Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX54987.1

JCVISYN3A_0825

Excinuclease ABC subunit B.
M. mycoides homolog: Q6MS38.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.

Statistics

Total GO Annotation: 207
Unique PROST Go: 4
Unique BLAST Go: 89
Unique Foldseek Go: 72

Total Homologs: 963
Unique PROST Homologs: 5
Unique BLAST Homologs: 301
Unique Foldseek Homologs: 236

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: uvrB; UvrABC system protein B
Zhang et al. [4]: GO:0009381|excinuclease ABC activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q6AF52 (UvrABC system protein B) with a FATCAT P-Value: 0 and RMSD of 2.46 angstrom. The sequence alignment identity is 47.5%.
Structural alignment shown in left. Query protein AVX54987.1 colored as red in alignment, homolog Q6AF52 colored as blue. Query protein AVX54987.1 is also shown in right top, homolog Q6AF52 showed in right bottom. They are colored based on secondary structures.

  AVX54987.1 M----FIANNKYKLVTKYKPSGDQNQAIEKLNKG-IIENKKHQVLLGATGTGKTFTIANIIAKHNKQALVIAHNKTLAMQLYYELKEMFPENRVEYFVSN 95
      Q6AF52 MEPTRLV--RPFEVVSEYQPSGDQPKAIAEL-AGRITAGETDVVLLGATGTGKSATTAWLVEAVQRPTLVLAHNKTLAAQLANEFRELLPNNAVEYFVSY 97

  AVX54987.1 FDFFQPEAYIPSKDLYIDKDSRQNMELDMMRLSACNALLTRNDTIVVASVAALFALQNPLEYSSAFIELKVGQKIKRNELLTWLVRSGYTRNDIENQLGS 195
      Q6AF52 YDYYQPEAYVPQTDTFIEKDSSINAEVERLRHSTTNSLLSRRDVVVVSTVSCIYGLGAAEEYLEAMVALQVGQNVGRDQLIRRFVAMQYERNDIDFSRGK 197

  AVX54987.1 FSAKGDVVKIVPGWVNNIMFRISLFDDEIESIHTLNTITNSILDNITTVTIHPAQSY-ITP---QDKLKTICNNIRNELVQRLAELQSENKLLEAQRLEQ 291
      Q6AF52 FRVRGDTIEIIPVYEEHAL-RIELFGDEIEALYSLHPLTGEVLARTDAVSVFPATHYAASPATIQRAIGT----IQTELHDRLVELEREGKLLEAQRLRM 292

  AVX54987.1 RTKYDLESLEEFGFCSGIENYSSHLDFRSKGQRPYVLLDYFNNDFITIIDESHITLPQIRG-MYNTDRSRKLTLVEYGFRLPSALDNRPLNFDEFNSLIK 390
      Q6AF52 RTQFDIEMMEQIGFCSGIENYSRHIDGRAPGEAPHCLLDYFPDDFLVVIDESHVTVPQI-GAMYEGDASRKRTLVEHGFRLPSAMDNRPLRWNEFKERVG 391

  AVX54987.1 QVIYTSATPGDYELDLVNHQVVQQIIRPTGLLDPQIEIRKTTNQIDDIINEIHLRKLQNERVFITTLTIRMSEDLTAFLQEKNIKVAYLHSELKTLERSE 490
      Q6AF52 QTVYLSATPGQYELGIA-DGVVEQIIRPTGLVDPQILVKPTKGQIDDLLEEIRARAERDERVLVTTLTKKMAEELTDFLAEAGVKVRYLHADVDTLRRVE 490

  AVX54987.1 ILNDLRKGVYDVVVGVNLLREGLDLPEVSLVCILDADKQGFLRNYRSLIQTIGRVARNVNGKAIMYADTVSQAMDEAIKETNRRRKIQEEFNKKHNITPK 590
      Q6AF52 LLTELRSGVFDVLVGINLLREGLDLPEVSLVAILDADKEGFLRSSTSLIQTIGRAARNVSGEVHMYADVLTDSMKKAIEETSRRSELQVEYNRANGIDPQ 590

