56e-04 | NA | NA | 0.4667 |
| 6. F | Q8A853 | Phosphate import ATP-binding protein PstB | 1.82e-02 | NA | NA | 0.5663 |
| 6. F | Q8UI76 | Phosphate import ATP-binding protein PstB | 2.41e-02 | NA | NA | 0.5253 |
| 6. F | Q7MFE8 | Phosphate import ATP-binding protein PstB 2 | 2.03e-02 | NA | NA | 0.5339 |
| 6. F | Q8Z2R4 | Ribose import ATP-binding protein RbsA | 4.81e-04 | NA | NA | 0.4126 |
| 6. F | P46341 | Phosphate import ATP-binding protein PstB 2 | 3.90e-02 | NA | NA | 0.5528 |
| 6. F | Q3J7S3 | Lipoprotein-releasing system ATP-binding protein LolD | 3.14e-02 | NA | NA | 0.5515 |
| 6. F | Q30YR3 | Phosphate import ATP-binding protein PstB | 1.39e-02 | NA | NA | 0.6012 |
| 6. F | Q7NA79 | Ribose import ATP-binding protein RbsA | 4.24e-04 | NA | NA | 0.4197 |
| 6. F | A0A1V1GB10 | ABC-type transporter oblD | 1.00e-01 | NA | NA | 0.2727 |
| 6. F | Q73L25 | Lipoprotein-releasing system ATP-binding protein LolD | 1.77e-02 | NA | NA | 0.5931 |
| 6. F | Q2FH51 | Phosphate import ATP-binding protein PstB | 2.68e-02 | NA | NA | 0.5076 |
| 6. F | P94366 | ATP-binding/permease protein CydC | 2.24e-01 | NA | NA | 0.3167 |
| 6. F | Q8PAG0 | Phosphate import ATP-binding protein PstB | 1.72e-02 | NA | NA | 0.5544 |
| 6. F | Q8ELT4 | Phosphate import ATP-binding protein PstB | 2.10e-02 | NA | NA | 0.5184 |
| 6. F | O28881 | Probable branched-chain amino acid transport ATP-binding protein LivG | 5.52e-03 | NA | NA | 0.6149 |
| 6. F | Q2JUA1 | Phosphate import ATP-binding protein PstB 1 | 2.90e-02 | NA | NA | 0.531 |
| 6. F | Q2SNX4 | Phosphate import ATP-binding protein PstB | 1.27e-02 | NA | NA | 0.4818 |
| 6. F | Q6ADG4 | Phosphate import ATP-binding protein PstB | 3.54e-02 | NA | NA | 0.5753 |
| 6. F | Q4QN44 | Ribose import ATP-binding protein RbsA | 5.66e-04 | NA | NA | 0.4 |
| 6. F | B6RAL1 | ABC transporter patM | 4.13e-02 | NA | NA | 0.2869 |
| 6. F | P45247 | Lipoprotein-releasing system ATP-binding protein LolD | 2.79e-02 | NA | NA | 0.5756 |
| 6. F | Q57HW1 | Ribose import ATP-binding protein RbsA | 4.58e-04 | NA | NA | 0.4094 |
| 6. F | Q3AJS9 | Phosphate import ATP-binding protein PstB | 5.20e-02 | NA | NA | 0.5778 |
| 6. F | Q82VL9 | Lipoprotein-releasing system ATP-binding protein LolD | 3.19e-02 | NA | NA | 0.5292 |
| 6. F | Q55195 | Phosphate import ATP-binding protein PstB 2 | 2.74e-02 | NA | NA | 0.5495 |
| 6. F | Q16928 | Protein white | 1.76e-01 | NA | NA | 0.359 |
| 6. F | P63369 | Phosphate import ATP-binding protein PstB 2 | 8.57e-03 | NA | NA | 0.5303 |
| 6. F | Q8RLB6 | Aliphatic sulfonates import ATP-binding protein SsuB | 4.93e-02 | NA | NA | 0.5725 |
| 6. F | P75059 | Spermidine/putrescine import ATP-binding protein PotA | 2.01e-02 | NA | NA | 0.3171 |
| 6. F | Q48GY7 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 7.52e-04 | NA | NA | 0.4169 |
| 6. F | Q57HY8 | Phosphate import ATP-binding protein PstB | 2.06e-02 | NA | NA | 0.6026 |
| 6. F | I1RL06 | ZEB2-regulated ABC transporter 1 | 4.47e-02 | NA | NA | 0.2678 |
| 6. F | Q5PJE7 | Autoinducer 2 import ATP-binding protein LsrA | 1.83e-03 | NA | NA | 0.4453 |
| 6. F | O83590 | Lipoprotein-releasing system ATP-binding protein LolD | 2.20e-02 | NA | NA | 0.5534 |
| 6. F | Q8YNJ3 | Phosphate import ATP-binding protein PstB 3 | 3.20e-02 | NA | NA | 0.553 |
| 6. F | Q57213 | Uncharacterized ABC transporter ATP-binding protein HI_1474 | 2.91e-02 | NA | NA | 0.6698 |
| 6. F | Q1MLW4 | Phosphate import ATP-binding protein PstB 1 | 1.37e-02 | NA | NA | 0.5347 |
| 6. F | Q2PBM0 | Autoinducer 2 import ATP-binding protein LsrA | 6.39e-03 | NA | NA | 0.4285 |
| 6. F | Q1QLB0 | Lipoprotein-releasing system ATP-binding protein LolD | 6.26e-02 | NA | NA | 0.5753 |
| 7. B | Q1MCN6 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 | 2.68e-02 | NA | 0.001 | NA |
| 7. B | Q9LSJ8 | ABC transporter B family member 16 | 4.73e-02 | NA | 0.007 | NA |
| 7. B | Q5NIG3 | ATP-dependent lipid A-core flippase | 1.90e-02 | NA | 0.011 | NA |
| 7. B | Q81GC1 | Spermidine/putrescine import ATP-binding protein PotA | 1.29e-02 | NA | 0.001 | NA |
| 7. B | Q6FFL0 | Zinc import ATP-binding protein ZnuC | 1.89e-02 | NA | 0.013 | NA |
| 7. B | Q07LY2 | Phosphonates import ATP-binding protein PhnC 2 | 2.48e-02 | NA | 5.38e-04 | NA |
| 7. B | A0A0H3JXA3 | Metal-staphylopine import system ATP-binding protein CntD | 2.31e-02 | NA | 0.006 | NA |
| 7. B | Q8DQY5 | Putative ABC transporter ATP-binding protein spr0430 | 3.94e-04 | NA | 0.007 | NA |
| 7. B | O66646 | Lipoprotein-releasing system ATP-binding protein LolD | 2.60e-02 | NA | 4.79e-04 | NA |
| 7. B | Q0T3U8 | Zinc import ATP-binding protein ZnuC | 5.16e-03 | NA | 0.005 | NA |
| 7. B | Q8DRS0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.61e-02 | NA | 0.002 | NA |
| 7. B | Q65TH4 | Macrolide export ATP-binding/permease protein MacB | 3.15e-01 | NA | 4.21e-04 | NA |
| 7. B | Q48P40 | ATP-dependent lipid A-core flippase | 2.48e-02 | NA | 1.52e-04 | NA |
| 7. B | O84071 | Probable metal transport system ATP-binding protein CT_068 | 8.14e-05 | NA | 0.005 | NA |
| 7. B | Q56342 | Galactose/methyl galactoside import ATP-binding protein MglA | 1.01e-03 | NA | 0.049 | NA |
| 7. B | Q2J0F4 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.64e-01 | NA | 0.047 | NA |
| 7. B | Q48HD9 | Phosphate import ATP-binding protein PstB 1 | 1.75e-02 | NA | 0.016 | NA |
| 7. B | P0A9T9 | Uncharacterized ABC transporter ATP-binding protein YbbA | 5.28e-02 | NA | 0.001 | NA |
| 7. B | Q21NS8 | ATP-dependent lipid A-core flippase | 1.96e-02 | NA | 0.008 | NA |
| 7. B | P74548 | Sulfate/thiosulfate import ATP-binding protein CysA | 7.19e-02 | NA | 0.001 | NA |
| 7. B | P10090 | Protein white | 1.88e-01 | NA | 0.033 | NA |
| 7. B | Q00449 | Multidrug resistance protein homolog 49 | 5.46e-02 | NA | 0.006 | NA |
| 7. B | Q160Y9 | Zinc import ATP-binding protein ZnuC | 3.13e-02 | NA | 0.032 | NA |
| 7. B | P54954 | Probable amino-acid import ATP-binding protein YxeO | 1.82e-02 | NA | 1.95e-08 | NA |
| 7. B | Q81HW8 | Ribose import ATP-binding protein RbsA | 2.69e-03 | NA | 0.007 | NA |
| 7. B | A3PRY1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 4.14e-02 | NA | 0.016 | NA |
| 7. B | Q3MAR5 | Spermidine/putrescine import ATP-binding protein PotA | 8.17e-02 | NA | 0.010 | NA |
| 7. B | Q02Z10 | Spermidine/putrescine import ATP-binding protein PotA | 7.81e-02 | NA | 0.001 | NA |
| 7. B | Q1RC47 | Uncharacterized ABC transporter ATP-binding protein YcjV | 3.55e-02 | NA | 0.003 | NA |
| 7. B | O59479 | Putative ABC transporter ATP-binding protein PH1815 | 2.53e-02 | NA | 1.31e-04 | NA |
| 7. B | Q8FJB1 | ATP-dependent lipid A-core flippase | 1.62e-01 | NA | 0.004 | NA |
| 7. B | Q8RQL7 | Glutamate transport ATP-binding protein GluA | 3.66e-02 | NA | 3.62e-04 | NA |
| 7. B | P55453 | Uncharacterized ABC transporter ATP-binding protein y4fO | 5.34e-02 | NA | 0.007 | NA |
| 7. B | P32721 | D-allose import ATP-binding protein AlsA | 8.61e-04 | NA | 0.031 | NA |
| 7. B | Q7N8M2 | Methionine import ATP-binding protein MetN | 5.63e-02 | NA | 0.005 | NA |
| 7. B | Q1MQ44 | Spermidine/putrescine import ATP-binding protein PotA | 4.37e-02 | NA | 4.11e-04 | NA |
| 7. B | Q7NTN6 | Ribose import ATP-binding protein RbsA | 1.06e-03 | NA | 2.77e-06 | NA |
| 7. B | Q0A4U4 | ATP-dependent lipid A-core flippase | 2.32e-02 | NA | 3.05e-08 | NA |
| 7. B | Q14JW6 | ATP-dependent lipid A-core flippase | 1.79e-02 | NA | 0.011 | NA |
| 7. B | Q8U4L3 | Putative ABC transporter ATP-binding protein PF0068 | 1.95e-02 | NA | 0.001 | NA |
| 7. B | Q729H7 | Lipoprotein-releasing system ATP-binding protein LolD | 2.43e-02 | NA | 3.57e-04 | NA |
| 7. B | P34713 | Multidrug resistance protein pgp-3 | 1.56e-02 | NA | 0.001 | NA |
| 7. B | P0A2V0 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 8.46e-02 | NA | 0.018 | NA |
| 7. B | Q0HFA0 | Molybdenum import ATP-binding protein ModC | 2.72e-02 | NA | 3.05e-04 | NA |
| 7. B | Q0C1C3 | Lipoprotein-releasing system ATP-binding protein LolD | 3.76e-02 | NA | 0.013 | NA |
| 7. B | P82451 | ATP-binding cassette sub-family C member 9 | 1.14e-01 | NA | 0.004 | NA |
| 7. B | Q5P6D5 | Macrolide export ATP-binding/permease protein MacB | 2.27e-01 | NA | 0.004 | NA |
| 7. B | Q92UV5 | Fe(3+) ions import ATP-binding protein FbpC 2 | 1.22e-01 | NA | 0.002 | NA |
| 7. B | Q4UMZ3 | Putative export ATP-binding/permease protein RF_0214 | 9.74e-03 | NA | 0.006 | NA |
| 7. B | Q5L222 | Spermidine/putrescine import ATP-binding protein PotA | 2.66e-02 | NA | 0.010 | NA |
| 7. B | Q81VQ1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.47e-02 | NA | 0.003 | NA |
| 7. B | O51587 | Spermidine/putrescine import ATP-binding protein PotA | 1.92e-02 | NA | 0.001 | NA |
| 7. B | Q8RCU0 | Phosphate import ATP-binding protein PstB 1 | 1.47e-02 | NA | 0.012 | NA |
| 7. B | O65934 | ABC transporter ATP-binding/permease protein Rv1747 | 2.19e-01 | NA | 1.15e-08 | NA |
| 7. B | Q72FW5 | Spermidine/putrescine import ATP-binding protein PotA | 4.34e-02 | NA | 1.26e-04 | NA |
| 7. B | Q8YD40 | Methionine import ATP-binding protein MetN | 7.16e-02 | NA | 0.040 | NA |
| 7. B | Q6GEL3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.00e-02 | NA | 0.035 | NA |
| 7. B | Q8FB37 | Maltose/maltodextrin import ATP-binding protein MalK | 1.71e-02 | NA | 0.015 | NA |
| 7. B | P0CZ27 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.67e-03 | NA | 0.019 | NA |
| 7. B | P18766 | Oligopeptide transport ATP-binding protein AmiF | 3.26e-02 | NA | 1.14e-04 | NA |
| 7. B | Q7NWX3 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 2.24e-02 | NA | 5.85e-06 | NA |
| 7. B | Q3KF57 | Macrolide export ATP-binding/permease protein MacB 1 | 1.99e-01 | NA | 0.004 | NA |
| 7. B | Q38UU0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.29e-02 | NA | 3.16e-06 | NA |
| 7. B | P43245 | ATP-dependent translocase ABCB1 | 1.61e-01 | NA | 2.83e-04 | NA |
| 7. B | P33310 | ATP-dependent permease MDL1, mitochondrial | 1.35e-02 | NA | 4.60e-04 | NA |
| 7. B | Q89C51 | Phosphonates import ATP-binding protein PhnC | 2.66e-02 | NA | 0.002 | NA |
| 7. B | Q48TP4 | Spermidine/putrescine import ATP-binding protein PotA | 2.47e-02 | NA | 1.17e-05 | NA |
| 7. B | Q9FHF1 | ABC transporter B family member 7 | 1.18e-01 | NA | 1.71e-04 | NA |
| 7. B | Q1GIE5 | Spermidine/putrescine import ATP-binding protein PotA | 5.06e-02 | NA | 0.036 | NA |
| 7. B | Q8DAV2 | ATP-dependent lipid A-core flippase | 1.73e-02 | NA | 2.40e-04 | NA |
| 7. B | P91660 | Probable multidrug resistance-associated protein lethal(2)03659 | 6.97e-02 | NA | 0.001 | NA |
| 7. B | Q9N0V3 | Bile salt export pump | 7.16e-02 | NA | 0.030 | NA |
| 7. B | Q8Z1U0 | Maltose/maltodextrin import ATP-binding protein MalK | 1.72e-02 | NA | 0.004 | NA |
| 7. B | Q2NSR0 | Hemin import ATP-binding protein HmuV | 3.21e-02 | NA | 0.001 | NA |
| 7. B | Q8G838 | Putative ABC transporter ATP-binding protein BL0043 | 2.18e-02 | NA | 8.75e-04 | NA |
| 7. B | Q830W6 | Spermidine/putrescine import ATP-binding protein PotA | 1.72e-02 | NA | 0.035 | NA |
| 7. B | Q88DY1 | Hemin import ATP-binding protein HmuV | 1.85e-02 | NA | 0.033 | NA |
| 7. B | O68106 | Cobalt import ATP-binding protein CbiO | 5.98e-03 | NA | 0.034 | NA |
| 7. B | Q1RE96 | Glutathione import ATP-binding protein GsiA | 2.38e-03 | NA | 0.002 | NA |
| 7. B | Q88CL2 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.97e-02 | NA | 0.001 | NA |
| 7. B | B5X0E4 | ATP-binding cassette sub-family B member 5 | 7.28e-02 | NA | 9.46e-05 | NA |
| 7. B | Q8NY21 | Methionine import ATP-binding protein MetN 1 | 7.58e-02 | NA | 2.34e-04 | NA |
| 7. B | Q63H61 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.76e-02 | NA | 0.002 | NA |
| 7. B | O14286 | Iron-sulfur clusters transporter atm1, mitochondrial | 1.41e-01 | NA | 6.64e-04 | NA |
| 7. B | Q82VK1 | Macrolide export ATP-binding/permease protein MacB | 2.17e-01 | NA | 0.001 | NA |
| 7. B | Q2JTU3 | Phosphate import ATP-binding protein PstB 2 | 3.77e-02 | NA | 0.032 | NA |
| 7. B | Q601T6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.29e-02 | NA | 0.003 | NA |
| 7. B | Q927N8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.08e-02 | NA | 0.019 | NA |
| 7. B | P96117 | Zinc transport system ATP-binding protein TroB | 7.28e-03 | NA | 2.17e-06 | NA |
| 7. B | Q1CA99 | Macrolide export ATP-binding/permease protein MacB 1 | 1.42e-01 | NA | 1.29e-04 | NA |
| 7. B | Q9I190 | Macrolide export ATP-binding/permease protein MacB | 2.19e-01 | NA | 6.26e-04 | NA |
| 7. B | Q0TPX5 | Ribose import ATP-binding protein RbsA | 1.01e-03 | NA | 7.75e-05 | NA |
| 7. B | Q3B276 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 1.62e-02 | NA | 0.001 | NA |
| 7. B | Q03EE4 | Energy-coupling factor transporter ATP-binding protein EcfA | 6.04e-03 | NA | 0.019 | NA |
| 7. B | Q142P6 | ATP-dependent lipid A-core flippase | 2.35e-02 | NA | 0.029 | NA |
| 7. B | K3VYH8 | ABC transporter FPSE_09185 | 7.90e-02 | NA | 0.001 | NA |
| 7. B | Q98QH4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.01e-02 | NA | 7.57e-04 | NA |
| 7. B | Q8DUF7 | Spermidine/putrescine import ATP-binding protein PotA | 8.85e-02 | NA | 1.30e-06 | NA |
| 7. B | Q2NSZ1 | Macrolide export ATP-binding/permease protein MacB | 2.32e-01 | NA | 0.014 | NA |
| 7. B | Q50293 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.11e-02 | NA | 1.21e-04 | NA |
| 7. B | Q1I7I9 | Macrolide export ATP-binding/permease protein MacB 2 | 1.95e-01 | NA | 0.012 | NA |