  AVX54987.1 TISKAISE--SILSEQ---TKKTLAKAKKIKDKKQK-----LQT----------IQQTI-DTLRQEMLQAAKELDFERAAILRDTIIELENE-KNTN--- 665
      Q6AF52 PLRKRIADITDILAREEADTAKILAG----RDQKRKSPTPSLRSGGIAAQGAAELESLIAD-LNAQMLAAAGELKFELAARLRDELSDLKRDLRQMEKAG 685

  AVX54987.1 --- 665
      Q6AF52 HLS 688

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0003677	DNA binding
1. PBF	GO:0009432	SOS response
1. PBF	GO:0009381	excinuclease ABC activity
1. PBF	GO:0004386	helicase activity
1. PBF	GO:0006289	nucleotide-excision repair
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0003678	DNA helicase activity
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0009380	excinuclease repair complex
3. BF	GO:0003723	RNA binding
3. BF	GO:0006409	tRNA export from nucleus
3. BF	GO:0003724	RNA helicase activity
3. BF	GO:0033592	RNA strand annealing activity
3. BF	GO:0010494	cytoplasmic stress granule
3. BF	GO:0006364	rRNA processing
3. BF	GO:0030687	preribosome, large subunit precursor
3. BF	GO:0140603	obsolete ATP hydrolysis activity
3. BF	GO:0016973	poly(A)+ mRNA export from nucleus
3. BF	GO:0043175	RNA polymerase core enzyme binding
3. BF	GO:0000822	inositol hexakisphosphate binding
3. BF	GO:0061749	forked DNA-dependent helicase activity
3. BF	GO:0015616	DNA translocase activity
3. BF	GO:0005844	polysome
3. BF	GO:0046872	metal ion binding
3. BF	GO:0016787	hydrolase activity
3. BF	GO:0062176	R-loop disassembly
3. BF	GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
3. BF	GO:0005934	cellular bud tip
3. BF	GO:0006401	RNA catabolic process
3. BF	GO:0000400	four-way junction DNA binding
3. BF	GO:0005730	nucleolus
3. BF	GO:0008186	ATP-dependent activity, acting on RNA
3. BF	GO:0000716	transcription-coupled nucleotide-excision repair, DNA damage recognition
3. BF	GO:0006268	DNA unwinding involved in DNA replication
3. BF	GO:0044614	nuclear pore cytoplasmic filaments
3. BF	GO:0006283	transcription-coupled nucleotide-excision repair
3. BF	GO:0043138	3'-5' DNA helicase activity
3. BF	GO:0003684	damaged DNA binding
3. BF	GO:0019843	rRNA binding
4. PB	GO:0036297	interstrand cross-link repair
4. PB	GO:0005634	nucleus
5. P	GO:0007064	mitotic sister chromatid cohesion
5. P	GO:0052559	induction by symbiont of host immune response
5. P	GO:0006139	nucleobase-containing compound metabolic process
5. P	GO:0034085	establishment of sister chromatid cohesion
6. F	GO:0009035	type I site-specific deoxyribonuclease activity
6. F	GO:0035315	hair cell differentiation
6. F	GO:1990417	snoRNA release from pre-rRNA
6. F	GO:0000439	transcription factor TFIIH core complex
6. F	GO:0006348
6. F	GO:0036310	ATP-dependent DNA/DNA annealing activity
6. F	GO:0005675	transcription factor TFIIH holo complex
6. F	GO:0031522	cell envelope Sec protein transport complex
6. F	GO:0005829	cytosol
6. F	GO:0036292	DNA rewinding
6. F	GO:1903097	regulation of CENP-A containing nucleosome assembly
6. F	GO:0060303	regulation of nucleosome density
6. F	GO:0006367	transcription initiation from RNA polymerase II promoter
6. F	GO:0015462	ABC-type protein transporter activity
6. F	GO:1901990	regulation of mitotic cell cycle phase transition
6. F	GO:0051983	regulation of chromosome segregation
6. F	GO:0043618	regulation of transcription from RNA polymerase II promoter in response to stress
6. F	GO:0043596	nuclear replication fork
6. F	GO:0034512	box C/D RNA binding