| 7. B | Q67SV5 | Methionine import ATP-binding protein MetN | 5.14e-02 | NA | 8.56e-04 | NA |
| 7. B | Q5WJP0 | Methionine import ATP-binding protein MetN 2 | 4.98e-02 | NA | 0.019 | NA |
| 7. B | Q8XED0 | Macrolide export ATP-binding/permease protein MacB | 1.22e-01 | NA | 3.13e-04 | NA |
| 7. B | Q71WH7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.50e-02 | NA | 0.010 | NA |
| 7. B | Q9KUI0 | Sulfate/thiosulfate import ATP-binding protein CysA | 6.62e-02 | NA | 2.50e-05 | NA |
| 7. B | Q1J6Q6 | Spermidine/putrescine import ATP-binding protein PotA | 2.56e-01 | NA | 8.89e-06 | NA |
| 7. B | P63353 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.27e-02 | NA | 0.006 | NA |
| 7. B | Q7ANN4 | Type I secretion system ATP-binding protein PrsD | 1.55e-01 | NA | 0.030 | NA |
| 7. B | F2Q5G0 | ABC multidrug transporter MDR2 | 1.30e-01 | NA | 0.002 | NA |
| 7. B | O85818 | Spermidine/putrescine import ATP-binding protein PotA | 3.74e-02 | NA | 0.004 | NA |
| 7. B | Q0HYN8 | Molybdenum import ATP-binding protein ModC | 2.51e-02 | NA | 1.95e-04 | NA |
| 7. B | Q2ISN3 | Phosphonates import ATP-binding protein PhnC 2 | 2.63e-02 | NA | 5.60e-04 | NA |
| 7. B | Q2JB14 | Phosphonates import ATP-binding protein PhnC | 1.87e-04 | NA | 0.001 | NA |
| 7. B | P44692 | Zinc import ATP-binding protein ZnuC | 6.99e-03 | NA | 0.036 | NA |
| 7. B | Q4KES7 | Macrolide export ATP-binding/permease protein MacB 1 | 4.04e-01 | NA | 6.30e-05 | NA |
| 7. B | O34677 | Glutamine transport ATP-binding protein GlnQ | 4.99e-02 | NA | 0.001 | NA |
| 7. B | Q722B1 | Spermidine/putrescine import ATP-binding protein PotA | 3.60e-02 | NA | 0.009 | NA |
| 7. B | Q48KB2 | Macrolide export ATP-binding/permease protein MacB | 2.00e-01 | NA | 0.010 | NA |
| 7. B | Q6D201 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.92e-02 | NA | 0.003 | NA |
| 7. B | Q7N6C6 | ATP-dependent lipid A-core flippase | 3.25e-02 | NA | 0.016 | NA |
| 7. B | P44662 | Probable iron transport system ATP-binding protein HI_0361 | 1.61e-02 | NA | 0.003 | NA |
| 7. B | Q5X9B6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.71e-03 | NA | 0.017 | NA |
| 7. B | Q9NP78 | ABC-type oligopeptide transporter ABCB9 | 1.96e-02 | NA | 0.029 | NA |
| 7. B | P63359 | ATP-dependent lipid A-core flippase | 3.27e-02 | NA | 0.008 | NA |
| 7. B | Q2J3T0 | Hemin import ATP-binding protein HmuV | 1.44e-02 | NA | 6.12e-04 | NA |
| 7. B | Q67RG2 | Phosphate import ATP-binding protein PstB 1 | 1.77e-02 | NA | 0.006 | NA |
| 7. B | Q00748 | Multidrug resistance protein homolog 65 | 9.91e-02 | NA | 0.013 | NA |
| 7. B | Q035B2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.37e-02 | NA | 0.001 | NA |
| 7. B | Q30V33 | Spermidine/putrescine import ATP-binding protein PotA | 2.40e-02 | NA | 0.004 | NA |
| 7. B | Q2FJI0 | Methionine import ATP-binding protein MetN 1 | 9.04e-02 | NA | 0.001 | NA |
| 7. B | Q8ZR89 | Methionine import ATP-binding protein MetN 2 | 4.57e-02 | NA | 0.003 | NA |
| 7. B | Q5R9Z5 | ATP-binding cassette sub-family F member 3 | 1.03e-02 | NA | 0.003 | NA |
| 7. B | P9WQK4 | Uncharacterized ABC transporter ATP-binding protein MT0079 | 2.75e-01 | NA | 0.020 | NA |
| 7. B | P9WQK0 | Uncharacterized ABC transporter ATP-binding protein MT1014 | 2.03e-02 | NA | 0.018 | NA |
| 7. B | A0AGP9 | Spermidine/putrescine import ATP-binding protein PotA | 3.34e-02 | NA | 0.008 | NA |
| 7. B | Q2UPC0 | ABC transporter aclQ | 1.26e-02 | NA | 2.53e-04 | NA |
| 7. B | Q5PMK1 | Spermidine/putrescine import ATP-binding protein PotA | 3.97e-02 | NA | 0.002 | NA |
| 7. B | Q47908 | ATP-dependent lipid A-core flippase | 2.18e-02 | NA | 0.003 | NA |
| 7. B | Q5E6M2 | Zinc import ATP-binding protein ZnuC 1 | 8.87e-03 | NA | 0.002 | NA |
| 7. B | Q6LHL2 | Molybdenum import ATP-binding protein ModC | 3.28e-02 | NA | 0.010 | NA |
| 7. B | O95255 | ATP-binding cassette sub-family C member 6 | 2.73e-01 | NA | 0.042 | NA |
| 7. B | Q1J982 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.04e-02 | NA | 0.024 | NA |
| 7. B | P60752 | ATP-dependent lipid A-core flippase | 3.96e-02 | NA | 0.004 | NA |
| 7. B | Q2G2M9 | Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 | 4.46e-02 | NA | 0.041 | NA |
| 7. B | Q4WPP6 | ABC multidrug transporter mdr2 | 3.78e-02 | NA | 2.63e-07 | NA |
| 7. B | Q5HVF4 | Phosphate import ATP-binding protein PstB | 1.39e-02 | NA | 0.042 | NA |
| 7. B | Q5PGH0 | ATP-dependent lipid A-core flippase | 1.07e-01 | NA | 0.009 | NA |
| 7. B | Q323W5 | Glutathione import ATP-binding protein GsiA | 1.88e-03 | NA | 8.53e-04 | NA |
| 7. B | Q7MFC4 | Maltose/maltodextrin import ATP-binding protein MalK | 2.07e-02 | NA | 0.007 | NA |
| 7. B | Q9C7F8 | ABC transporter B family member 13 | 4.22e-02 | NA | 2.61e-04 | NA |
| 7. B | Q18AM3 | Spermidine/putrescine import ATP-binding protein PotA | 1.40e-02 | NA | 8.46e-06 | NA |
| 7. B | Q7MMN0 | Zinc import ATP-binding protein ZnuC | 1.41e-02 | NA | 0.002 | NA |
| 7. B | Q92AF9 | Manganese transport system ATP-binding protein MntB | 5.04e-05 | NA | 6.96e-05 | NA |
| 7. B | Q2T8T6 | Ribose import ATP-binding protein RbsA 2 | 2.18e-03 | NA | 0.008 | NA |
| 7. B | Q8Z7H7 | Spermidine/putrescine import ATP-binding protein PotA | 4.47e-02 | NA | 0.002 | NA |
| 7. B | Q6LK87 | Maltose/maltodextrin import ATP-binding protein MalK | 2.41e-02 | NA | 0.004 | NA |
| 7. B | A0RBB0 | Spermidine/putrescine import ATP-binding protein PotA | 2.00e-02 | NA | 0.001 | NA |
| 7. B | Q2RGX2 | Xylose import ATP-binding protein XylG | 4.73e-03 | NA | 0.010 | NA |
| 7. B | Q5M4F3 | Phosphate import ATP-binding protein PstB 1 | 1.82e-02 | NA | 0.008 | NA |
| 7. B | P21629 | High-affinity branched-chain amino acid transport ATP-binding protein BraF | 4.75e-03 | NA | 4.89e-06 | NA |
| 7. B | Q0SML1 | Spermidine/putrescine import ATP-binding protein PotA | 1.27e-02 | NA | 6.72e-04 | NA |
| 7. B | Q4W9C7 | ABC multidrug transporter G | 1.05e-01 | NA | 0.012 | NA |
| 7. B | O80725 | ABC transporter B family member 4 | 9.59e-02 | NA | 0.022 | NA |
| 7. B | Q50801 | Putative ABC transporter ATP-binding protein MTBMA_c05830 | 7.78e-03 | NA | 4.30e-05 | NA |
| 7. B | Q87UN0 | Zinc import ATP-binding protein ZnuC | 2.55e-02 | NA | 0.002 | NA |
| 7. B | Q5LUR8 | Zinc import ATP-binding protein ZnuC | 2.64e-02 | NA | 0.028 | NA |
| 7. B | P23878 | Ferric enterobactin transport ATP-binding protein FepC | 7.81e-05 | NA | 6.71e-04 | NA |
| 7. B | Q1RAS6 | Zinc import ATP-binding protein ZnuC | 5.25e-03 | NA | 0.001 | NA |
| 7. B | Q664X5 | Maltose/maltodextrin import ATP-binding protein MalK | 2.21e-02 | NA | 0.008 | NA |
| 7. B | Q87GB5 | Maltose/maltodextrin import ATP-binding protein MalK | 2.66e-02 | NA | 0.005 | NA |
| 7. B | Q2NUA5 | ATP-dependent lipid A-core flippase | 3.54e-02 | NA | 0.010 | NA |
| 7. B | Q2T4S8 | Arabinose import ATP-binding protein AraG 2 | 3.15e-04 | NA | 5.65e-04 | NA |
| 7. B | P75356 | Putative ABC transporter ATP-binding protein MG303 homolog | 1.74e-02 | NA | 0.001 | NA |
| 7. B | Q97X60 | Putative ABC transporter ATP-binding protein SSO1893 | 6.27e-04 | NA | 8.50e-04 | NA |
| 7. B | Q4A8A1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.85e-02 | NA | 0.003 | NA |
| 7. B | Q8LPJ4 | ABC transporter E family member 2 | 5.29e-03 | NA | 0.015 | NA |
| 7. B | P21439 | Phosphatidylcholine translocator ABCB4 | 3.28e-01 | NA | 3.16e-04 | NA |
| 7. B | O34510 | Fe(3+)-citrate import ATP-binding protein YfmF | 9.82e-05 | NA | 8.82e-05 | NA |
| 7. B | Q9JJ59 | ABC-type oligopeptide transporter ABCB9 | 2.06e-02 | NA | 0.014 | NA |
| 7. B | Q1LQD3 | ATP-dependent lipid A-core flippase | 2.67e-02 | NA | 0.020 | NA |
| 7. B | Q926D8 | Zinc uptake system ATP-binding protein ZurA | 1.59e-02 | NA | 0.030 | NA |
| 7. B | Q0TIV6 | Lipoprotein-releasing system ATP-binding protein LolD | 2.41e-02 | NA | 0.019 | NA |
| 7. B | Q138A9 | Hemin import ATP-binding protein HmuV | 2.63e-02 | NA | 1.21e-04 | NA |
| 7. B | Q1D382 | Lipoprotein-releasing system ATP-binding protein LolD | 2.39e-02 | NA | 0.010 | NA |
| 7. B | Q56953 | Chelated iron transport system membrane protein YfeB | 1.10e-02 | NA | 4.20e-05 | NA |
| 7. B | Q08D64 | ATP-binding cassette sub-family B member 6 | 1.24e-01 | NA | 0.015 | NA |
| 7. B | S0ELQ3 | ABC transporter GPY2 | 4.48e-02 | NA | 0.007 | NA |
| 7. B | Q8EAN3 | Molybdenum import ATP-binding protein ModC | 2.76e-02 | NA | 0.002 | NA |
| 7. B | Q2SPI3 | Zinc import ATP-binding protein ZnuC 1 | 2.71e-02 | NA | 0.013 | NA |
| 7. B | Q8FIM7 | Lipoprotein-releasing system ATP-binding protein LolD | 2.54e-02 | NA | 0.019 | NA |
| 7. B | Q4KBU0 | Methionine import ATP-binding protein MetN 3 | 4.73e-02 | NA | 0.005 | NA |
| 7. B | Q6Q876 | Multidrug resistance protein sirA | 2.80e-01 | NA | 2.40e-04 | NA |
| 7. B | Q1CGD7 | Macrolide export ATP-binding/permease protein MacB 2 | 2.31e-01 | NA | 1.29e-04 | NA |
| 7. B | Q57R58 | Macrolide export ATP-binding/permease protein MacB | 1.77e-01 | NA | 2.66e-04 | NA |
| 7. B | Q1I966 | Macrolide export ATP-binding/permease protein MacB 1 | 2.09e-01 | NA | 0.007 | NA |
| 7. B | Q83KR7 | Zinc import ATP-binding protein ZnuC | 5.59e-03 | NA | 0.005 | NA |
| 7. B | Q97WT4 | Putative ABC transporter ATP-binding protein SSO2030 | 5.24e-04 | NA | 1.23e-04 | NA |
| 7. B | Q5LZU3 | Phosphate import ATP-binding protein PstB 1 | 1.79e-02 | NA | 0.008 | NA |
| 7. B | Q0PAR0 | Macrolide export ATP-binding/permease protein MacB | 2.31e-01 | NA | 0.007 | NA |
| 7. B | P06795 | ATP-dependent translocase ABCB1 | 1.16e-01 | NA | 0.001 | NA |
| 7. B | Q48KI4 | Lipoprotein-releasing system ATP-binding protein LolD | 3.10e-02 | NA | 0.001 | NA |
| 7. B | Q1WSB9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.23e-02 | NA | 0.001 | NA |
| 7. B | Q82B58 | Putative ABC transporter ATP-binding protein SAV_5847 | 1.41e-03 | NA | 3.28e-06 | NA |
| 7. B | Q1JEC9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.53e-03 | NA | 0.017 | NA |
| 7. B | Q5PGK9 | Macrolide export ATP-binding/permease protein MacB | 1.69e-01 | NA | 2.71e-04 | NA |
| 7. B | Q9ZU35 | ABC transporter G family member 7 | 1.30e-01 | NA | 0.010 | NA |
| 7. B | Q6YUU5 | Putative multidrug resistance protein | 1.58e-01 | NA | 0.009 | NA |
| 7. B | Q7NTU0 | Lipoprotein-releasing system ATP-binding protein LolD | 5.36e-02 | NA | 0.026 | NA |
| 7. B | Q65UE1 | Spermidine/putrescine import ATP-binding protein PotA | 5.16e-02 | NA | 0.008 | NA |
| 7. B | P0AAG3 | Glutamate/aspartate import ATP-binding protein GltL | 2.77e-02 | NA | 0.006 | NA |
| 7. B | Q884D4 | Macrolide export ATP-binding/permease protein MacB 1 | 3.73e-01 | NA | 0.022 | NA |
| 7. B | Q5YRD1 | Methionine import ATP-binding protein MetN | 1.02e-01 | NA | 0.014 | NA |
| 7. B | P0C0E8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.70e-03 | NA | 0.024 | NA |
| 7. B | Q5LBT4 | Spermidine/putrescine import ATP-binding protein PotA | 3.25e-02 | NA | 0.048 | NA |
| 7. B | Q8DRR9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.06e-02 | NA | 0.016 | NA |
| 7. B | Q7N3Q4 | Vitamin B12 import ATP-binding protein BtuD | 2.35e-02 | NA | 1.74e-04 | NA |
| 7. B | Q1LC89 | Hemin import ATP-binding protein HmuV | 2.42e-02 | NA | 0.018 | NA |
| 7. B | Q0BZD8 | Phosphonates import ATP-binding protein PhnC | 2.41e-02 | NA | 0.019 | NA |
| 7. B | Q9RDI1 | Ribose import ATP-binding protein RbsA 2 | 6.92e-04 | NA | 4.33e-04 | NA |
| 7. B | P0A194 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 4.73e-03 | NA | 7.86e-04 | NA |
| 7. B | Q6F813 | Macrolide export ATP-binding/permease protein MacB | 1.59e-01 | NA | 3.61e-05 | NA |
| 7. B | Q881Q1 | Macrolide export ATP-binding/permease protein MacB 2 | 2.09e-01 | NA | 1.89e-05 | NA |
| 7. B | J9VWU3 | Iron-sulfur clusters transporter ATM1, mitochondrial | 4.82e-02 | NA | 0.009 | NA |
| 7. B | Q734T1 | Putative ABC transporter ATP-binding protein BCE_3323 | 3.50e-04 | NA | 3.69e-05 | NA |
| 7. B | Q58129 | Uncharacterized ABC transporter ATP-binding protein MJ0719 | 6.69e-03 | NA | 0.009 | NA |
| 7. B | A3CRB8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.87e-03 | NA | 0.036 | NA |
| 7. B | P0DKX6 | Cyclolysin secretion/processing ATP-binding protein CyaB | 2.27e-02 | NA | 0.003 | NA |
| 7. B | A0ALT7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.98e-02 | NA | 0.005 | NA |
| 7. B | A0PXX8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.78e-03 | NA | 0.017 | NA |
| 7. B | Q9FWX8 | ABC transporter B family member 12 | 6.92e-02 | NA | 0.012 | NA |
| 7. B | Q1C0Q8 | Hemin import ATP-binding protein HmuV | 2.71e-02 | NA | 1.93e-04 | NA |
| 7. B | Q2T4B3 | Macrolide export ATP-binding/permease protein MacB | 2.76e-01 | NA | 2.97e-05 | NA |
| 7. B | Q1MAB5 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 6.45e-02 | NA | 0.026 | NA |
| 7. B | Q5ZZZ7 | Spermidine/putrescine import ATP-binding protein PotA | 2.86e-02 | NA | 0.050 | NA |
| 7. B | Q2SZW0 | ATP-dependent lipid A-core flippase | 1.78e-02 | NA | 0.008 | NA |
| 7. B | Q9HUG8 | ATP-dependent lipid A-core flippase | 1.21e-01 | NA | 3.96e-04 | NA |
| 7. B | P70970 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.78e-02 | NA | 0.007 | NA |
| 7. B | Q0KDG3 | Methionine import ATP-binding protein MetN | 6.80e-02 | NA | 0.033 | NA |
| 7. B | Q87RE5 | Zinc import ATP-binding protein ZnuC | 1.43e-02 | NA | 0.017 | NA |
| 7. B | Q38UT9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.13e-02 | NA | 0.010 | NA |
| 7. B | Q0I3Y9 | Spermidine/putrescine import ATP-binding protein PotA | 6.97e-02 | NA | 0.012 | NA |