6. F	GO:0006355	regulation of transcription, DNA-templated
6. F	GO:0035065	regulation of histone acetylation
6. F	GO:0031297	replication fork processing
6. F	GO:0048478	replication fork protection
6. F	GO:0016442	RISC complex
6. F	GO:0009002	serine-type D-Ala-D-Ala carboxypeptidase activity
6. F	GO:0032508	DNA duplex unwinding
6. F	GO:0080040	positive regulation of cellular response to phosphate starvation
6. F	GO:1990077	primosome complex
6. F	GO:0097550	transcription preinitiation complex
6. F	GO:0006362	transcription elongation from RNA polymerase I promoter
6. F	GO:0090501	RNA phosphodiester bond hydrolysis
6. F	GO:0000729	DNA double-strand break processing
6. F	GO:0009411	response to UV
6. F	GO:0009274	peptidoglycan-based cell wall
6. F	GO:0032006	regulation of TOR signaling
6. F	GO:0031011	Ino80 complex
6. F	GO:0051539	4 iron, 4 sulfur cluster binding
6. F	GO:0006392	transcription elongation from mitochondrial promoter
6. F	GO:0000812	Swr1 complex
6. F	GO:0006366	transcription by RNA polymerase II
6. F	GO:0065002	intracellular protein transmembrane transport
6. F	GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
6. F	GO:0016021	integral component of membrane
6. F	GO:0030422	production of siRNA involved in RNA interference
6. F	GO:0008564	protein-exporting ATPase activity
6. F	GO:0016887	ATP hydrolysis activity
6. F	GO:0043486	histone exchange
6. F	GO:0016584	nucleosome positioning
6. F	GO:0006310	DNA recombination
6. F	GO:0042393	histone binding
6. F	GO:0032040	small-subunit processome
6. F	GO:0043044
6. F	GO:0006265	DNA topological change
6. F	GO:0070578	RISC-loading complex
6. F	GO:0070580	base J metabolic process
6. F	GO:0070615
6. F	GO:0090329	regulation of DNA-dependent DNA replication
6. F	GO:0031054	pre-miRNA processing
6. F	GO:0000717	nucleotide-excision repair, DNA duplex unwinding
6. F	GO:0033683	nucleotide-excision repair, DNA incision
6. F	GO:0006281	DNA repair
6. F	GO:0016458	obsolete gene silencing
6. F	GO:0030423	targeting of mRNA for destruction involved in RNA interference
6. F	GO:0006605	protein targeting
6. F	GO:0009650	UV protection
6. F	GO:0042766	nucleosome mobilization
6. F	GO:0000722	telomere maintenance via recombination
6. F	GO:0000112	nucleotide-excision repair factor 3 complex
6. F	GO:0006269	DNA replication, synthesis of RNA primer
6. F	GO:0017038	protein import
6. F	GO:0008658	penicillin binding
6. F	GO:0034511	U3 snoRNA binding
7. B	GO:0044357	regulation of rRNA stability
7. B	GO:0006417	regulation of translation
7. B	GO:0035145	exon-exon junction complex
7. B	GO:0030515	snoRNA binding
7. B	GO:0035640	exploration behavior
7. B	GO:0071006	U2-type catalytic step 1 spliceosome
7. B	GO:0061614	miRNA transcription
7. B	GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
7. B	GO:0000384	first spliceosomal transesterification activity
7. B	GO:0048701	embryonic cranial skeleton morphogenesis
7. B	GO:0017148	negative regulation of translation
7. B	GO:0045445	myoblast differentiation
7. B	GO:1902527	positive regulation of protein monoubiquitination
7. B	GO:1990120	messenger ribonucleoprotein complex assembly
7. B	GO:0003743	translation initiation factor activity
7. B	GO:0002183	cytoplasmic translational initiation
7. B	GO:0031047	gene silencing by RNA
7. B	GO:0019034	viral replication complex
7. B	GO:0005643	nuclear pore
7. B	GO:1990904	ribonucleoprotein complex
7. B	GO:0071932	replication fork reversal