| 7. B | Q1J449 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.83e-03 | NA | 0.024 | NA |
| 7. B | Q71WT2 | Phosphate import ATP-binding protein PstB 2 | 2.38e-02 | NA | 0.049 | NA |
| 7. B | Q93SH7 | Hemin import ATP-binding protein HmuV | 2.19e-02 | NA | 1.59e-04 | NA |
| 7. B | Q0TI47 | Uncharacterized ABC transporter ATP-binding protein YcjV | 3.65e-02 | NA | 0.003 | NA |
| 7. B | Q57S53 | Methionine import ATP-binding protein MetN 2 | 4.35e-02 | NA | 0.003 | NA |
| 7. B | Q080S4 | Lipoprotein-releasing system ATP-binding protein LolD | 3.33e-02 | NA | 0.003 | NA |
| 7. B | Q81J15 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.50e-02 | NA | 0.014 | NA |
| 7. B | Q8Z5N5 | Cobalt import ATP-binding protein CbiO | 7.94e-03 | NA | 0.001 | NA |
| 7. B | P60753 | ATP-dependent lipid A-core flippase | 3.58e-02 | NA | 0.004 | NA |
| 7. B | Q09428 | ATP-binding cassette sub-family C member 8 | 5.00e-02 | NA | 0.003 | NA |
| 7. B | Q609Q1 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.77e-02 | NA | 0.006 | NA |
| 7. B | Q0BKJ3 | ATP-dependent lipid A-core flippase | 8.53e-02 | NA | 0.017 | NA |
| 7. B | Q7N6F9 | Macrolide export ATP-binding/permease protein MacB | 2.60e-01 | NA | 0.001 | NA |
| 7. B | Q7WH20 | ATP-dependent lipid A-core flippase | 6.86e-02 | NA | 1.15e-04 | NA |
| 7. B | Q9LID6 | ABC transporter E family member 1 | 1.44e-02 | NA | 0.017 | NA |
| 7. B | Q9CM47 | Macrolide export ATP-binding/permease protein MacB | 1.45e-01 | NA | 2.29e-04 | NA |
| 7. B | Q07LU3 | Hemin import ATP-binding protein HmuV | 2.43e-02 | NA | 5.10e-05 | NA |
| 7. B | P45022 | Probable amino-acid ABC transporter ATP-binding protein HI_1078 | 9.16e-02 | NA | 0.002 | NA |
| 7. B | Q6LQC0 | Hemin import ATP-binding protein HmuV | 2.08e-02 | NA | 0.021 | NA |
| 7. B | Q1JUP7 | Arabinose import ATP-binding protein AraG | 5.75e-04 | NA | 0.001 | NA |
| 7. B | P21447 | ATP-dependent translocase ABCB1 | 1.58e-01 | NA | 0.001 | NA |
| 7. B | Q8TQW9 | Putative ABC transporter ATP-binding protein MA_1418 | 7.11e-04 | NA | 5.77e-05 | NA |
| 7. B | Q0BFU0 | Ribose import ATP-binding protein RbsA 1 | 9.64e-04 | NA | 5.01e-04 | NA |
| 7. B | A1B677 | Macrolide export ATP-binding/permease protein MacB 1/2 | 1.84e-01 | NA | 0.006 | NA |
| 7. B | Q9HZL7 | Lipoprotein-releasing system ATP-binding protein LolD | 2.44e-02 | NA | 0.007 | NA |
| 7. B | Q0P9X7 | Probable ABC transporter ATP-binding protein PEB1C | 4.14e-02 | NA | 5.59e-04 | NA |
| 7. B | Q132E8 | Phosphonates import ATP-binding protein PhnC | 2.64e-02 | NA | 0.005 | NA |
| 7. B | P21448 | ATP-dependent translocase ABCB1 | 2.84e-01 | NA | 2.62e-04 | NA |
| 7. B | Q5BAY0 | ABC multidrug transporter atrD | 5.04e-02 | NA | 0.017 | NA |
| 7. B | D0MYB4 | Elongation factor 3 | 4.75e-02 | NA | 0.037 | NA |
| 7. B | P9WQK5 | Uncharacterized ABC transporter ATP-binding protein Rv0073 | 2.56e-01 | NA | 0.020 | NA |
| 7. B | Q62IG3 | ATP-dependent lipid A-core flippase | 1.52e-02 | NA | 0.006 | NA |
| 7. B | Q8T6H3 | ABC transporter C family member 6 | 6.46e-02 | NA | 0.005 | NA |
| 7. B | P47426 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.26e-02 | NA | 0.016 | NA |
| 7. B | Q8E8K8 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 3.16e-02 | NA | 0.012 | NA |
| 7. B | Q81J16 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.16e-02 | NA | 6.23e-04 | NA |
| 7. B | Q5QXD0 | Hemin import ATP-binding protein HmuV | 8.82e-03 | NA | 4.39e-04 | NA |
| 7. B | A0A059JJ46 | ABC multidrug transporter MDR2 | 1.58e-01 | NA | 0.004 | NA |
| 7. B | Q9PR37 | Spermidine/putrescine import ATP-binding protein PotA | 3.98e-02 | NA | 0.011 | NA |
| 7. B | Q57180 | Uncharacterized ABC transporter ATP-binding protein HI_1051 | 1.68e-02 | NA | 0.018 | NA |
| 7. B | P49938 | Iron(3+)-hydroxamate import ATP-binding protein FhuC | 5.92e-05 | NA | 0.038 | NA |
| 7. B | Q5X2Z8 | Lipoprotein-releasing system ATP-binding protein LolD | 3.01e-02 | NA | 0.044 | NA |
| 7. B | Q9HMZ4 | Putative ABC transporter ATP-binding protein VNG_2317G | 1.93e-02 | NA | 0.002 | NA |
| 7. B | B2GUP8 | Mitochondrial potassium channel ATP-binding subunit | 1.20e-01 | NA | 2.28e-04 | NA |
| 7. B | Q6MU19 | Spermidine/putrescine import ATP-binding protein PotA | 9.75e-02 | NA | 2.08e-04 | NA |
| 7. B | Q5H503 | Methionine import ATP-binding protein MetN | 7.35e-02 | NA | 0.003 | NA |
| 7. B | P94420 | Petrobactin import ATP-binding protein YclP | 6.74e-03 | NA | 0.002 | NA |
| 7. B | Q5HRU5 | Methionine import ATP-binding protein MetN 1 | 6.95e-02 | NA | 1.12e-05 | NA |
| 7. B | Q9KQW9 | ATP-dependent lipid A-core flippase | 2.20e-02 | NA | 1.60e-05 | NA |
| 7. B | Q8Y8T6 | Spermidine/putrescine import ATP-binding protein PotA | 5.35e-02 | NA | 0.008 | NA |
| 7. B | Q8YUI9 | Phosphonates import ATP-binding protein PhnC 2 | 2.85e-02 | NA | 0.015 | NA |
| 7. B | Q9RR46 | Glycine betaine/carnitine transport ATP-binding protein GbuA | 1.33e-01 | NA | 1.01e-05 | NA |
| 7. B | Q99ZS8 | Spermidine/putrescine import ATP-binding protein PotA | 2.38e-02 | NA | 2.22e-05 | NA |
| 7. B | Q8ZNV7 | Zinc import ATP-binding protein ZnuC | 5.03e-03 | NA | 0.001 | NA |
| 7. B | Q9LSJ6 | ABC transporter B family member 17 | 2.38e-02 | NA | 0.003 | NA |
| 7. B | F2RPA4 | ABC multidrug transporter MDR2 | 1.43e-01 | NA | 0.012 | NA |
| 7. B | D5AQY6 | Nickel import ATP-binding protein NikO | 1.44e-02 | NA | 8.54e-04 | NA |
| 7. B | Q8DMY0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.03e-02 | NA | 0.032 | NA |
| 7. B | P75370 | Probable ABC transporter ATP-binding protein p29 | 6.13e-02 | NA | 0.049 | NA |
| 7. B | Q8EIL8 | Macrolide export ATP-binding/permease protein MacB | 2.04e-01 | NA | 1.35e-04 | NA |
| 7. B | P0A2V3 | Octopine permease ATP-binding protein P | 1.04e-01 | NA | 0.003 | NA |
| 7. B | Q98HF7 | Spermidine/putrescine import ATP-binding protein PotA | 7.81e-02 | NA | 0.022 | NA |
| 7. B | P45321 | Molybdenum import ATP-binding protein ModC | 3.00e-02 | NA | 0.022 | NA |
| 7. B | Q7VKP7 | Molybdenum import ATP-binding protein ModC | 2.11e-02 | NA | 0.026 | NA |
| 7. B | Q8XXB6 | ATP-dependent lipid A-core flippase | 3.01e-02 | NA | 8.21e-04 | NA |
| 7. B | Q7NZU6 | ATP-dependent lipid A-core flippase | 1.56e-02 | NA | 0.007 | NA |
| 7. B | Q3Z2L6 | Zinc import ATP-binding protein ZnuC | 5.03e-03 | NA | 0.001 | NA |
| 7. B | P57066 | Lipoprotein-releasing system ATP-binding protein LolD | 2.42e-02 | NA | 0.023 | NA |
| 7. B | Q9KD30 | Manganese transport system ATP-binding protein MntB | 8.51e-03 | NA | 6.85e-06 | NA |
| 7. B | Q8EBC3 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 1.57e-01 | NA | 2.57e-05 | NA |
| 7. B | P9WQI3 | Trehalose import ATP-binding protein SugC | 5.45e-02 | NA | 0.037 | NA |
| 7. B | Q8RD43 | Ribose import ATP-binding protein RbsA | 5.29e-04 | NA | 0.004 | NA |
| 7. B | Q3SQZ1 | Macrolide export ATP-binding/permease protein MacB | 1.28e-01 | NA | 2.26e-04 | NA |
| 7. B | Q1JLT7 | Spermidine/putrescine import ATP-binding protein PotA | 1.06e-01 | NA | 8.89e-06 | NA |
| 7. B | A1VZQ5 | Probable ABC transporter ATP-binding protein PEB1C | 3.68e-02 | NA | 5.30e-04 | NA |
| 7. B | P36879 | Uncharacterized ABC transporter ATP-binding protein YadG | 2.38e-02 | NA | 0.049 | NA |
| 7. B | Q8Z5W6 | Zinc import ATP-binding protein ZnuC | 4.73e-03 | NA | 0.001 | NA |
| 7. B | Q92DL6 | Spermidine/putrescine import ATP-binding protein PotA | 3.61e-02 | NA | 0.008 | NA |
| 7. B | Q58664 | Probable branched-chain amino acid transport ATP-binding protein LivF | 8.19e-03 | NA | 0.039 | NA |
| 7. B | Q5E0F2 | ATP-dependent lipid A-core flippase | 2.08e-02 | NA | 4.28e-05 | NA |
| 7. B | Q58206 | Uncharacterized ABC transporter ATP-binding protein MJ0796 | 4.41e-02 | NA | 0.010 | NA |
| 7. B | Q322E8 | Zinc import ATP-binding protein ZnuC | 5.10e-03 | NA | 0.001 | NA |
| 7. B | P0AAG0 | Dipeptide transport ATP-binding protein DppD | 4.42e-02 | NA | 0.003 | NA |
| 7. B | A1A967 | Glutathione import ATP-binding protein GsiA | 2.30e-03 | NA | 0.002 | NA |
| 7. B | Q6LQ77 | Vitamin B12 import ATP-binding protein BtuD | 8.74e-03 | NA | 1.89e-04 | NA |
| 7. B | P75516 | Putative carbohydrate transport ATP-binding protein MPN_258 | 3.67e-03 | NA | 0.028 | NA |
| 7. B | Q9KQB8 | Zinc import ATP-binding protein ZnuC | 1.47e-02 | NA | 1.25e-04 | NA |
| 7. B | Q3B2U2 | Lipoprotein-releasing system ATP-binding protein LolD 1 | 4.73e-02 | NA | 0.017 | NA |
| 7. B | P54537 | Arginine transport ATP-binding protein ArtM | 5.63e-02 | NA | 6.55e-06 | NA |
| 7. B | P9WER4 | ABC-type transporter braE | NA | NA | 0.024 | NA |
| 7. B | Q20Y31 | Phosphonates import ATP-binding protein PhnC 2 | 2.74e-02 | NA | 0.009 | NA |
| 7. B | Q64SQ6 | Spermidine/putrescine import ATP-binding protein PotA | 5.12e-02 | NA | 0.049 | NA |
| 7. B | Q03ZL5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.96e-02 | NA | 4.98e-06 | NA |
| 7. B | Q4KC87 | Fe(3+) ions import ATP-binding protein FbpC | 3.67e-02 | NA | 0.012 | NA |
| 7. B | Q87R16 | ATP-dependent lipid A-core flippase | 4.22e-02 | NA | 7.29e-04 | NA |
| 7. B | Q7N6R3 | Molybdenum import ATP-binding protein ModC | 5.07e-02 | NA | 0.001 | NA |
| 7. B | Q2YU20 | Putative multidrug export ATP-binding/permease protein SAB1799c | 5.28e-02 | NA | 0.018 | NA |
| 7. B | Q9KS33 | Spermidine/putrescine import ATP-binding protein PotA | 8.58e-02 | NA | 0.010 | NA |
| 7. B | A0L0V9 | Macrolide export ATP-binding/permease protein MacB | 1.35e-01 | NA | 1.35e-04 | NA |
| 7. B | A0A348AXX9 | ABC-type transporter TR06 | 5.41e-02 | NA | 0.001 | NA |
| 7. B | Q9UZC8 | DNA double-strand break repair Rad50 ATPase | 3.95e-01 | NA | 0.026 | NA |
| 7. B | Q4KKK4 | Zinc import ATP-binding protein ZnuC | 3.30e-02 | NA | 0.001 | NA |
| 7. B | Q63FX9 | Ribose import ATP-binding protein RbsA | 2.35e-03 | NA | 0.005 | NA |
| 7. B | Q7CMM7 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.95e-03 | NA | 0.024 | NA |
| 7. B | Q2P7S3 | Methionine import ATP-binding protein MetN | 6.69e-02 | NA | 0.003 | NA |
| 7. B | P45769 | Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ | 1.65e-02 | NA | 1.26e-06 | NA |
| 7. B | Q4AA74 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.24e-02 | NA | 0.003 | NA |
| 7. B | Q3K9F9 | Lipoprotein-releasing system ATP-binding protein LolD | 2.71e-02 | NA | 6.42e-04 | NA |
| 7. B | Q8EEV5 | Lipoprotein-releasing system ATP-binding protein LolD | 2.49e-02 | NA | 0.005 | NA |
| 7. B | Q8DAV6 | Lipoprotein-releasing system ATP-binding protein LolD | 2.59e-02 | NA | 0.023 | NA |
| 7. B | Q1GZI0 | ATP-dependent lipid A-core flippase | 4.18e-02 | NA | 0.010 | NA |
| 7. B | Q3YUV0 | Maltose/maltodextrin import ATP-binding protein MalK | 2.16e-02 | NA | 0.014 | NA |
| 7. B | Q9ZR72 | ABC transporter B family member 1 | 6.27e-02 | NA | 0.004 | NA |
| 7. B | O27739 | Energy-coupling factor transporter ATP-binding protein EcfA | 6.76e-03 | NA | 0.005 | NA |
| 7. B | Q9LHD1 | ABC transporter B family member 15 | 4.00e-02 | NA | 0.033 | NA |
| 7. B | A1BCE9 | Macrolide export ATP-binding/permease protein MacB 3 | 1.61e-01 | NA | 8.43e-05 | NA |
| 7. B | Q03PF2 | Spermidine/putrescine import ATP-binding protein PotA | 1.96e-02 | NA | 1.88e-04 | NA |
| 7. B | Q2YIV5 | Methionine import ATP-binding protein MetN | 7.13e-02 | NA | 0.040 | NA |
| 7. B | Q92UI2 | Ribose import ATP-binding protein RbsA 3 | 7.58e-04 | NA | 0.009 | NA |
| 7. B | Q08201 | Phosphatidylcholine translocator ABCB4 | 1.45e-01 | NA | 2.21e-04 | NA |
| 7. B | Q9CJB8 | Lactococcin transport/processing ATP-binding protein LcnC-like | 1.49e-02 | NA | 7.69e-04 | NA |
| 7. B | Q92LX3 | Methionine import ATP-binding protein MetN | 6.61e-02 | NA | 0.006 | NA |
| 7. B | P37313 | Dipeptide transport ATP-binding protein DppF | 1.04e-01 | NA | 0.021 | NA |
| 7. B | Q6D4E2 | Spermidine/putrescine import ATP-binding protein PotA | 1.70e-02 | NA | 0.021 | NA |
| 7. B | O28882 | Probable branched-chain amino acid transport ATP-binding protein LivF | 1.14e-02 | NA | 0.012 | NA |
| 7. B | Q2IXX0 | Macrolide export ATP-binding/permease protein MacB | 1.87e-01 | NA | 0.016 | NA |
| 7. B | Q02DK9 | Zinc import ATP-binding protein ZnuC | 2.39e-02 | NA | 1.86e-06 | NA |
| 7. B | Q47JR8 | ATP-dependent lipid A-core flippase | 3.08e-02 | NA | 3.72e-04 | NA |
| 7. B | P0A193 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 4.68e-03 | NA | 7.86e-04 | NA |
| 7. B | Q1QE80 | Spermidine/putrescine import ATP-binding protein PotA | 2.46e-02 | NA | 0.031 | NA |
| 7. B | O57872 | Putative ABC transporter ATP-binding protein PH0132 | 1.22e-02 | NA | 2.82e-05 | NA |
| 7. B | Q5PIA5 | Zinc import ATP-binding protein ZnuC | 4.35e-03 | NA | 0.001 | NA |
| 7. B | Q91WA9 | ATP-binding cassette subfamily G member 4 | 1.97e-01 | NA | 0.045 | NA |
| 7. B | F2T1C4 | ABC multidrug transporter MDR2 | 8.20e-02 | NA | 0.005 | NA |
| 7. B | Q0TBU8 | Hemin import ATP-binding protein HmuV | 2.07e-02 | NA | 0.004 | NA |
| 7. B | Q6GC27 | Methionine import ATP-binding protein MetN 1 | 7.12e-02 | NA | 2.34e-04 | NA |
| 7. B | A1JRI2 | Zinc import ATP-binding protein ZnuC | 1.79e-02 | NA | 3.98e-05 | NA |
| 7. B | A1WXT0 | Zinc import ATP-binding protein ZnuC | 3.64e-03 | NA | 5.42e-04 | NA |
| 7. B | Q70GD4 | Hemin import ATP-binding protein HmuV | 1.35e-02 | NA | 0.002 | NA |
| 7. B | Q14Q07 | Spermidine/putrescine import ATP-binding protein PotA | 6.81e-02 | NA | 2.35e-04 | NA |
| 7. B | Q2SSS4 | Spermidine/putrescine import ATP-binding protein PotA | 7.13e-02 | NA | 3.20e-04 | NA |