7. B	GO:1990416	cellular response to brain-derived neurotrophic factor stimulus
7. B	GO:0051028	mRNA transport
7. B	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
7. B	GO:0000398	mRNA splicing, via spliceosome
7. B	GO:0070336	flap-structured DNA binding
7. B	GO:0007276	gamete generation
7. B	GO:1990830	cellular response to leukemia inhibitory factor
7. B	GO:0043046	DNA methylation involved in gamete generation
7. B	GO:0006369	termination of RNA polymerase II transcription
7. B	GO:0097078	FAL1-SGD1 complex
7. B	GO:0034587	piRNA metabolic process
7. B	GO:0008143	poly(A) binding
7. B	GO:0090394	negative regulation of excitatory postsynaptic potential
7. B	GO:0000464	endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
7. B	GO:1900260	negative regulation of RNA-directed 5'-3' RNA polymerase activity
7. B	GO:0099524	postsynaptic cytosol
7. B	GO:0010529	negative regulation of transposition
7. B	GO:0035613	RNA stem-loop binding
7. B	GO:0007049	cell cycle
7. B	GO:0071821	FANCM-MHF complex
7. B	GO:0003729	mRNA binding
7. B	GO:1904574	negative regulation of selenocysteine insertion sequence binding
7. B	GO:0000346	transcription export complex
7. B	GO:0099578	regulation of translation at postsynapse, modulating synaptic transmission
7. B	GO:0007535	donor selection
7. B	GO:0050688	regulation of defense response to virus
7. B	GO:0035368	selenocysteine insertion sequence binding
7. B	GO:0051301	cell division
7. B	GO:0030688	preribosome, small subunit precursor
7. B	GO:2001014	regulation of skeletal muscle cell differentiation
7. B	GO:1904570	negative regulation of selenocysteine incorporation
7. B	GO:0008270	zinc ion binding
7. B	GO:0007141	male meiosis I
7. B	GO:1901195	positive regulation of formation of translation preinitiation complex
7. B	GO:0051214	RNAi-mediated antiviral immunity against RNA virus
7. B	GO:0031965	nuclear membrane
7. B	GO:0031370	eukaryotic initiation factor 4G binding
7. B	GO:0030521	androgen receptor signaling pathway
7. B	GO:0000373	Group II intron splicing
7. B	GO:0006415	translational termination
7. B	GO:0043186	P granule
7. B	GO:0039530	MDA-5 signaling pathway
7. B	GO:1903040	exon-exon junction complex assembly
7. B	GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
7. B	GO:0010586	miRNA metabolic process
7. B	GO:0071013	catalytic step 2 spliceosome
7. B	GO:0007140	male meiotic nuclear division
7. B	GO:0097322	7SK snRNA binding
7. B	GO:0033677	DNA/RNA helicase activity
7. B	GO:0043240	Fanconi anaemia nuclear complex
7. B	GO:0051607	defense response to virus
7. B	GO:1990511	piRNA biosynthetic process
7. B	GO:0072715	cellular response to selenite ion
7. B	GO:0000390	spliceosomal complex disassembly
7. B	GO:0045003	double-strand break repair via synthesis-dependent strand annealing
7. B	GO:0045182	translation regulator activity
7. B	GO:0000381	regulation of alternative mRNA splicing, via spliceosome
7. B	GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
7. B	GO:0060543	negative regulation of strand invasion
7. B	GO:1902415	regulation of mRNA binding
7. B	GO:0000725	recombinational repair
7. B	GO:0071546	pi-body
7. B	GO:0010501	RNA secondary structure unwinding
7. B	GO:0016607	nuclear speck
7. B	GO:0071042	nuclear polyadenylation-dependent mRNA catabolic process
7. B	GO:0071547	piP-body
7. B	GO:0033567	DNA replication, Okazaki fragment processing
7. B	GO:0033391	chromatoid body