| 7. B | Q0HJG0 | Lipoprotein-releasing system ATP-binding protein LolD | 2.52e-02 | NA | 0.004 | NA |
| 7. B | O86751 | Fe(3+) ions import ATP-binding protein FbpC | 4.31e-02 | NA | 2.83e-04 | NA |
| 7. B | Q8Z0H0 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.34e-02 | NA | 0.032 | NA |
| 7. B | Q7MLE6 | Vitamin B12 import ATP-binding protein BtuD | 2.14e-02 | NA | 0.012 | NA |
| 7. B | Q0VT01 | Macrolide export ATP-binding/permease protein MacB | 3.41e-01 | NA | 0.001 | NA |
| 7. B | A0B3Z7 | Arabinose import ATP-binding protein AraG 2 | 6.06e-04 | NA | 0.002 | NA |
| 7. B | Q31YT6 | ATP-dependent lipid A-core flippase | 3.22e-02 | NA | 0.004 | NA |
| 7. B | Q8PUE7 | Putative ABC transporter ATP-binding protein MM_2387 | 5.41e-04 | NA | 5.29e-05 | NA |
| 7. B | Q8LPQ6 | ABC transporter B family member 28 | 5.58e-02 | NA | 0.048 | NA |
| 7. B | Q1CA68 | ATP-dependent lipid A-core flippase | 5.21e-02 | NA | 0.012 | NA |
| 7. B | Q9WYI7 | Uncharacterized ABC transporter ATP-binding protein TM_0352 | 2.17e-02 | NA | 6.44e-06 | NA |
| 7. B | Q73BM0 | Spermidine/putrescine import ATP-binding protein PotA | 1.26e-02 | NA | 0.001 | NA |
| 7. B | Q6D645 | Hemin import ATP-binding protein HmuV | 4.09e-02 | NA | 0.029 | NA |
| 7. B | P0DKX5 | Cyclolysin secretion/processing ATP-binding protein CyaB | 2.93e-02 | NA | 0.003 | NA |
| 7. B | Q3IX40 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.94e-02 | NA | 0.014 | NA |
| 7. B | Q92XW1 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 2.88e-04 | NA | 0.031 | NA |
| 7. B | Q7WP62 | Molybdenum import ATP-binding protein ModC | 3.58e-02 | NA | 0.003 | NA |
| 7. B | F2SQT8 | ABC multidrug transporter MDR5 | 1.51e-01 | NA | 0.019 | NA |
| 7. B | Q57RB2 | Glutathione import ATP-binding protein GsiA | 9.90e-04 | NA | 0.002 | NA |
| 7. B | Q60350 | Uncharacterized ABC transporter ATP-binding protein MJ0035 | 5.46e-03 | NA | 4.74e-04 | NA |
| 7. B | Q890R3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.79e-02 | NA | 0.034 | NA |
| 7. B | Q8FCJ1 | Hemin import ATP-binding protein HmuV | 2.10e-02 | NA | 0.004 | NA |
| 7. B | Q48HL2 | Phosphonates import ATP-binding protein PhnC 2 | 3.35e-02 | NA | 3.20e-05 | NA |
| 7. B | Q9CXJ4 | Mitochondrial potassium channel ATP-binding subunit | 1.61e-01 | NA | 7.36e-06 | NA |
| 7. B | Q65SW3 | Molybdenum import ATP-binding protein ModC | 4.66e-02 | NA | 0.008 | NA |
| 7. B | Q9JVR5 | Macrolide export ATP-binding/permease protein MacB | 2.14e-01 | NA | 0.005 | NA |
| 7. B | Q3SGJ8 | Phosphonates import ATP-binding protein PhnC | 1.55e-02 | NA | 0.020 | NA |
| 7. B | P48243 | Glutamate transport ATP-binding protein GluA | 7.43e-02 | NA | 3.46e-04 | NA |
| 7. B | Q02FW7 | Hemin import ATP-binding protein HmuV | 3.08e-02 | NA | 0.015 | NA |
| 7. B | Q39E73 | ATP-dependent lipid A-core flippase | 2.42e-02 | NA | 0.002 | NA |
| 7. B | Q9LYS2 | ABC transporter C family member 10 | 1.88e-01 | NA | 0.036 | NA |
| 7. B | Q1JGY7 | Spermidine/putrescine import ATP-binding protein PotA | 1.95e-01 | NA | 8.89e-06 | NA |
| 7. B | Q82JY6 | Fe(3+) ions import ATP-binding protein FbpC | 3.85e-02 | NA | 1.67e-04 | NA |
| 7. B | P68188 | Maltose/maltodextrin import ATP-binding protein MalK | 2.40e-02 | NA | 0.014 | NA |
| 7. B | Q6F0V4 | Spermidine/putrescine import ATP-binding protein PotA | 4.32e-02 | NA | 1.63e-04 | NA |
| 7. B | Q4K9A4 | Macrolide export ATP-binding/permease protein MacB 2 | 1.98e-01 | NA | 0.017 | NA |
| 7. B | Q3K0Y6 | Spermidine/putrescine import ATP-binding protein PotA | 2.06e-01 | NA | 1.43e-04 | NA |
| 7. B | Q1BUV6 | ATP-dependent lipid A-core flippase | 2.39e-02 | NA | 0.002 | NA |
| 7. B | Q8Z824 | Macrolide export ATP-binding/permease protein MacB | 1.81e-01 | NA | 2.62e-04 | NA |
| 7. B | P45171 | Spermidine/putrescine import ATP-binding protein PotA | 2.84e-02 | NA | 0.004 | NA |
| 7. B | P47365 | Putative carbohydrate transport ATP-binding protein MG119 | 3.47e-03 | NA | 0.008 | NA |
| 7. B | Q81V36 | Ribose import ATP-binding protein RbsA | 2.01e-03 | NA | 0.006 | NA |
| 7. B | Q9FWX7 | ABC transporter B family member 11 | 1.54e-01 | NA | 0.049 | NA |
| 7. B | Q9NRK6 | ATP-binding cassette sub-family B member 10, mitochondrial | 1.71e-01 | NA | 9.14e-06 | NA |
| 7. B | P34712 | Multidrug resistance protein pgp-1 | 1.11e-01 | NA | 0.022 | NA |
| 7. B | Q480N3 | ATP-dependent lipid A-core flippase 2 | 2.10e-02 | NA | 0.015 | NA |
| 7. B | Q5LYN4 | Spermidine/putrescine import ATP-binding protein PotA | 1.09e-01 | NA | 2.35e-06 | NA |
| 7. B | P45843 | Protein scarlet | 4.11e-01 | NA | 1.77e-04 | NA |
| 7. B | Q7UBD0 | Maltose/maltodextrin import ATP-binding protein MalK | 2.02e-02 | NA | 0.014 | NA |
| 7. B | Q1J450 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.87e-03 | NA | 0.017 | NA |
| 7. B | Q659V4 | Hemin import ATP-binding protein HmuV | 1.20e-02 | NA | 0.002 | NA |
| 7. B | Q7M8U0 | Macrolide export ATP-binding/permease protein MacB | 2.00e-01 | NA | 0.004 | NA |
| 7. B | Q1Q8K4 | Phosphate import ATP-binding protein PstB | 2.10e-02 | NA | 0.034 | NA |
| 7. B | Q5WVN2 | ATP-dependent lipid A-core flippase | 4.47e-02 | NA | 0.002 | NA |
| 7. B | Q8RBQ1 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 6.75e-04 | NA | 0.023 | NA |
| 7. B | Q7A7E3 | Methionine import ATP-binding protein MetN 1 | 8.38e-02 | NA | 2.92e-04 | NA |
| 7. B | Q88XV1 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.42e-02 | NA | 1.14e-04 | NA |
| 7. B | Q9LSJ2 | ABC transporter B family member 22 | 1.73e-01 | NA | 0.003 | NA |
| 7. B | Q88G95 | Molybdenum import ATP-binding protein ModC | 8.69e-02 | NA | 0.019 | NA |
| 7. B | Q8XHV3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.72e-03 | NA | 0.002 | NA |
| 7. B | Q8EUF1 | Energy-coupling factor transporter ATP-binding protein EcfA | 8.78e-03 | NA | 0.013 | NA |
| 7. B | Q6GFJ1 | Putative multidrug export ATP-binding/permease protein SAR1956 | 4.40e-02 | NA | 0.041 | NA |
| 7. B | Q312H8 | Lipoprotein-releasing system ATP-binding protein LolD | 2.16e-02 | NA | 0.021 | NA |
| 7. B | Q4KJB2 | ATP-dependent lipid A-core flippase | 8.35e-02 | NA | 9.81e-05 | NA |
| 7. B | P0CZ28 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.02e-02 | NA | 0.024 | NA |
| 7. B | Q6KHL2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.06e-02 | NA | 6.45e-04 | NA |
| 7. B | Q9HT73 | Zinc import ATP-binding protein ZnuC | 2.37e-02 | NA | 1.86e-06 | NA |
| 7. B | P57030 | Lipoprotein-releasing system ATP-binding protein LolD | 2.77e-02 | NA | 0.018 | NA |
| 7. B | Q6HNE7 | Ribose import ATP-binding protein RbsA | 7.19e-03 | NA | 0.006 | NA |
| 7. B | P06611 | Vitamin B12 import ATP-binding protein BtuD | 6.61e-03 | NA | 2.18e-04 | NA |
| 7. B | Q8UII7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 | 1.26e-01 | NA | 0.032 | NA |
| 7. B | Q66CL2 | Macrolide export ATP-binding/permease protein MacB 1 | 1.58e-01 | NA | 1.29e-04 | NA |
| 7. B | Q9JI39 | ATP-binding cassette sub-family B member 10, mitochondrial | 1.52e-01 | NA | 1.51e-04 | NA |
| 7. B | Q7MJ01 | Lipoprotein-releasing system ATP-binding protein LolD | 2.45e-02 | NA | 0.023 | NA |
| 7. B | Q99WE1 | Methionine import ATP-binding protein MetN 1 | 7.30e-02 | NA | 2.92e-04 | NA |
| 7. B | Q58903 | Uncharacterized ABC transporter ATP-binding protein MJ1508 | 3.20e-02 | NA | 0.006 | NA |
| 7. B | Q1GJU0 | Hemin import ATP-binding protein HmuV | 2.13e-02 | NA | 0.017 | NA |
| 7. B | Q73F66 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.52e-02 | NA | 0.001 | NA |
| 7. B | Q4KB64 | Molybdenum import ATP-binding protein ModC | 1.20e-01 | NA | 0.010 | NA |
| 7. B | Q1CNR8 | Maltose/maltodextrin import ATP-binding protein MalK | 1.76e-02 | NA | 0.008 | NA |
| 7. B | Q8TI16 | Energy-coupling factor transporter ATP-binding protein EcfA | 8.96e-03 | NA | 2.15e-05 | NA |
| 7. B | Q1C951 | Molybdenum import ATP-binding protein ModC | 5.05e-02 | NA | 0.002 | NA |
| 7. B | Q8X6W1 | Glutathione import ATP-binding protein GsiA | 2.21e-03 | NA | 8.10e-04 | NA |
| 7. B | Q62K82 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.64e-02 | NA | 0.006 | NA |
| 7. B | Q0SRL2 | Spermidine/putrescine import ATP-binding protein PotA | 4.17e-02 | NA | 6.07e-05 | NA |
| 7. B | P94367 | ATP-binding/permease protein CydD | 2.93e-02 | NA | 0.002 | NA |
| 7. B | P29551 | Elongation factor 3 | 5.92e-02 | NA | 0.005 | NA |
| 7. B | Q9CMG7 | ATP-dependent lipid A-core flippase | 3.27e-02 | NA | 0.014 | NA |
| 7. B | Q1RDU4 | ATP-dependent lipid A-core flippase | 2.71e-02 | NA | 0.004 | NA |
| 7. B | Q1RJ91 | Putative export ATP-binding/permease protein RBE_0492 | 9.51e-03 | NA | 0.009 | NA |
| 7. B | Q4FQD1 | Phosphate import ATP-binding protein PstB | 2.20e-02 | NA | 0.029 | NA |
| 7. B | Q9PHQ1 | Phosphate import ATP-binding protein PstB | 1.40e-02 | NA | 0.044 | NA |
| 7. B | P0A2V1 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 1.29e-01 | NA | 0.018 | NA |
| 7. B | Q73DH7 | Ribose import ATP-binding protein RbsA | 1.81e-03 | NA | 0.011 | NA |
| 7. B | Q9V1Q4 | Putative ABC transporter ATP-binding protein PYRAB03730 | 2.15e-02 | NA | 2.25e-06 | NA |
| 7. B | Q57NA5 | Zinc import ATP-binding protein ZnuC | 4.82e-03 | NA | 0.001 | NA |
| 7. B | Q8RI39 | Spermidine/putrescine import ATP-binding protein PotA | 3.20e-02 | NA | 0.012 | NA |
| 7. B | Q99XI2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.28e-03 | NA | 0.017 | NA |
| 7. B | P55469 | Uncharacterized ABC transporter ATP-binding protein y4gM | 2.52e-02 | NA | 0.035 | NA |
| 7. B | Q2RZ08 | Hemin import ATP-binding protein HmuV | 2.40e-02 | NA | 1.09e-05 | NA |
| 7. B | B2KWH4 | ABC transporter 1 | 1.62e-01 | NA | 6.25e-05 | NA |
| 7. B | Q6LPK6 | ATP-dependent lipid A-core flippase | 3.74e-02 | NA | 1.34e-04 | NA |
| 7. B | Q8TIW9 | Putative ABC transporter ATP-binding protein MA_4021 | 1.69e-02 | NA | 2.23e-04 | NA |
| 7. B | P0A9S7 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 4.69e-03 | NA | 3.07e-04 | NA |
| 7. B | Q4WA92 | ABC multidrug transporter E | 3.88e-02 | NA | 5.12e-04 | NA |
| 7. B | Q88RL1 | Zinc import ATP-binding protein ZnuC | 2.35e-02 | NA | 4.02e-04 | NA |
| 7. B | Q3Z300 | Lipoprotein-releasing system ATP-binding protein LolD | 2.54e-02 | NA | 0.019 | NA |
| 7. B | Q4HVU7 | Iron-sulfur clusters transporter ATM1, mitochondrial | 7.52e-02 | NA | 0.024 | NA |
| 7. B | Q9V2E4 | Putative ABC transporter ATP-binding protein PYRAB01300 | 9.84e-03 | NA | 2.27e-05 | NA |
| 7. B | P63354 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.13e-02 | NA | 0.006 | NA |
| 7. B | Q7N545 | Zinc import ATP-binding protein ZnuC | 4.74e-03 | NA | 1.46e-05 | NA |
| 7. B | P02915 | Histidine transport ATP-binding protein HisP | 1.06e-01 | NA | 1.22e-07 | NA |
| 7. B | Q4K681 | Spermidine/putrescine import ATP-binding protein PotA | 1.95e-02 | NA | 0.016 | NA |
| 7. B | Q2IF17 | Lipoprotein-releasing system ATP-binding protein LolD | 1.42e-02 | NA | 3.35e-05 | NA |
| 7. B | Q3SFZ6 | ATP-dependent lipid A-core flippase | 1.24e-02 | NA | 0.002 | NA |
| 7. B | Q92VJ2 | Sulfate/thiosulfate import ATP-binding protein CysA 2 | 3.25e-04 | NA | 0.025 | NA |
| 7. B | P0CL92 | Iron-sulfur clusters transporter ATM1, mitochondrial | 3.73e-02 | NA | 0.012 | NA |
| 7. B | Q1DCP5 | Hemin import ATP-binding protein HmuV | 2.48e-02 | NA | 2.67e-04 | NA |
| 7. B | Q5HM28 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.14e-03 | NA | 0.018 | NA |
| 7. B | A0R8K9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.01e-02 | NA | 0.003 | NA |
| 7. B | Q8CQS7 | Methionine import ATP-binding protein MetN 2 | 6.96e-02 | NA | 1.12e-05 | NA |
| 7. B | P21440 | Phosphatidylcholine translocator ABCB4 | 1.12e-01 | NA | 1.75e-04 | NA |
| 7. B | P0CU83 | ABC multidrug transporter MDR2 | 5.86e-02 | NA | 0.002 | NA |
| 7. B | Q9NUQ8 | ATP-binding cassette sub-family F member 3 | 1.96e-02 | NA | 0.003 | NA |
| 7. B | A0A0M4FLW6 | ABC transporter G family member STR2 | 1.13e-01 | NA | 0.036 | NA |
| 7. B | Q9K6J9 | Ribose import ATP-binding protein RbsA | 1.40e-03 | NA | 2.82e-05 | NA |
| 7. B | Q9QYJ4 | ABC-type oligopeptide transporter ABCB9 | 1.03e-01 | NA | 0.017 | NA |
| 7. B | A1AC19 | Zinc import ATP-binding protein ZnuC | 4.94e-03 | NA | 0.001 | NA |
| 7. B | Q6D437 | ATP-dependent lipid A-core flippase | 2.29e-02 | NA | 0.003 | NA |
| 7. B | A1B9K8 | Zinc import ATP-binding protein ZnuC | 4.50e-03 | NA | 0.032 | NA |
| 7. B | Q48QM2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.57e-03 | NA | 0.024 | NA |
| 7. B | F2PRR1 | ABC multidrug transporter MDR2 | 1.45e-01 | NA | 0.005 | NA |
| 7. B | Q8ZQM4 | Glutathione import ATP-binding protein GsiA | 8.56e-04 | NA | 0.002 | NA |
| 7. B | P0A191 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 1.21e-02 | NA | 6.39e-04 | NA |
| 7. B | Q0SXQ1 | Maltose/maltodextrin import ATP-binding protein MalK | 1.71e-02 | NA | 0.031 | NA |
| 7. B | Q0TNZ3 | Spermidine/putrescine import ATP-binding protein PotA | 2.10e-02 | NA | 0.002 | NA |
| 7. B | Q5F4X8 | ATP-dependent lipid A-core flippase | 1.39e-01 | NA | 0.001 | NA |
| 7. B | Q839D4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.30e-02 | NA | 0.019 | NA |
| 7. B | O67154 | Phosphate import ATP-binding protein PstB | 1.61e-02 | NA | 0.035 | NA |
| 7. B | Q045Z7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 4.04e-02 | NA | 4.93e-04 | NA |
| 7. B | Q5LI72 | Lipoprotein-releasing system ATP-binding protein LolD | 1.30e-02 | NA | 0.002 | NA |