Uniprot GO Annotations

GO	Description
GO:0003677	DNA binding
GO:0009432	SOS response
GO:0090305	nucleic acid phosphodiester bond hydrolysis
GO:0009381	excinuclease ABC activity
GO:0006281	DNA repair
GO:0006289	nucleotide-excision repair
GO:0016887	ATP hydrolysis activity
GO:0005737	cytoplasm
GO:0004518	nuclease activity
GO:0005524	ATP binding
GO:0006974	cellular response to DNA damage stimulus
GO:0009380	excinuclease repair complex
GO:0016787	hydrolase activity
GO:0000166	nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q2JN87	UvrABC system protein B	0.00e+00	1.49e-65	0.0	0.8922
1. PBF	B4U3P4	UvrABC system protein B	0.00e+00	3.15e-61	0.0	0.8856
1. PBF	B6J8A0	UvrABC system protein B	0.00e+00	1.75e-62	0.0	0.8981
1. PBF	O26542	UvrABC system protein B	0.00e+00	4.13e-62	0.0	0.8979
1. PBF	B5YJW4	UvrABC system protein B	0.00e+00	1.32e-65	0.0	0.8694
1. PBF	Q605S7	UvrABC system protein B	0.00e+00	7.67e-56	0.0	0.879
1. PBF	Q8G5L9	UvrABC system protein B	0.00e+00	1.95e-51	0.0	0.9007
1. PBF	A8F0V9	UvrABC system protein B	0.00e+00	1.14e-63	0.0	0.8888
1. PBF	Q9ZB21	UvrABC system protein B	0.00e+00	9.78e-64	0.0	0.9088
1. PBF	Q4ZV05	UvrABC system protein B	0.00e+00	1.62e-60	0.0	0.8829
1. PBF	B8H7K6	UvrABC system protein B	0.00e+00	1.13e-50	0.0	0.9008
1. PBF	Q31ES7	UvrABC system protein B	0.00e+00	3.49e-56	0.0	0.8817
1. PBF	Q7MM80	UvrABC system protein B	0.00e+00	8.12e-56	0.0	0.8939
1. PBF	B8ZJQ9	UvrABC system protein B	0.00e+00	1.80e-62	0.0	0.8911
1. PBF	B4TC52	UvrABC system protein B	0.00e+00	3.84e-57	0.0	0.8905
1. PBF	Q7UZL3	UvrABC system protein B	0.00e+00	1.03e-61	0.0	0.8781
1. PBF	Q48KA6	UvrABC system protein B	0.00e+00	2.64e-61	0.0	0.8852
1. PBF	A7FYY1	UvrABC system protein B	0.00e+00	2.00e-63	0.0	0.8876
1. PBF	Q5N3H1	UvrABC system protein B	0.00e+00	6.30e-71	0.0	0.7891
1. PBF	Q03JK4	UvrABC system protein B	0.00e+00	4.49e-60	0.0	0.888
1. PBF	A8AJ07	UvrABC system protein B	0.00e+00	3.48e-55	0.0	0.889
1. PBF	A2RE43	UvrABC system protein B	0.00e+00	1.04e-65	0.0	0.888
1. PBF	Q9PR24	UvrABC system protein B	0.00e+00	4.17e-72	0.0	0.9217
1. PBF	Q9ZDW2	UvrABC system protein B	0.00e+00	2.08e-65	0.0	0.8909
1. PBF	Q83NI7	UvrABC system protein B	0.00e+00	6.09e-55	0.0	0.8758
1. PBF	Q8TKS3	UvrABC system protein B	0.00e+00	1.34e-57	0.0	0.8994
1. PBF	Q9ZKA0	UvrABC system protein B	0.00e+00	3.54e-61	0.0	0.9011
1. PBF	B4TQU3	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8956