| 7. B | Q12ES3 | Lipoprotein-releasing system ATP-binding protein LolD | 3.58e-02 | NA | 0.002 | NA |
| 7. B | Q97SA3 | Putative ABC transporter ATP-binding protein SP_0483 | 7.23e-04 | NA | 8.22e-04 | NA |
| 7. B | Q63TY1 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.67e-02 | NA | 0.005 | NA |
| 7. B | Q73R11 | Putative ABC transporter ATP-binding protein TDE_0282 | 2.35e-03 | NA | 1.05e-04 | NA |
| 7. B | Q1B677 | Methionine import ATP-binding protein MetN | 8.39e-02 | NA | 0.011 | NA |
| 7. B | Q9EYM2 | Lipoprotein-releasing system ATP-binding protein LolD | 5.22e-02 | NA | 0.003 | NA |
| 7. B | Q7W1F4 | Molybdenum import ATP-binding protein ModC | 3.23e-02 | NA | 0.003 | NA |
| 7. B | P35116 | Nopaline permease ATP-binding protein P | 9.20e-02 | NA | 7.72e-07 | NA |
| 7. B | Q6D654 | Vitamin B12 import ATP-binding protein BtuD | 5.33e-03 | NA | 0.003 | NA |
| 7. B | S0EGU4 | ABC transporter BEA3 | 1.93e-01 | NA | 0.042 | NA |
| 7. B | Q5F8K2 | Lipoprotein-releasing system ATP-binding protein LolD | 2.86e-02 | NA | 0.010 | NA |
| 7. B | Q74DN5 | Putative ABC transporter ATP-binding protein GSU1281 | 1.86e-02 | NA | 0.012 | NA |
| 7. B | O26236 | Putative ABC transporter ATP-binding protein MTH_133 | 7.97e-03 | NA | 0.001 | NA |
| 7. B | Q12NL5 | Lipoprotein-releasing system ATP-binding protein LolD | 3.15e-02 | NA | 0.009 | NA |
| 7. B | A1A9B7 | Macrolide export ATP-binding/permease protein MacB 1 | 1.87e-01 | NA | 2.25e-04 | NA |
| 7. B | Q2SMN9 | Macrolide export ATP-binding/permease protein MacB | 1.98e-01 | NA | 0.002 | NA |
| 7. B | Q5PGP3 | Glutathione import ATP-binding protein GsiA | 9.69e-04 | NA | 0.002 | NA |
| 7. B | Q8PSR0 | Putative ABC transporter ATP-binding protein MM_3016 | 5.60e-04 | NA | 0.003 | NA |
| 7. B | Q1CGH0 | ATP-dependent lipid A-core flippase | 5.07e-02 | NA | 0.012 | NA |
| 7. B | Q2YVT7 | Methionine import ATP-binding protein MetN 1 | 7.21e-02 | NA | 1.86e-04 | NA |
| 7. B | Q8T9W4 | ABC transporter B family member 3 | 1.87e-01 | NA | 0.003 | NA |
| 7. B | Q2SB47 | Hemin import ATP-binding protein HmuV | 2.39e-02 | NA | 1.43e-05 | NA |
| 7. B | P27675 | Glutamine transport ATP-binding protein GlnQ | 4.06e-02 | NA | 8.26e-06 | NA |
| 7. B | Q8DIA0 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.33e-02 | NA | 8.83e-04 | NA |
| 7. B | Q6D7D0 | Molybdenum import ATP-binding protein ModC | 7.28e-02 | NA | 0.002 | NA |
| 7. B | Q63VX7 | ATP-dependent lipid A-core flippase | 1.77e-02 | NA | 0.006 | NA |
| 7. B | Q8YK28 | Phosphonates import ATP-binding protein PhnC 3 | 1.46e-02 | NA | 0.032 | NA |
| 7. B | Q6HG98 | Putative ABC transporter ATP-binding protein BT9727_3105 | 3.69e-04 | NA | 8.84e-05 | NA |
| 7. B | Q8Y651 | Manganese transport system ATP-binding protein MntB | 4.35e-05 | NA | 7.91e-05 | NA |
| 7. B | Q66H39 | ATP-binding cassette sub-family F member 3 | 1.32e-02 | NA | 0.002 | NA |
| 7. B | Q5ZWE4 | Spermidine/putrescine import ATP-binding protein PotA | 8.54e-02 | NA | 0.005 | NA |
| 7. B | Q72PE5 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.95e-03 | NA | 0.006 | NA |
| 7. B | Q92NU9 | Macrolide export ATP-binding/permease protein MacB | 1.94e-01 | NA | 5.99e-04 | NA |
| 7. B | P57031 | Lipoprotein-releasing system ATP-binding protein LolD | 2.85e-02 | NA | 0.018 | NA |
| 7. B | Q8YIT2 | Macrolide export ATP-binding/permease protein MacB | 2.27e-01 | NA | 0.003 | NA |
| 7. B | Q2YRG7 | Macrolide export ATP-binding/permease protein MacB | 2.20e-01 | NA | 0.002 | NA |
| 7. B | Q55281 | Manganese transport system ATP-binding protein MntA | 5.75e-05 | NA | 0.002 | NA |
| 7. B | Q4ZRT7 | Phosphate import ATP-binding protein PstB 1 | 1.71e-02 | NA | 0.016 | NA |
| 7. B | Q8GU82 | ABC transporter G family member 45 | 1.49e-01 | NA | 0.043 | NA |
| 7. B | P0C2H3 | Macrolide export ATP-binding/permease protein MacB 2 | 1.77e-01 | NA | 4.72e-04 | NA |
| 7. B | P45073 | Lipopolysaccharide export system ATP-binding protein LptB | 2.77e-02 | NA | 6.77e-05 | NA |
| 7. B | Q71ED1 | Beta-(1-->2)glucan export ATP-binding/permease protein NdvA | 9.35e-02 | NA | 0.032 | NA |
| 7. B | Q5HEQ8 | Putative multidrug export ATP-binding/permease protein SACOL1924 | 4.30e-02 | NA | 0.041 | NA |
| 7. B | Q1IGY7 | Zinc import ATP-binding protein ZnuC | 2.29e-02 | NA | 6.23e-05 | NA |
| 7. B | Q97ZT9 | Phosphate import ATP-binding protein PstB | 3.62e-02 | NA | 0.019 | NA |
| 7. B | Q2FFM9 | Putative multidrug export ATP-binding/permease protein SAUSA300_1847 | 4.22e-02 | NA | 0.041 | NA |
| 7. B | Q8TQ05 | Putative ABC transporter ATP-binding protein MA_1747 | 6.66e-04 | NA | 6.02e-04 | NA |
| 7. B | Q3K6R9 | Hemin import ATP-binding protein HmuV | 3.55e-02 | NA | 8.20e-05 | NA |
| 7. B | Q1BJW2 | Arabinose import ATP-binding protein AraG 2 | 6.04e-04 | NA | 0.002 | NA |
| 7. B | Q03I83 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.10e-02 | NA | 0.003 | NA |
| 7. B | Q92GP9 | Putative export ATP-binding/permease protein RC1073 | 2.87e-02 | NA | 0.003 | NA |
| 7. B | Q6XYZ3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.02e-02 | NA | 0.011 | NA |
| 7. B | Q28VN1 | Zinc import ATP-binding protein ZnuC | 2.28e-02 | NA | 0.020 | NA |
| 7. B | Q4ZV73 | Lipoprotein-releasing system ATP-binding protein LolD | 3.07e-02 | NA | 0.001 | NA |
| 7. B | Q832R5 | Putative ABC transporter ATP-binding protein EF_2153 | 1.04e-03 | NA | 0.023 | NA |
| 7. B | Q1QYT1 | Arabinose import ATP-binding protein AraG | 3.99e-04 | NA | 0.025 | NA |
| 7. B | Q9YGA6 | Trehalose/maltose import ATP-binding protein MalK | 7.26e-02 | NA | 0.001 | NA |
| 7. B | P77481 | Putative uncharacterized ABC transporter ATP-binding protein YcjV | 2.76e-02 | NA | 0.001 | NA |
| 7. B | Q99S47 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.01e-02 | NA | 0.029 | NA |
| 7. B | Q7CMM8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.24e-03 | NA | 0.017 | NA |
| 7. B | Q7W9N7 | ATP-dependent lipid A-core flippase | 3.89e-02 | NA | 1.15e-04 | NA |
| 7. B | Q04HV8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 3.06e-02 | NA | 0.032 | NA |
| 7. B | Q7CHI2 | Macrolide export ATP-binding/permease protein MacB 1 | 1.58e-01 | NA | 1.29e-04 | NA |
| 7. B | Q97UY8 | Glucose import ATP-binding protein GlcV | 3.09e-02 | NA | 0.001 | NA |
| 7. B | Q8Y4E9 | Phosphate import ATP-binding protein PstB 2 | 1.95e-02 | NA | 0.047 | NA |
| 7. B | A1U0A9 | Macrolide export ATP-binding/permease protein MacB | 1.64e-01 | NA | 1.49e-04 | NA |
| 7. B | P0A9X3 | Zinc import ATP-binding protein ZnuC | 5.16e-03 | NA | 0.001 | NA |
| 7. B | Q5HIL5 | Methionine import ATP-binding protein MetN 1 | 7.13e-02 | NA | 0.001 | NA |
| 7. B | A0A0D1BUH6 | ABC-type transporter atr1 | 8.18e-02 | NA | 0.004 | NA |
| 7. B | Q6VMN4 | Xylose import ATP-binding protein XylG | 1.25e-03 | NA | 4.95e-04 | NA |
| 7. B | Q8ZAS8 | Maltose/maltodextrin import ATP-binding protein MalK | 1.71e-02 | NA | 0.008 | NA |
| 7. B | Q17320 | Protein white | 3.59e-01 | NA | 0.028 | NA |
| 7. B | A3CVD3 | Energy-coupling factor transporter ATP-binding protein EcfA | 7.11e-03 | NA | 1.56e-04 | NA |
| 7. B | Q8UKE4 | Macrolide export ATP-binding/permease protein MacB | 2.50e-01 | NA | 0.001 | NA |
| 7. B | Q5DZC6 | Maltose/maltodextrin import ATP-binding protein MalK | 3.31e-02 | NA | 0.014 | NA |
| 7. B | Q52815 | General L-amino acid transport ATP-binding protein AapP | 4.76e-02 | NA | 1.83e-04 | NA |
| 7. B | Q7A470 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.42e-03 | NA | 0.029 | NA |
| 7. B | Q8PY27 | Putative ABC transporter ATP-binding protein MM_1037 | 8.67e-03 | NA | 0.006 | NA |
| 7. B | Q66AT7 | Zinc import ATP-binding protein ZnuC | 2.06e-02 | NA | 2.62e-05 | NA |
| 7. B | Q1AXT9 | Phosphate import ATP-binding protein PstB | 5.71e-02 | NA | 0.024 | NA |
| 7. B | P10346 | Glutamine transport ATP-binding protein GlnQ | 2.91e-02 | NA | 4.12e-04 | NA |
| 7. B | Q882S0 | Phosphonates import ATP-binding protein PhnC 2 | 3.48e-02 | NA | 9.00e-05 | NA |
| 7. B | Q0TMS8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.43e-03 | NA | 0.002 | NA |
| 7. B | P0A9T8 | Uncharacterized ABC transporter ATP-binding protein YbbA | 5.52e-02 | NA | 0.001 | NA |
| 7. B | Q55DW4 | ABC transporter G family member 1 | 2.88e-01 | NA | 5.19e-04 | NA |
| 7. B | Q5P2S7 | ATP-dependent lipid A-core flippase | 1.71e-01 | NA | 0.001 | NA |
| 7. B | Q4WD46 | ABC-type transporter fsqE | 1.36e-01 | NA | 0.035 | NA |
| 7. B | Q3B3H7 | Phosphate import ATP-binding protein PstB | 4.69e-02 | NA | 0.020 | NA |
| 7. B | Q1C812 | Zinc import ATP-binding protein ZnuC | 1.74e-02 | NA | 3.80e-05 | NA |
| 7. B | Q5X9B5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.82e-03 | NA | 0.024 | NA |
| 7. B | Q28QL7 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 3.75e-02 | NA | 0.008 | NA |
| 7. B | Q3KJ31 | ATP-dependent lipid A-core flippase | 7.20e-02 | NA | 7.98e-04 | NA |
| 7. B | P0CZ29 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.04e-02 | NA | 0.024 | NA |
| 7. B | P72297 | Octopine permease ATP-binding protein P | 1.01e-01 | NA | 0.018 | NA |
| 7. B | Q6GJL2 | Methionine import ATP-binding protein MetN 1 | 8.07e-02 | NA | 3.10e-04 | NA |
| 7. B | Q9HYL7 | Phosphonates import ATP-binding protein PhnC 2 | 1.52e-02 | NA | 1.15e-04 | NA |
| 7. B | Q7W9U5 | Sulfate/thiosulfate import ATP-binding protein CysA | 8.27e-02 | NA | 0.001 | NA |
| 7. B | Q160M2 | Spermidine/putrescine import ATP-binding protein PotA | 2.84e-02 | NA | 5.62e-05 | NA |
| 7. B | Q02MI4 | Macrolide export ATP-binding/permease protein MacB | 2.29e-01 | NA | 0.005 | NA |
| 7. B | Q2M3G0 | ATP-binding cassette sub-family B member 5 | 1.07e-01 | NA | 3.86e-04 | NA |
| 7. B | Q8PY26 | Putative ABC transporter ATP-binding protein MM_1038 | 8.10e-03 | NA | 1.90e-04 | NA |
| 7. B | Q217L2 | Macrolide export ATP-binding/permease protein MacB | 1.82e-01 | NA | 0.007 | NA |
| 7. B | Q21WN9 | ATP-dependent lipid A-core flippase | 1.67e-01 | NA | 5.17e-04 | NA |
| 7. B | P55662 | Probable amino-acid ABC transporter ATP-binding protein y4tH | 2.49e-02 | NA | 0.002 | NA |
| 7. B | Q5RKI8 | Mitochondrial potassium channel ATP-binding subunit | 2.70e-02 | NA | 6.46e-06 | NA |
| 7. B | Q8Z864 | Glutathione import ATP-binding protein GsiA | 9.90e-04 | NA | 0.002 | NA |
| 7. B | Q8ELR4 | Spermidine/putrescine import ATP-binding protein PotA | 3.30e-02 | NA | 0.001 | NA |
| 7. B | Q8ZGA9 | ATP-dependent lipid A-core flippase | 4.40e-02 | NA | 0.012 | NA |
| 7. B | Q9PPV1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.38e-02 | NA | 0.039 | NA |
| 7. B | Q4ZV10 | Macrolide export ATP-binding/permease protein MacB 1 | 3.00e-01 | NA | 0.044 | NA |
| 7. B | P0A9S8 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 4.71e-03 | NA | 3.07e-04 | NA |
| 7. B | Q7MU65 | Lipoprotein-releasing system ATP-binding protein LolD | 1.27e-02 | NA | 0.002 | NA |
| 7. B | Q4FS42 | ATP-dependent lipid A-core flippase | 3.26e-02 | NA | 0.007 | NA |
| 7. B | Q972J5 | Putative ABC transporter ATP-binding protein STK_11360 | 1.49e-03 | NA | 0.007 | NA |
| 7. B | Q66D71 | Molybdenum import ATP-binding protein ModC | 3.25e-02 | NA | 0.002 | NA |
| 7. B | Q5LXJ4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.05e-02 | NA | 0.003 | NA |
| 7. B | Q2G0V2 | Methionine import ATP-binding protein MetN 1 | 8.51e-02 | NA | 0.001 | NA |
| 7. B | Q0BGD7 | Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 | 4.59e-04 | NA | 0.012 | NA |
| 7. B | Q1JJD0 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.09e-03 | NA | 0.017 | NA |
| 7. B | Q82CM5 | Ribose import ATP-binding protein RbsA 1 | 6.56e-04 | NA | 3.70e-04 | NA |
| 7. B | Q56A55 | Mitochondrial potassium channel ATP-binding subunit | 2.24e-02 | NA | 0.002 | NA |
| 7. B | Q3JYF5 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 4.25e-02 | NA | 0.011 | NA |
| 7. B | Q97Q42 | Spermidine/putrescine import ATP-binding protein PotA | 1.17e-01 | NA | 1.23e-04 | NA |
| 7. B | Q1JJC9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.57e-03 | NA | 0.024 | NA |
| 7. B | Q20ZS6 | Lipoprotein-releasing system ATP-binding protein LolD 2 | 3.43e-02 | NA | 5.20e-04 | NA |
| 7. B | Q8TXI4 | DNA double-strand break repair Rad50 ATPase | 1.08e-01 | NA | 0.010 | NA |
| 7. B | A0ALT6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.02e-02 | NA | 0.050 | NA |
| 7. B | Q5FM18 | Phosphate import ATP-binding protein PstB 1 | 3.13e-02 | NA | 0.011 | NA |
| 7. B | Q88AS5 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.19e-02 | NA | 0.013 | NA |
| 7. B | Q97EK9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.31e-03 | NA | 0.002 | NA |
| 7. B | P36619 | Leptomycin B resistance protein pmd1 | 1.54e-01 | NA | 0.005 | NA |
| 7. B | Q3Z3Q4 | Macrolide export ATP-binding/permease protein MacB | 1.47e-01 | NA | 2.11e-04 | NA |
| 7. B | P0CZ35 | Spermidine/putrescine import ATP-binding protein PotA | 2.15e-01 | NA | 1.17e-05 | NA |
| 7. B | P31134 | Putrescine transport ATP-binding protein PotG | 7.07e-02 | NA | 0.001 | NA |
| 7. B | Q0VTB6 | Zinc import ATP-binding protein ZnuC | 3.39e-02 | NA | 5.84e-05 | NA |
| 7. B | Q66CI3 | ATP-dependent lipid A-core flippase | 5.96e-02 | NA | 0.012 | NA |
| 7. B | O34814 | Cell division ATP-binding protein FtsE | 1.16e-02 | NA | 0.039 | NA |
| 7. B | Q3MGT2 | Phosphonates import ATP-binding protein PhnC | 4.21e-02 | NA | 0.019 | NA |
| 7. B | A3CMQ7 | Spermidine/putrescine import ATP-binding protein PotA | 8.36e-02 | NA | 1.09e-04 | NA |
| 7. B | Q8E2L3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.73e-02 | NA | 0.011 | NA |
| 7. B | Q9I6T2 | Spermidine/putrescine import ATP-binding protein PotA 1 | 1.10e-02 | NA | 0.007 | NA |
| 7. B | P0C2H2 | Macrolide export ATP-binding/permease protein MacB | 1.70e-01 | NA | 4.72e-04 | NA |
| 7. B | A0RP01 | Macrolide export ATP-binding/permease protein MacB | 1.41e-01 | NA | 0.002 | NA |
| 7. B | Q0TJM0 | Glutathione import ATP-binding protein GsiA | 2.23e-03 | NA | 0.002 | NA |
| 7. B | Q8ES39 | Putative ABC transporter ATP-binding protein OB0804 | 7.16e-04 | NA | 0.034 | NA |
| 7. B | Q83LT3 | Glutathione import ATP-binding protein GsiA | 2.19e-03 | NA | 6.11e-04 | NA |
| 7. B | Q97N51 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.03e-02 | NA | 0.030 | NA |
| 7. B | P45052 | Oligopeptide transport ATP-binding protein OppD | 2.05e-02 | NA | 2.24e-05 | NA |
| 7. B | Q1JEC8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.91e-03 | NA | 0.024 | NA |
| 7. B | P0CZ34 | Spermidine/putrescine import ATP-binding protein PotA | 2.34e-01 | NA | 1.17e-05 | NA |
| 7. B | Q06034 | Multidrug resistance protein 1 | 7.09e-02 | NA | 3.08e-04 | NA |
| 7. B | Q12C33 | ATP-dependent lipid A-core flippase | 4.93e-02 | NA | 0.013 | NA |
| 7. B | Q8A1M1 | Lipoprotein-releasing system ATP-binding protein LolD | 1.32e-02 | NA | 0.001 | NA |
| 7. B | Q8EB59 | Hemin import ATP-binding protein HmuV | 2.76e-02 | NA | 9.01e-06 | NA |
| 7. B | Q02QM1 | Phosphonates import ATP-binding protein PhnC 1 | 2.83e-02 | NA | 7.11e-05 | NA |
| 7. B | Q09427 | ATP-binding cassette sub-family C member 8 | 2.32e-01 | NA | 0.001 | NA |
| 7. B | Q8K268 | ATP-binding cassette sub-family F member 3 | 1.02e-02 | NA | 0.006 | NA |
| 7. B | O58687 | DNA double-strand break repair Rad50 ATPase | 3.91e-01 | NA | 0.006 | NA |
| 7. B | Q7VUJ5 | Molybdenum import ATP-binding protein ModC | 3.64e-02 | NA | 0.003 | NA |
| 7. B | Q3A558 | Lipoprotein-releasing system ATP-binding protein LolD | 2.48e-02 | NA | 0.046 | NA |
| 7. B | Q9LJX0 | ABC transporter B family member 19 | 1.05e-01 | NA | 6.00e-04 | NA |
| 7. B | Q9HZS1 | Histidine transport ATP-binding protein HisP | 7.60e-02 | NA | 1.36e-06 | NA |
| 7. B | P77279 | Probable iron export ATP-binding protein FetA | 1.72e-02 | NA | 0.001 | NA |
| 7. B | Q28QF9 | Hemin import ATP-binding protein HmuV | 9.16e-03 | NA | 0.009 | NA |
| 7. B | P29927 | UvrABC system protein A (Fragment) | 2.93e-09 | NA | 1.83e-26 | NA |
| 7. B | Q32DZ9 | Macrolide export ATP-binding/permease protein MacB | 1.03e-01 | NA | 2.17e-04 | NA |
| 7. B | Q6G1V5 | Macrolide export ATP-binding/permease protein MacB | 1.82e-01 | NA | 5.64e-04 | NA |
| 7. B | Q31FG2 | ATP-dependent lipid A-core flippase | 1.66e-02 | NA | 0.006 | NA |
| 7. B | P75957 | Lipoprotein-releasing system ATP-binding protein LolD | 2.57e-02 | NA | 0.015 | NA |
| 7. B | Q5M244 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.06e-02 | NA | 0.003 | NA |
| 7. B | Q0TJH0 | Macrolide export ATP-binding/permease protein MacB | 2.12e-01 | NA | 2.25e-04 | NA |
| 7. B | Q74KF9 | Phosphate import ATP-binding protein PstB 1 | 4.85e-02 | NA | 0.034 | NA |
| 7. B | P0A192 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 1.21e-02 | NA | 6.39e-04 | NA |
| 7. B | P0AAG2 | Dipeptide transport ATP-binding protein DppD | 4.32e-02 | NA | 0.003 | NA |
| 7. B | Q6MPX9 | Macrolide export ATP-binding/permease protein MacB | 1.93e-01 | NA | 0.012 | NA |
| 7. B | Q81VQ2 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.17e-02 | NA | 2.59e-04 | NA |
| 7. B | Q9KTJ5 | Methionine import ATP-binding protein MetN | 6.15e-02 | NA | 0.035 | NA |
| 7. B | Q72D73 | Putative ABC transporter ATP-binding protein DVU_1056 | 4.73e-02 | NA | 0.002 | NA |
| 7. B | Q8T9W2 | ABC transporter B family member 5 | 2.85e-02 | NA | 4.88e-05 | NA |
| 7. B | Q5ZUH9 | ATP-dependent lipid A-core flippase | 1.30e-01 | NA | 0.002 | NA |
| 7. B | Q9HY19 | Spermidine/putrescine import ATP-binding protein PotA 2 | 4.51e-02 | NA | 0.039 | NA |
| 7. B | Q8X8E3 | Lipoprotein-releasing system ATP-binding protein LolD | 2.70e-02 | NA | 0.025 | NA |
| 7. B | O31711 | Uncharacterized ABC transporter ATP-binding protein YknY | 1.86e-02 | NA | 0.018 | NA |
| 7. B | Q7WGW1 | Sulfate/thiosulfate import ATP-binding protein CysA | 8.31e-02 | NA | 0.001 | NA |
| 7. B | Q9XDA6 | Zinc uptake system ATP-binding protein ZurA | 7.09e-05 | NA | 0.031 | NA |
| 7. B | Q4QJQ0 | Molybdenum import ATP-binding protein ModC | 1.43e-01 | NA | 0.023 | NA |
| 7. B | Q7NC40 | Phosphate import ATP-binding protein PstB | 1.84e-02 | NA | 0.025 | NA |
| 7. B | Q66FK0 | Hemin import ATP-binding protein HmuV | 3.26e-02 | NA | 1.93e-04 | NA |
| 7. B | P33916 | Uncharacterized ABC transporter ATP-binding protein YejF | 3.73e-04 | NA | 0.015 | NA |
| 7. B | Q0T5R2 | Spermidine/putrescine import ATP-binding protein PotA | 2.88e-02 | NA | 0.014 | NA |
| 7. B | B5FJ99 | Vitamin B12 import ATP-binding protein BtuD | 4.94e-03 | NA | 7.39e-05 | NA |
| 7. B | Q45460 | Choline transport ATP-binding protein OpuBA | 3.07e-01 | NA | 0.004 | NA |
| 7. B | Q54BT3 | ABC transporter B family member 2 | 2.13e-01 | NA | 0.046 | NA |
| 7. B | Q4L5B3 | Spermidine/putrescine import ATP-binding protein PotA | 6.71e-02 | NA | 0.018 | NA |
| 7. B | Q0I5E9 | Methionine import ATP-binding protein MetN | 6.02e-02 | NA | 0.004 | NA |
| 7. B | Q1CFP9 | Molybdenum import ATP-binding protein ModC | 7.30e-02 | NA | 0.002 | NA |
| 7. B | Q8YM92 | Spermidine/putrescine import ATP-binding protein PotA | 5.17e-02 | NA | 0.014 | NA |
| 7. B | Q492R2 | Lipoprotein-releasing system ATP-binding protein LolD | 2.53e-02 | NA | 1.37e-04 | NA |
| 7. B | Q9Z8J5 | Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 | 6.18e-05 | NA | 2.46e-04 | NA |
| 7. B | P9WQI2 | Trehalose import ATP-binding protein SugC | 2.73e-02 | NA | 0.037 | NA |
| 7. B | Q884I3 | Lipoprotein-releasing system ATP-binding protein LolD | 2.98e-02 | NA | 1.30e-04 | NA |
| 7. B | Q8DFQ4 | Zinc import ATP-binding protein ZnuC | 8.57e-03 | NA | 0.002 | NA |
| 7. B | Q5X498 | ATP-dependent lipid A-core flippase | 1.55e-01 | NA | 0.002 | NA |
| 7. B | P77795 | Uncharacterized ABC transporter ATP-binding protein YdcT | 1.93e-02 | NA | 0.015 | NA |
| 7. B | Q0B5V4 | Arabinose import ATP-binding protein AraG 2 | 5.95e-04 | NA | 7.78e-04 | NA |
| 7. B | Q9PKX1 | Probable metal transport system ATP-binding protein TC_0339 | 7.54e-05 | NA | 0.019 | NA |
| 7. B | Q8R9L8 | Putative ABC transporter ATP-binding protein TTE1589 | 2.87e-04 | NA | 1.61e-04 | NA |
| 7. B | Q03PY5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.41e-02 | NA | 0.036 | NA |
| 7. B | Q93DX8 | Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) | 4.06e-02 | NA | 0.010 | NA |
| 7. B | Q3B5J7 | Macrolide export ATP-binding/permease protein MacB | 2.02e-01 | NA | 0.001 | NA |
| 7. B | P45861 | Uncharacterized ABC transporter ATP-binding protein YwjA | 4.60e-02 | NA | 0.012 | NA |
| 7. B | Q32EX7 | Lipoprotein-releasing system ATP-binding protein LolD | 2.47e-02 | NA | 0.015 | NA |
| 7. B | Q3JUI6 | ATP-dependent lipid A-core flippase | 1.78e-02 | NA | 0.006 | NA |
| 7. B | Q8ETV6 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.96e-02 | NA | 0.003 | NA |
| 7. B | B2RX12 | ATP-binding cassette sub-family C member 3 | 2.94e-01 | NA | 0.003 | NA |
| 7. B | Q2A1U9 | ATP-dependent lipid A-core flippase | 1.01e-01 | NA | 0.017 | NA |
| 7. B | Q8LPK2 | ABC transporter B family member 2 | 2.13e-02 | NA | 1.25e-04 | NA |
| 7. B | Q5PDU4 | Cobalt import ATP-binding protein CbiO | 8.13e-03 | NA | 0.001 | NA |
| 7. B | Q3Z3K7 | ATP-dependent lipid A-core flippase | 3.88e-02 | NA | 0.004 | NA |
| 7. B | A0A059JK44 | ABC multidrug transporter MDR2 | 8.71e-02 | NA | 0.002 | NA |
| 7. B | Q7NAQ7 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 5.09e-02 | NA | 0.014 | NA |
| 7. B | Q6D4A8 | Zinc import ATP-binding protein ZnuC | 5.18e-03 | NA | 1.14e-04 | NA |
| 7. B | O83321 | Probable riboflavin import ATP-binding protein RfuB | 2.18e-02 | NA | 0.011 | NA |
| 7. B | Q5NQX0 | Cytochrome c biogenesis ATP-binding export protein CcmA | 2.96e-02 | NA | 0.017 | NA |
| 7. B | O34900 | L-cystine import ATP-binding protein TcyN | 9.47e-02 | NA | 1.18e-05 | NA |
| 7. B | P44407 | ATP-dependent lipid A-core flippase | 9.31e-02 | NA | 0.001 | NA |
| 7. B | Q4FTM3 | Lipoprotein-releasing system ATP-binding protein LolD | 4.55e-02 | NA | 0.001 | NA |
| 7. B | Q7VL52 | ATP-dependent lipid A-core flippase | 4.24e-02 | NA | 1.27e-04 | NA |
| 7. B | Q05596 | Cobalt import ATP-binding protein CbiO | 8.30e-03 | NA | 0.002 | NA |
| 7. B | D3ZCM3 | ATP-binding cassette subfamily G member 4 | 1.50e-01 | NA | 0.041 | NA |
| 7. B | O54187 | Putative ABC transporter ATP-binding protein SCO5958 | 8.54e-03 | NA | 0.049 | NA |
| 7. B | Q84EY8 | Hemin import ATP-binding protein HmuV | 1.50e-02 | NA | 0.002 | NA |
| 7. B | Q03ZQ0 | Spermidine/putrescine import ATP-binding protein PotA | 3.82e-02 | NA | 0.001 | NA |
| 7. B | O29527 | Putative ABC transporter ATP-binding protein AF_0731 | 1.34e-02 | NA | 0.033 | NA |
| 7. B | P0CL93 | Iron-sulfur clusters transporter ATM1, mitochondrial | 5.12e-02 | NA | 0.012 | NA |
| 7. B | P22638 | Heterocyst differentiation ATP-binding protein HepA | 2.69e-02 | NA | 0.002 | NA |
| 7. B | Q48QM3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.95e-03 | NA | 0.017 | NA |
| 7. B | Q2K0S7 | Ribose import ATP-binding protein RbsA 3 | 1.12e-03 | NA | 0.029 | NA |
| 7. B | Q1R3Q1 | Maltose/maltodextrin import ATP-binding protein MalK | 2.07e-02 | NA | 0.014 | NA |
| 7. B | Q8D653 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.54e-02 | NA | 5.75e-04 | NA |
| 7. B | Q83RS0 | Lipoprotein-releasing system ATP-binding protein LolD | 2.50e-02 | NA | 0.019 | NA |
| 7. B | Q31ZH4 | Lipoprotein-releasing system ATP-binding protein LolD | 2.55e-02 | NA | 0.018 | NA |
| 7. B | P19566 | Maltose/maltodextrin import ATP-binding protein MalK | 2.05e-02 | NA | 0.003 | NA |
| 7. B | Q58418 | Phosphate import ATP-binding protein PstB | 1.31e-02 | NA | 0.022 | NA |
| 7. B | Q12R52 | Hemin import ATP-binding protein HmuV | 1.87e-02 | NA | 2.39e-04 | NA |
| 7. B | Q579H8 | Methionine import ATP-binding protein MetN | 7.16e-02 | NA | 0.040 | NA |
| 7. B | P39456 | L-cystine import ATP-binding protein TcyC | 9.56e-03 | NA | 1.02e-05 | NA |
| 7. B | Q9CL63 | Ribose import ATP-binding protein RbsA 2 | 3.18e-03 | NA | 0.005 | NA |
| 7. B | Q9S472 | L-arabinose transport ATP-binding protein AraG | 9.88e-04 | NA | 0.035 | NA |
| 7. B | Q5PKZ8 | Maltose/maltodextrin import ATP-binding protein MalK | 1.72e-02 | NA | 0.006 | NA |
| 7. B | Q5QU36 | ATP-dependent lipid A-core flippase | 9.71e-02 | NA | 0.002 | NA |
| 7. B | O68877 | Hemin import ATP-binding protein HmuV | 3.39e-02 | NA | 0.015 | NA |
| 7. B | P47545 | Putative ABC transporter ATP-binding protein MG303 | 1.50e-02 | NA | 0.004 | NA |
| 7. B | Q4ZU82 | Phosphonates import ATP-binding protein PhnC 2 | 2.09e-02 | NA | 4.52e-04 | NA |
| 7. B | P0A9S9 | High-affinity branched-chain amino acid transport ATP-binding protein LivG | 4.80e-03 | NA | 3.07e-04 | NA |
| 7. B | Q0T6D3 | Glutathione import ATP-binding protein GsiA | 4.23e-04 | NA | 7.57e-04 | NA |
| 7. B | A0R8K8 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.13e-02 | NA | 2.59e-04 | NA |
| 7. B | Q8KFE9 | Macrolide export ATP-binding/permease protein MacB | 2.97e-01 | NA | 0.034 | NA |
| 7. B | A0KPH6 | Zinc import ATP-binding protein ZnuC | 1.99e-02 | NA | 0.001 | NA |
| 7. B | Q68W42 | Putative export ATP-binding/permease protein RT0691 | 2.50e-02 | NA | 1.94e-04 | NA |
| 7. B | P63360 | ATP-dependent lipid A-core flippase | 2.37e-02 | NA | 0.008 | NA |
| 7. B | Q83LR7 | Macrolide export ATP-binding/permease protein MacB | 1.83e-01 | NA | 2.08e-04 | NA |
| 7. B | Q8PYH5 | Putative ABC transporter ATP-binding protein MM_0887 | 1.12e-02 | NA | 0.005 | NA |
| 7. B | Q04CG8 | Phosphonates import ATP-binding protein PhnC | 1.97e-02 | NA | 0.015 | NA |
| 7. B | Q81TH8 | Spermidine/putrescine import ATP-binding protein PotA | 4.33e-02 | NA | 0.001 | NA |
| 7. B | Q6LQ00 | Putative ABC transporter ATP-binding protein PBPRA2240 | 5.78e-04 | NA | 0.011 | NA |
| 7. B | P07821 | Iron(3+)-hydroxamate import ATP-binding protein FhuC | 7.95e-03 | NA | 0.007 | NA |
| 7. B | Q18CI9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.24e-03 | NA | 0.047 | NA |
| 7. B | P0C0E9 | Energy-coupling factor transporter ATP-binding protein EcfA | 1.04e-02 | NA | 0.024 | NA |
| 7. B | Q99T13 | Putative multidrug export ATP-binding/permease protein SAV1866 | 4.38e-02 | NA | 0.041 | NA |
| 7. B | Q4QK57 | Spermidine/putrescine import ATP-binding protein PotA | 1.99e-02 | NA | 0.003 | NA |
| 7. B | Q0TGX4 | Zinc import ATP-binding protein ZnuC | 5.65e-03 | NA | 0.001 | NA |
| 7. B | Q9K0N7 | Macrolide export ATP-binding/permease protein MacB | 2.10e-01 | NA | 0.003 | NA |
| 7. B | Q97KS6 | Spermidine/putrescine import ATP-binding protein PotA | 2.51e-02 | NA | 0.011 | NA |
| 7. B | Q4KFA2 | Lipoprotein-releasing system ATP-binding protein LolD | 2.68e-02 | NA | 1.45e-04 | NA |
| 7. B | A0KGB3 | Macrolide export ATP-binding/permease protein MacB 1 | 2.79e-01 | NA | 3.53e-04 | NA |
| 7. B | P11599 | Alpha-hemolysin translocation ATP-binding protein HlyB | 1.46e-02 | NA | 0.026 | NA |
| 7. B | Q03ZL6 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.58e-02 | NA | 0.047 | NA |
| 7. B | Q4QPI4 | ATP-dependent lipid A-core flippase | 7.44e-02 | NA | 0.006 | NA |