1. PBF	C0PWY7	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8945
1. PBF	Q1CSF2	UvrABC system protein B	0.00e+00	2.65e-62	0.0	0.9
1. PBF	A8F8W9	UvrABC system protein B	0.00e+00	3.37e-53	0.0	0.8873
1. PBF	Q3JC03	UvrABC system protein B	0.00e+00	5.99e-53	0.0	0.8732
1. PBF	Q5FL61	UvrABC system protein B	0.00e+00	1.44e-63	0.0	0.8903
1. PBF	B5E4X3	UvrABC system protein B	0.00e+00	2.57e-62	0.0	0.8915
1. PBF	A2C5B3	UvrABC system protein B	0.00e+00	9.86e-61	0.0	0.889
1. PBF	Q82WA9	UvrABC system protein B	0.00e+00	7.73e-51	0.0	0.8753
1. PBF	Q473K3	UvrABC system protein B	0.00e+00	9.90e-59	0.0	0.8893
1. PBF	Q3KLB1	UvrABC system protein B	0.00e+00	1.95e-68	0.0	0.8795
1. PBF	Q5M3D5	UvrABC system protein B	0.00e+00	4.62e-60	0.0	0.8878
1. PBF	C5CFR8	UvrABC system protein B	0.00e+00	1.68e-55	0.0	0.8822
1. PBF	B0BWK0	UvrABC system protein B	0.00e+00	1.53e-63	0.0	0.889
1. PBF	Q3ATT8	UvrABC system protein B	0.00e+00	2.90e-65	0.0	0.878
1. PBF	B1IXI9	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8878
1. PBF	Q1JBD1	UvrABC system protein B	0.00e+00	2.42e-65	0.0	0.8874
1. PBF	Q8P7X1	UvrABC system protein B	0.00e+00	1.17e-60	0.0	0.8929
1. PBF	Q5L4S6	UvrABC system protein B	0.00e+00	2.45e-71	0.0	0.8826
1. PBF	Q8DPK7	UvrABC system protein B	0.00e+00	1.23e-62	0.0	0.8913
1. PBF	Q9PJF4	UvrABC system protein B	0.00e+00	5.65e-69	0.0	0.8649
1. PBF	O84590	UvrABC system protein B	0.00e+00	6.20e-69	0.0	0.866
1. PBF	Q11Z64	UvrABC system protein B	0.00e+00	1.07e-63	0.0	0.8865
1. PBF	Q5NFN4	UvrABC system protein B	0.00e+00	1.53e-63	0.0	0.8737
1. PBF	B7KC96	UvrABC system protein B	0.00e+00	9.13e-74	0.0	0.8951
1. PBF	P10125	UvrABC system protein B	0.00e+00	8.94e-48	0.0	0.9007
1. PBF	Q8ENJ5	UvrABC system protein B	0.00e+00	1.85e-69	0.0	0.8893
1. PBF	Q7WK66	UvrABC system protein B	0.00e+00	6.49e-67	0.0	0.8847
1. PBF	Q5LC24	UvrABC system protein B	0.00e+00	5.06e-64	0.0	0.8845
1. PBF	A8GMJ1	UvrABC system protein B	0.00e+00	1.68e-65	0.0	0.8884
1. PBF	Q32I48	UvrABC system protein B	0.00e+00	6.03e-58	0.0	0.8922
1. PBF	A1STV6	UvrABC system protein B	0.00e+00	3.82e-58	0.0	0.8899
1. PBF	B1LAR2	UvrABC system protein B	0.00e+00	2.34e-59	0.0	0.8744
1. PBF	A9MTI2	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8959
1. PBF	O83154	UvrABC system protein B	0.00e+00	2.87e-56	0.0	0.8909
1. PBF	Q47QN5	UvrABC system protein B	0.00e+00	2.96e-50	0.0	0.9066