| 7. B | P08183 | ATP-dependent translocase ABCB1 | 1.35e-01 | NA | 0.001 | NA |
| 7. B | Q6RCE0 | Phosphonates import ATP-binding protein PhnC | 3.04e-02 | NA | 0.015 | NA |
| 7. B | Q1JBV6 | Spermidine/putrescine import ATP-binding protein PotA | 1.93e-01 | NA | 8.89e-06 | NA |
| 7. B | Q399M3 | Macrolide export ATP-binding/permease protein MacB | 2.23e-01 | NA | 3.87e-04 | NA |
| 7. B | P0CZ26 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.98e-03 | NA | 0.019 | NA |
| 7. B | Q1CJG3 | Zinc import ATP-binding protein ZnuC | 2.38e-02 | NA | 3.80e-05 | NA |
| 7. B | Q4A5A5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.08e-02 | NA | 0.006 | NA |
| 7. B | Q89NX6 | Macrolide export ATP-binding/permease protein MacB | 2.08e-01 | NA | 8.47e-04 | NA |
| 7. B | Q39T41 | Lipoprotein-releasing system ATP-binding protein LolD | 2.19e-02 | NA | 3.65e-05 | NA |
| 7. B | B7VPD0 | Vitamin B12 import ATP-binding protein BtuD | 6.60e-03 | NA | 0.021 | NA |
| 7. B | Q48PV0 | Zinc import ATP-binding protein ZnuC | 2.81e-02 | NA | 0.002 | NA |
| 7. B | Q24XJ2 | Spermidine/putrescine import ATP-binding protein PotA | 1.73e-02 | NA | 0.002 | NA |
| 7. B | P55604 | Uncharacterized ABC transporter ATP-binding protein y4oS | 1.88e-02 | NA | 0.020 | NA |
| 7. B | A0PY57 | Spermidine/putrescine import ATP-binding protein PotA | 1.72e-02 | NA | 5.35e-06 | NA |
| 7. B | Q8ZGX6 | Molybdenum import ATP-binding protein ModC | 4.01e-02 | NA | 0.002 | NA |
| 7. B | Q6G868 | Putative multidrug export ATP-binding/permease protein SAS1788 | 4.27e-02 | NA | 0.041 | NA |
| 7. B | P0A9U0 | Uncharacterized ABC transporter ATP-binding protein YbbA | 5.60e-02 | NA | 0.001 | NA |
| 7. B | Q86HQ2 | ABC transporter G family member 8 | 2.05e-01 | NA | 0.022 | NA |
| 7. B | Q1M5X4 | Ribose import ATP-binding protein RbsA 2 | 5.71e-03 | NA | 0.015 | NA |
| 7. B | A2RI78 | Dipeptide transport ATP-binding protein DppF | 6.81e-02 | NA | 2.83e-04 | NA |
| 7. B | Q8Y454 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.92e-03 | NA | 0.021 | NA |
| 7. B | Q660M8 | Spermidine/putrescine import ATP-binding protein PotA | 1.73e-02 | NA | 5.84e-04 | NA |
| 7. B | Q59R09 | Iron-sulfur clusters transporter ATM1, mitochondrial | 3.59e-02 | NA | 0.031 | NA |
| 7. B | Q64Z80 | Lipoprotein-releasing system ATP-binding protein LolD | 1.26e-02 | NA | 0.002 | NA |
| 7. B | Q00564 | Lactococcin-A transport/processing ATP-binding protein LcnC | 1.38e-02 | NA | 0.002 | NA |
| 7. B | Q7NPP4 | Phosphate import ATP-binding protein PstB 1 | 2.99e-02 | NA | 0.007 | NA |
| 7. B | Q8E554 | Spermidine/putrescine import ATP-binding protein PotA | 2.21e-01 | NA | 1.43e-04 | NA |
| 7. B | P0AAG4 | Glutamate/aspartate import ATP-binding protein GltL | 2.75e-02 | NA | 0.006 | NA |
| 7. B | Q73F67 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.19e-02 | NA | 1.44e-04 | NA |
| 7. B | Q891M1 | Ribose import ATP-binding protein RbsA | 1.07e-03 | NA | 4.87e-04 | NA |
| 7. B | Q8D2U8 | ATP-dependent lipid A-core flippase | 3.16e-02 | NA | 0.007 | NA |
| 7. B | Q7CIC2 | Zinc import ATP-binding protein ZnuC | 1.95e-02 | NA | 3.80e-05 | NA |
| 7. B | Q880A6 | Phosphate import ATP-binding protein PstB 1 | 1.74e-02 | NA | 0.016 | NA |
| 7. B | Q9JW59 | ATP-dependent lipid A-core flippase | 2.81e-02 | NA | 0.002 | NA |
| 7. B | Q1J983 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.06e-03 | NA | 0.017 | NA |
| 7. B | P22731 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 1.10e-02 | NA | 0.004 | NA |
| 7. B | Q9X1Z1 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 5.01e-03 | NA | 0.004 | NA |
| 7. B | Q9SZR9 | ABC transporter G family member 9 | 2.97e-01 | NA | 0.003 | NA |
| 7. B | Q93D97 | Putative ABC transporter ATP-binding protein SMU_1934c | 7.34e-04 | NA | 0.015 | NA |
| 7. B | Q8X8K4 | Uncharacterized ABC transporter ATP-binding protein YcjV | 2.17e-02 | NA | 0.001 | NA |
| 7. B | Q7VMF9 | Macrolide export ATP-binding/permease protein MacB | 1.95e-01 | NA | 0.004 | NA |
| 7. B | P75831 | Macrolide export ATP-binding/permease protein MacB | 1.60e-01 | NA | 2.25e-04 | NA |
| 7. B | Q74L61 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 8.99e-03 | NA | 0.001 | NA |
| 7. B | Q1CC21 | Maltose/maltodextrin import ATP-binding protein MalK | 2.09e-02 | NA | 0.008 | NA |
| 7. B | Q1H0W2 | Hemin import ATP-binding protein HmuV | 2.81e-02 | NA | 0.008 | NA |
| 7. B | Q9CGD4 | Spermidine/putrescine import ATP-binding protein PotA | 9.13e-02 | NA | 0.001 | NA |
| 7. B | Q8XJX3 | Ribose import ATP-binding protein RbsA | 1.01e-03 | NA | 6.20e-05 | NA |
| 7. B | Q6LTB1 | Zinc import ATP-binding protein ZnuC | 7.31e-03 | NA | 1.04e-05 | NA |
| 7. B | Q7CN92 | Spermidine/putrescine import ATP-binding protein PotA | 1.00e-01 | NA | 2.22e-05 | NA |
| 7. B | Q9FNU2 | ABC transporter B family member 25 | 5.30e-02 | NA | 3.31e-04 | NA |
| 7. B | Q1QCN2 | Lipoprotein-releasing system ATP-binding protein LolD | 4.75e-02 | NA | 0.001 | NA |
| 7. B | Q5RFQ9 | Mitochondrial potassium channel ATP-binding subunit | 2.99e-02 | NA | 2.18e-04 | NA |
| 7. B | Q5JEB0 | Molybdate/tungstate import ATP-binding protein WtpC | 3.52e-02 | NA | 6.68e-05 | NA |
| 7. B | P10089 | Alpha-hemolysin translocation ATP-binding protein HlyB | 2.05e-01 | NA | 0.048 | NA |
| 7. B | Q8FJL0 | Glutathione import ATP-binding protein GsiA | 2.14e-03 | NA | 0.002 | NA |
| 7. B | Q4WSI1 | ABC multidrug transporter mdr4 | 1.30e-01 | NA | 2.50e-05 | NA |
| 7. B | Q4ZT65 | Macrolide export ATP-binding/permease protein MacB 2 | 2.05e-01 | NA | 0.012 | NA |
| 7. B | Q04JW0 | Spermidine/putrescine import ATP-binding protein PotA | 2.50e-01 | NA | 1.23e-04 | NA |
| 7. B | Q6FYL0 | Macrolide export ATP-binding/permease protein MacB | 2.81e-01 | NA | 0.002 | NA |
| 7. B | P71082 | Putative multidrug export ATP-binding/permease protein YgaD | 2.36e-02 | NA | 0.002 | NA |
| 7. B | Q5M397 | Spermidine/putrescine import ATP-binding protein PotA | 9.26e-02 | NA | 2.19e-06 | NA |
| 7. B | Q63H62 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.82e-02 | NA | 0.001 | NA |
| 7. B | Q0A9E2 | Zinc import ATP-binding protein ZnuC | 1.21e-02 | NA | 5.23e-05 | NA |
| 7. B | Q3J7R8 | ATP-dependent lipid A-core flippase | 2.69e-02 | NA | 3.21e-05 | NA |
| 7. B | Q04EY4 | Energy-coupling factor transporter ATP-binding protein EcfA3 | 1.93e-02 | NA | 1.03e-04 | NA |
| 7. B | Q8U4K3 | Molybdate/tungstate import ATP-binding protein WtpC | 2.11e-02 | NA | 3.80e-04 | NA |
| 7. B | Q63E84 | Spermidine/putrescine import ATP-binding protein PotA | 1.23e-02 | NA | 0.001 | NA |
| 7. B | Q9M1Q9 | ABC transporter B family member 21 | 9.54e-02 | NA | 0.009 | NA |
| 7. B | Q1WVI7 | Spermidine/putrescine import ATP-binding protein PotA | 1.23e-02 | NA | 0.002 | NA |
| 7. B | Q2Y624 | Lipoprotein-releasing system ATP-binding protein LolD | 2.52e-02 | NA | 0.001 | NA |
| 7. B | Q3Z3V4 | Glutathione import ATP-binding protein GsiA | 2.12e-03 | NA | 7.70e-04 | NA |
| 7. B | P70170 | ATP-binding cassette sub-family C member 9 | 6.55e-02 | NA | 0.006 | NA |
| 7. B | Q83D84 | ATP-dependent lipid A-core flippase | 2.27e-02 | NA | 1.31e-04 | NA |
| 7. B | Q15TB1 | Lipoprotein-releasing system ATP-binding protein LolD | 3.44e-02 | NA | 4.96e-05 | NA |
| 7. B | P0A9X2 | Zinc import ATP-binding protein ZnuC | 5.01e-03 | NA | 0.001 | NA |
| 7. B | Q67JX4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.79e-02 | NA | 0.005 | NA |
| 7. B | Q6C6N0 | Iron-sulfur clusters transporter ATM1, mitochondrial | 1.12e-01 | NA | 0.010 | NA |
| 7. B | Q7VZE5 | Sulfate/thiosulfate import ATP-binding protein CysA | 8.25e-02 | NA | 0.001 | NA |
| 7. B | Q8FHR3 | Uncharacterized ABC transporter ATP-binding protein YcjV | 3.76e-02 | NA | 0.002 | NA |
| 7. B | Q2KVS6 | Macrolide export ATP-binding/permease protein MacB | 2.08e-01 | NA | 1.26e-04 | NA |
| 7. B | Q6F1W5 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.63e-02 | NA | 0.036 | NA |
| 7. B | Q0VQP5 | ATP-dependent lipid A-core flippase | 1.04e-02 | NA | 9.06e-06 | NA |
| 7. B | P40790 | Spermidine/putrescine import ATP-binding protein PotA | 4.54e-02 | NA | 0.002 | NA |
| 7. B | Q12M46 | ATP-dependent lipid A-core flippase | 1.66e-01 | NA | 0.019 | NA |
| 7. B | Q4L8L7 | Putative hemin import ATP-binding protein HrtA | 7.29e-02 | NA | 0.021 | NA |
| 7. B | Q2KYS6 | ATP-dependent lipid A-core flippase | 3.75e-02 | NA | 3.40e-04 | NA |
| 7. B | P37732 | Molybdenum import ATP-binding protein ModC 1 | 6.93e-02 | NA | 0.002 | NA |
| 7. B | O30506 | Arginine/ornithine transport ATP-binding protein AotP | 6.83e-02 | NA | 6.01e-04 | NA |
| 7. B | F2RP52 | ABC multidrug transporter MDR2 | 1.28e-01 | NA | 0.005 | NA |
| 7. B | Q5E5I1 | Hemin import ATP-binding protein HmuV | 4.28e-02 | NA | 0.007 | NA |
| 7. B | Q8NR42 | Aliphatic sulfonates import ATP-binding protein SsuB | 4.80e-02 | NA | 0.013 | NA |
| 7. B | Q9KL04 | Maltose/maltodextrin import ATP-binding protein MalK | 3.47e-02 | NA | 0.023 | NA |
| 7. B | Q60AA3 | ATP-dependent lipid A-core flippase | 2.09e-02 | NA | 2.56e-04 | NA |
| 7. B | Q9WY65 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 7.41e-03 | NA | 0.002 | NA |
| 7. B | Q5WET8 | Phosphate import ATP-binding protein PstB 1 | 2.76e-02 | NA | 0.003 | NA |
| 7. B | Q1RGL1 | Zinc import ATP-binding protein ZnuC | 3.11e-02 | NA | 1.10e-04 | NA |
| 7. B | Q9NUT2 | Mitochondrial potassium channel ATP-binding subunit | 1.22e-01 | NA | 3.48e-04 | NA |
| 7. B | A1K323 | Macrolide export ATP-binding/permease protein MacB | 1.89e-01 | NA | 8.48e-04 | NA |
| 7. B | P50332 | Nod factor export ATP-binding protein I | 3.82e-02 | NA | 0.026 | NA |
| 7. B | Q890D1 | Nickel import ATP-binding protein LarO | 6.42e-03 | NA | 0.026 | NA |
| 7. B | Q8NR12 | Ribose import ATP-binding protein RbsA | 7.91e-04 | NA | 0.003 | NA |
| 7. B | Q6F9A8 | Sulfate/thiosulfate import ATP-binding protein CysA | 3.86e-03 | NA | 2.03e-05 | NA |
| 7. B | P21449 | Multidrug resistance protein 2 | 9.49e-02 | NA | 2.78e-04 | NA |
| 7. B | Q4QND5 | Zinc import ATP-binding protein ZnuC | 8.43e-03 | NA | 0.043 | NA |
| 7. B | Q6NJ07 | Methionine import ATP-binding protein MetN | 5.50e-02 | NA | 0.007 | NA |
| 7. B | O34979 | Uncharacterized ABC transporter ATP-binding protein YvrO | 2.28e-02 | NA | 6.86e-05 | NA |
| 7. B | Q323M3 | Macrolide export ATP-binding/permease protein MacB | 1.39e-01 | NA | 0.001 | NA |
| 7. B | P07109 | Histidine transport ATP-binding protein HisP | 9.66e-02 | NA | 5.21e-07 | NA |
| 7. B | Q6AE21 | Methionine import ATP-binding protein MetN | 5.23e-02 | NA | 6.93e-04 | NA |
| 7. B | Q09429 | ATP-binding cassette sub-family C member 8 | 8.34e-02 | NA | 0.002 | NA |
| 7. B | Q1BPZ6 | Macrolide export ATP-binding/permease protein MacB | 1.97e-01 | NA | 4.13e-04 | NA |
| 7. B | Q7MJ07 | ATP-dependent lipid A-core flippase | 1.68e-02 | NA | 1.78e-04 | NA |
| 7. B | P16678 | Putative phosphonates utilization ATP-binding protein PhnK | 1.27e-02 | NA | 0.001 | NA |
| 7. B | Q8XIZ5 | Spermidine/putrescine import ATP-binding protein PotA | 2.02e-02 | NA | 0.002 | NA |
| 7. B | Q217B2 | Hemin import ATP-binding protein HmuV | 2.46e-02 | NA | 2.81e-05 | NA |
| 7. B | Q54RU1 | ABC transporter B family member 6 | 4.53e-02 | NA | 0.028 | NA |
| 7. B | Q9M0M2 | ABC transporter B family member 9 | 1.08e-01 | NA | 0.010 | NA |
| 7. B | Q0HVQ0 | Lipoprotein-releasing system ATP-binding protein LolD | 2.45e-02 | NA | 0.004 | NA |
| 7. B | Q1QDA8 | Macrolide export ATP-binding/permease protein MacB | 1.81e-01 | NA | 0.002 | NA |
| 7. B | Q9Y8G1 | ABC multidrug transporter atrD | 5.22e-02 | NA | 0.017 | NA |
| 7. B | Q897I2 | Putative ABC transporter ATP-binding protein CTC_00753 | 7.11e-05 | NA | 1.06e-05 | NA |
| 7. B | Q1BWN5 | Ribose import ATP-binding protein RbsA 1 | 9.04e-04 | NA | 5.19e-04 | NA |
| 7. B | Q57R14 | ATP-dependent lipid A-core flippase | 3.28e-02 | NA | 0.008 | NA |
| 7. B | Q4FU75 | Macrolide export ATP-binding/permease protein MacB | 2.22e-01 | NA | 0.002 | NA |
| 7. B | Q9A7X1 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.21e-02 | NA | 0.046 | NA |
| 7. B | Q32E34 | ATP-dependent lipid A-core flippase | 2.79e-02 | NA | 0.004 | NA |
| 7. B | A1VYW8 | Macrolide export ATP-binding/permease protein MacB | 2.00e-01 | NA | 0.010 | NA |
| 7. B | P0A9X1 | Zinc import ATP-binding protein ZnuC | 5.19e-03 | NA | 0.001 | NA |
| 7. B | Q0TJD9 | ATP-dependent lipid A-core flippase | 3.97e-02 | NA | 0.004 | NA |
| 7. B | Q21TR5 | Putative ribose/galactose/methyl galactoside import ATP-binding protein | 7.96e-04 | NA | 0.009 | NA |
| 7. B | Q8T674 | ABC transporter G family member 20 | 1.96e-01 | NA | 0.007 | NA |
| 7. B | Q87G35 | Putative ABC transporter ATP-binding protein VPA1482 | 6.77e-04 | NA | 8.94e-04 | NA |
| 7. B | A1RG29 | Macrolide export ATP-binding/permease protein MacB | 2.83e-01 | NA | 0.003 | NA |
| 7. B | Q07LR5 | Methionine import ATP-binding protein MetN | 1.42e-01 | NA | 0.028 | NA |
| 7. B | Q52402 | Transport ATP-binding protein AarD | 2.90e-02 | NA | 0.002 | NA |
| 7. B | Q8R4P9 | ATP-binding cassette sub-family C member 10 | 2.52e-01 | NA | 0.015 | NA |
| 7. B | Q74AT2 | Lipoprotein-releasing system ATP-binding protein LolD | 3.06e-02 | NA | 3.48e-05 | NA |
| 7. B | Q8UH62 | Sulfate/thiosulfate import ATP-binding protein CysA 1 | 2.84e-04 | NA | 0.001 | NA |
| 7. B | Q57QC8 | Spermidine/putrescine import ATP-binding protein PotA | 6.67e-02 | NA | 0.002 | NA |
| 7. B | Q9LSJ5 | ABC transporter B family member 18 | 4.62e-02 | NA | 0.018 | NA |
| 7. B | Q2K4V4 | sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 | 3.25e-02 | NA | 0.001 | NA |
| 7. B | Q3KC21 | Molybdenum import ATP-binding protein ModC | 1.17e-01 | NA | 0.048 | NA |
| 7. B | Q59056 | Uncharacterized ABC transporter ATP-binding protein MJ1662 | 2.96e-04 | NA | 8.99e-04 | NA |
| 7. B | A1BE50 | Macrolide export ATP-binding/permease protein MacB | 2.23e-01 | NA | 0.047 | NA |
| 7. B | Q65T42 | Sulfate/thiosulfate import ATP-binding protein CysA | 1.86e-04 | NA | 0.035 | NA |
| 7. B | Q2SIN5 | ATP-dependent lipid A-core flippase | 1.68e-02 | NA | 2.37e-05 | NA |
| 7. B | Q03JH1 | Spermidine/putrescine import ATP-binding protein PotA | 8.81e-02 | NA | 2.52e-06 | NA |
| 7. B | A2RH10 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 9.11e-03 | NA | 0.017 | NA |
| 7. B | P13568 | Multidrug resistance protein | 1.85e-01 | NA | 0.034 | NA |
| 7. B | Q9GTN7 | Serine protease/ABC transporter B family protein tagA | 1.64e-01 | NA | 1.42e-04 | NA |
| 7. B | A2RH11 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 9.81e-03 | NA | 0.024 | NA |
| 7. B | Q8RD07 | Putative ABC transporter ATP-binding protein TTE0246 | 8.39e-03 | NA | 3.43e-04 | NA |
| 7. B | Q2NK31 | Spermidine/putrescine import ATP-binding protein PotA | 1.38e-01 | NA | 0.019 | NA |
| 7. B | Q6HPM9 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.59e-02 | NA | 0.003 | NA |
| 7. B | Q63MM6 | Macrolide export ATP-binding/permease protein MacB | 2.33e-01 | NA | 5.45e-05 | NA |
| 7. B | Q6HLQ9 | Spermidine/putrescine import ATP-binding protein PotA | 1.28e-02 | NA | 0.001 | NA |
| 7. B | Q6NBX6 | Phosphonates import ATP-binding protein PhnC 1 | 2.89e-02 | NA | 0.013 | NA |
| 7. B | Q8FV85 | Methionine import ATP-binding protein MetN | 7.26e-02 | NA | 0.040 | NA |
| 7. B | Q46Y89 | ATP-dependent lipid A-core flippase | 2.21e-02 | NA | 0.009 | NA |
| 7. B | Q21JQ9 | Lipoprotein-releasing system ATP-binding protein LolD | 3.70e-02 | NA | 0.011 | NA |
| 7. B | Q2FVF0 | Metal-staphylopine import system ATP-binding protein CntD | 7.24e-03 | NA | 0.006 | NA |
| 7. B | Q6D8T5 | Macrolide export ATP-binding/permease protein MacB | 1.67e-01 | NA | 0.008 | NA |
| 7. B | Q8DPC2 | Spermidine/putrescine import ATP-binding protein PotA | 1.13e-01 | NA | 1.23e-04 | NA |
| 7. B | Q3ZA58 | Phosphate import ATP-binding protein PstB | 1.16e-02 | NA | 0.038 | NA |
| 7. B | Q6BXD7 | Iron-sulfur clusters transporter ATM1, mitochondrial | 8.06e-02 | NA | 0.001 | NA |
| 7. B | Q8DZJ0 | Spermidine/putrescine import ATP-binding protein PotA | 2.45e-02 | NA | 1.43e-04 | NA |
| 7. B | A0LCH8 | Zinc import ATP-binding protein ZnuC | 6.19e-03 | NA | 0.002 | NA |
| 7. B | Q13LX0 | Ribose import ATP-binding protein RbsA | 1.08e-03 | NA | 0.007 | NA |
| 7. B | P46920 | Glycine betaine transport ATP-binding protein OpuAA | 1.85e-01 | NA | 0.008 | NA |
| 7. B | O88563 | ATP-binding cassette sub-family C member 3 | 2.31e-01 | NA | 0.016 | NA |
| 7. B | Q0SSJ0 | Ribose import ATP-binding protein RbsA | 1.04e-03 | NA | 2.87e-04 | NA |
| 7. B | Q8ZQE4 | Macrolide export ATP-binding/permease protein MacB | 1.69e-01 | NA | 2.66e-04 | NA |
| 7. B | A0K718 | Ribose import ATP-binding protein RbsA 1 | 9.80e-04 | NA | 5.19e-04 | NA |
| 7. B | Q04G50 | Spermidine/putrescine import ATP-binding protein PotA | 3.85e-02 | NA | 9.52e-05 | NA |
| 7. B | Q9JXR3 | ATP-dependent lipid A-core flippase | 2.97e-02 | NA | 0.001 | NA |
| 7. B | P68187 | Maltose/maltodextrin import ATP-binding protein MalK | 1.99e-02 | NA | 0.014 | NA |
| 7. B | Q3JGG7 | Macrolide export ATP-binding/permease protein MacB | 2.79e-01 | NA | 5.45e-05 | NA |
| 7. B | Q1QBW0 | ATP-dependent lipid A-core flippase | 2.96e-02 | NA | 8.25e-04 | NA |
| 7. B | Q7UU57 | Ribose import ATP-binding protein RbsA | 9.56e-04 | NA | 0.048 | NA |
| 7. B | P75186 | Phosphate import ATP-binding protein PstB | 3.20e-02 | NA | 0.039 | NA |
| 7. B | Q035B3 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.33e-02 | NA | 0.015 | NA |
| 7. B | Q9C7F2 | ABC transporter B family member 14 | 6.11e-02 | NA | 3.99e-04 | NA |
| 7. B | Q5XCA4 | Spermidine/putrescine import ATP-binding protein PotA | 2.63e-01 | NA | 1.32e-05 | NA |
| 7. B | Q63563 | ATP-binding cassette sub-family C member 9 | 1.94e-01 | NA | 0.006 | NA |
| 7. B | A0B212 | Macrolide export ATP-binding/permease protein MacB | 2.02e-01 | NA | 4.06e-04 | NA |
| 7. B | Q8Z8R5 | Methionine import ATP-binding protein MetN 2 | 4.56e-02 | NA | 0.003 | NA |
| 7. B | Q9K7C3 | L-arabinose transport ATP-binding protein AraG | 1.28e-03 | NA | 0.008 | NA |
| 7. B | Q2LVL0 | ATP-dependent lipid A-core flippase | 2.05e-02 | NA | 4.78e-04 | NA |
| 7. B | Q9KHT9 | Carnitine transport ATP-binding protein OpuCA | 3.09e-02 | NA | 0.004 | NA |
| 7. B | Q93SS1 | Hemin import ATP-binding protein HmuV | 2.76e-02 | NA | 0.011 | NA |
| 7. B | Q08381 | Molybdenum import ATP-binding protein ModC | 5.43e-02 | NA | 0.036 | NA |
| 7. B | P9WQK1 | Uncharacterized ABC transporter ATP-binding protein Rv0986 | 2.53e-02 | NA | 0.018 | NA |
| 7. B | Q83CV2 | Lipoprotein-releasing system ATP-binding protein LolD | 2.29e-02 | NA | 0.025 | NA |
| 7. B | Q7N3S7 | Hemin import ATP-binding protein HmuV | 4.32e-02 | NA | 0.006 | NA |
| 7. B | Q1GL85 | Zinc import ATP-binding protein ZnuC | 2.29e-02 | NA | 0.044 | NA |
| 7. B | A3DDF6 | Spermidine/putrescine import ATP-binding protein PotA | 7.06e-02 | NA | 0.019 | NA |
| 7. B | Q97WH0 | DNA double-strand break repair Rad50 ATPase | 1.69e-01 | NA | 0.006 | NA |
| 7. B | Q8A883 | Spermidine/putrescine import ATP-binding protein PotA | 3.79e-02 | NA | 0.022 | NA |
| 7. B | A0KMJ3 | Macrolide export ATP-binding/permease protein MacB 2 | 3.03e-01 | NA | 5.79e-04 | NA |
| 7. B | Q8DWR4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.74e-02 | NA | 0.011 | NA |
| 7. B | J9VF33 | ABC multidrug transporter MDR1 | 4.55e-02 | NA | 0.042 | NA |
| 7. B | Q8TI15 | Putative ABC transporter ATP-binding protein MA_4342 | 6.47e-03 | NA | 6.62e-04 | NA |
| 7. B | Q4ZZS2 | Zinc import ATP-binding protein ZnuC | 2.62e-02 | NA | 0.001 | NA |
| 7. B | Q88J90 | Ribose import ATP-binding protein RbsA | 6.92e-04 | NA | 0.039 | NA |
| 7. B | Q9PPV2 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 2.94e-02 | NA | 0.010 | NA |
| 7. B | P0A2V2 | Octopine permease ATP-binding protein P | 1.04e-01 | NA | 0.003 | NA |
| 7. B | Q67JX3 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.12e-02 | NA | 0.007 | NA |
| 7. B | Q32IB5 | Glutathione import ATP-binding protein GsiA | 2.50e-03 | NA | 8.24e-04 | NA |
| 7. B | O34338 | Manganese transport system ATP-binding protein MntB | 1.49e-03 | NA | 8.55e-05 | NA |
| 7. B | Q5PCG9 | Methionine import ATP-binding protein MetN 2 | 4.40e-02 | NA | 0.003 | NA |
| 7. B | P12866 | Alpha-factor-transporting ATPase | 1.92e-01 | NA | 0.006 | NA |
| 7. B | Q8EUR3 | Spermidine/putrescine import ATP-binding protein PotA | 1.07e-01 | NA | 0.046 | NA |
| 7. B | Q1GC08 | Phosphonates import ATP-binding protein PhnC | 1.76e-02 | NA | 0.012 | NA |
| 7. B | Q7MFH3 | Putative ABC transporter ATP-binding protein VVA0347 | 6.24e-04 | NA | 0.016 | NA |
| 7. B | P33311 | ATP-dependent permease MDL2, mitochondrial | 4.29e-02 | NA | 4.14e-06 | NA |
| 7. B | Q58488 | Energy-coupling factor transporter ATP-binding protein EcfA | 7.09e-03 | NA | 0.013 | NA |
| 7. B | Q5WXF0 | Spermidine/putrescine import ATP-binding protein PotA | 1.71e-02 | NA | 0.007 | NA |
| 7. B | Q4ZZ16 | ATP-dependent lipid A-core flippase | 6.07e-02 | NA | 4.31e-04 | NA |
| 7. B | Q7VWD8 | ATP-dependent lipid A-core flippase | 6.88e-02 | NA | 1.18e-04 | NA |
| 7. B | P15031 | Fe(3+) dicitrate transport ATP-binding protein FecE | 1.55e-02 | NA | 3.85e-04 | NA |
| 7. B | Q88F88 | Macrolide export ATP-binding/permease protein MacB | 3.51e-01 | NA | 0.021 | NA |
| 7. B | Q83LP0 | ATP-dependent lipid A-core flippase | 4.07e-02 | NA | 0.004 | NA |
| 7. B | Q7A0J1 | Putative multidrug export ATP-binding/permease protein MW1806 | 4.39e-02 | NA | 0.041 | NA |
| 7. B | Q9CIS8 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.17e-02 | NA | 0.048 | NA |
| 7. B | Q1RE44 | Macrolide export ATP-binding/permease protein MacB | 1.92e-01 | NA | 2.25e-04 | NA |
| 7. B | Q9SGY1 | ABC transporter B family member 10 | 1.75e-01 | NA | 3.82e-06 | NA |
| 7. B | Q88KY4 | Lipoprotein-releasing system ATP-binding protein LolD | 2.87e-02 | NA | 1.85e-04 | NA |
| 7. B | Q8CK44 | Ribose import ATP-binding protein RbsA 1 | 9.42e-04 | NA | 0.006 | NA |
| 7. B | Q9Z810 | Probable metal transport system ATP-binding protein CPn_0542/CP_0210/CPj0542/CpB0563 | 1.27e-01 | NA | 0.046 | NA |
| 7. B | Q3ZWN4 | Phosphate import ATP-binding protein PstB | 1.11e-02 | NA | 0.041 | NA |
| 7. B | Q6N9W0 | Methionine import ATP-binding protein MetN 1 | 1.22e-01 | NA | 0.016 | NA |
| 7. B | P47433 | Putative ABC transporter ATP-binding protein MG187 | 3.07e-02 | NA | 0.026 | NA |
| 7. B | O34992 | Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA | 2.74e-02 | NA | 0.001 | NA |
| 7. B | Q02592 | Heavy metal tolerance protein | 1.22e-01 | NA | 6.44e-06 | NA |
| 7. B | Q5FFT1 | Phosphate import ATP-binding protein PstB | 1.08e-02 | NA | 0.008 | NA |
| 7. B | Q5HVG3 | Macrolide export ATP-binding/permease protein MacB | 3.03e-01 | NA | 0.007 | NA |
| 7. B | Q02R79 | Spermidine/putrescine import ATP-binding protein PotA | 4.56e-02 | NA | 0.039 | NA |
| 7. B | Q4A5A4 | Energy-coupling factor transporter ATP-binding protein EcfA2 | 1.24e-02 | NA | 0.001 | NA |
| 7. B | Q8XZX8 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | 5.14e-02 | NA | 0.001 | NA |
| 7. B | P55570 | Uncharacterized ABC transporter ATP-binding protein y4mK | 2.54e-03 | NA | 0.049 | NA |
| 7. B | O60706 | ATP-binding cassette sub-family C member 9 | 6.13e-02 | NA | 0.002 | NA |
| 7. B | G2JZ44 | Carnitine transport ATP-binding protein OpuCA | 2.62e-02 | NA | 0.004 | NA |
| 7. B | Q6HPN0 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.16e-02 | NA | 2.59e-04 | NA |
| 7. B | Q0I4C5 | ATP-dependent lipid A-core flippase | 3.28e-02 | NA | 0.003 | NA |
| 7. B | Q73P93 | Putative ABC transporter ATP-binding protein TDE_0906 | 7.08e-04 | NA | 0.005 | NA |
| 7. B | Q8D928 | Vitamin B12 import ATP-binding protein BtuD | 2.36e-02 | NA | 0.009 | NA |
| 7. B | Q9ZCM8 | Putative export ATP-binding/permease protein RP696 | 2.31e-02 | NA | 2.71e-04 | NA |
| 7. B | Q7ULB5 | Macrolide export ATP-binding/permease protein MacB | 1.09e-01 | NA | 0.002 | NA |
| 7. B | Q8F6Z1 | Sulfate/thiosulfate import ATP-binding protein CysA | 4.69e-03 | NA | 0.006 | NA |
| 7. B | Q96YR5 | DNA double-strand break repair Rad50 ATPase | 2.73e-01 | NA | 0.049 | NA |
| 7. B | Q4K5Z7 | Hemin import ATP-binding protein HmuV | 1.82e-02 | NA | 0.025 | NA |
| 7. B | Q9F9B0 | Fructose import ATP-binding protein FrcA | 2.84e-02 | NA | 0.012 | NA |
| 7. B | Q1I4Q5 | Hemin import ATP-binding protein HmuV | 2.05e-02 | NA | 0.002 | NA |
| 7. B | Q6N7Y6 | Hemin import ATP-binding protein HmuV | 2.65e-02 | NA | 1.39e-06 | NA |
| 7. B | Q39BJ8 | Arabinose import ATP-binding protein AraG 2 | 5.75e-04 | NA | 7.48e-04 | NA |
| 7. B | Q3KKA1 | Zinc import ATP-binding protein ZnuC | 3.13e-02 | NA | 4.99e-04 | NA |
| 7. B | Q3ATR5 | Macrolide export ATP-binding/permease protein MacB | 2.22e-01 | NA | 1.15e-04 | NA |
| 7. B | Q8YQ88 | Putative ABC transporter ATP-binding protein alr3946 | 5.48e-03 | NA | 3.71e-04 | NA |
| 7. B | Q4WTT9 | ABC multidrug transporter mdr1 | 4.83e-02 | NA | 2.29e-04 | NA |
| 7. B | A3CRB9 | Energy-coupling factor transporter ATP-binding protein EcfA1 | 1.06e-02 | NA | 0.025 | NA |
| 7. B | Q1RD37 | Lipoprotein-releasing system ATP-binding protein LolD | 2.45e-02 | NA | 0.019 | NA |
| 7. B | Q8D3V0 | Maltose/maltodextrin import ATP-binding protein MalK | 2.22e-02 | NA | 0.007 | NA |
| 7. B | Q7A4T3 | Putative multidrug export ATP-binding/permease protein SA1683 | 4.45e-02 | NA | 0.041 | NA |
| 7. B | Q32HA3 | Zinc import ATP-binding protein ZnuC | 5.16e-03 | NA | 0.001 | NA |
| 7. B | O57896 | Molybdate/tungstate import ATP-binding protein WtpC | 2.31e-02 | NA | 0.006 | NA |
| 7. B | Q3KE48 | Macrolide export ATP-binding/permease protein MacB 2 | 2.03e-01 | NA | 0.013 | NA |
| 7. B | Q39GY8 | Ribose import ATP-binding protein RbsA 1 | 1.09e-03 | NA | 6.83e-04 | NA |
| 7. B | Q5MK06 | Macrolide export ATP-binding/permease protein MacB | 2.96e-01 | NA | 0.021 | NA |
| 7. B | Q65U21 | ATP-dependent lipid A-core flippase | 3.45e-02 | NA | 0.002 | NA |
| 7. B | Q8X5N2 | Hemin import ATP-binding protein HmuV | 3.35e-02 | NA | 0.006 | NA |
| 7. B | Q9X196 | Spermidine/putrescine import ATP-binding protein PotA | 6.11e-02 | NA | 0.011 | NA |
| 7. B | Q9SYI2 | ABC transporter B family member 3 | 9.35e-02 | NA | 0.034 | NA |
| 7. B | Q81N53 | Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 | 1.51e-04 | NA | 1.12e-04 | NA |
| 7. B | Q7NIW1 | Sulfate/thiosulfate import ATP-binding protein CysA | 2.98e-02 | NA | 0.001 | NA |
| 7. B | Q88ZJ6 | Spermidine/putrescine import ATP-binding protein PotA | 2.40e-02 | NA | 0.031 | NA |
| 7. B | Q0WML0 | ABC transporter B family member 27 | 3.71e-02 | NA | 0.001 | NA |
| 7. B | P75796 | Glutathione import ATP-binding protein GsiA | 1.99e-03 | NA | 7.76e-04 | NA |
| 7. B | P23174 | Phosphatidylcholine translocator ABCB4 | 1.08e-01 | NA | 0.001 | NA |
| 7. B | Q57GZ7 | Maltose/maltodextrin import ATP-binding protein MalK | 3.25e-02 | NA | 0.003 | NA |