1. PBF	B7J0S9	UvrABC system protein B	0.00e+00	1.86e-62	0.0	0.8771
1. PBF	A0PYA5	UvrABC system protein B	0.00e+00	1.85e-67	0.0	0.8883
1. PBF	Q8AA95	UvrABC system protein B	0.00e+00	8.39e-66	0.0	0.8882
1. PBF	Q1CFQ8	UvrABC system protein B	0.00e+00	2.95e-58	0.0	0.8927
1. PBF	A8GBD1	UvrABC system protein B	0.00e+00	1.28e-63	0.0	0.8959
1. PBF	B2IPP4	UvrABC system protein B	0.00e+00	1.80e-62	0.0	0.8885
1. PBF	A4TNQ1	UvrABC system protein B	0.00e+00	2.95e-58	0.0	0.8931
1. PBF	Q3Z9B4	UvrABC system protein B	0.00e+00	5.15e-65	0.0	0.8858
1. PBF	C5BV49	UvrABC system protein B	0.00e+00	2.23e-52	0.0	0.9052
1. PBF	Q1JGE8	UvrABC system protein B	0.00e+00	1.17e-65	0.0	0.8895
1. PBF	O33395	UvrABC system protein B	0.00e+00	1.80e-62	0.0	0.8747
1. PBF	P67423	UvrABC system protein B	0.00e+00	4.78e-50	0.0	0.8878
1. PBF	Q8CPZ0	UvrABC system protein B	0.00e+00	9.19e-66	0.0	0.8935
1. PBF	P57991	UvrABC system protein B	0.00e+00	2.41e-48	0.0	0.8897
1. PBF	Q829Y6	UvrABC system protein B	0.00e+00	1.76e-42	0.0	0.8923
1. PBF	B7LC61	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8965
1. PBF	B4ESU7	UvrABC system protein B	0.00e+00	1.51e-62	0.0	0.8914
1. PBF	P75558	UvrABC system protein B	0.00e+00	1.10e-74	0.0	0.9303
1. PBF	Q46IE1	UvrABC system protein B	0.00e+00	1.13e-57	0.0	0.9023
1. PBF	P0DH38	UvrABC system protein B	0.00e+00	2.42e-65	0.0	0.8891
1. PBF	Q4UW79	UvrABC system protein B	0.00e+00	1.17e-60	0.0	0.897
1. PBF	Q6F9D2	UvrABC system protein B	0.00e+00	3.02e-67	0.0	0.8857
1. PBF	A7HKC0	UvrABC system protein B	0.00e+00	1.04e-59	0.0	0.8799
1. PBF	Q67T57	UvrABC system protein B	0.00e+00	6.81e-70	0.0	0.8878
1. PBF	Q6NHI3	UvrABC system protein B	0.00e+00	1.86e-59	0.0	0.8883
1. PBF	B7ULX6	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8934
1. PBF	B5BC27	UvrABC system protein B	0.00e+00	5.10e-57	0.0	0.8935
1. PBF	Q2P0Z3	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8847
1. PBF	Q66D62	UvrABC system protein B	0.00e+00	7.01e-59	0.0	0.8929
1. PBF	Q8E471	UvrABC system protein B	0.00e+00	1.01e-65	0.0	0.8842
1. PBF	C3PMP5	UvrABC system protein B	0.00e+00	4.57e-65	0.0	0.8892
1. PBF	Q73MY7	UvrABC system protein B	0.00e+00	2.03e-61	0.0	0.8809
1. PBF	Q87MX6	UvrABC system protein B	0.00e+00	2.89e-54	0.0	0.893
1. PBF	Q8F8A9	UvrABC system protein B	0.00e+00	2.42e-55	0.0	0.8831
1. PBF	Q5WDG7	UvrABC system protein B	0.00e+00	9.76e-66	0.0	0.888
1. PBF	Q88LF9	UvrABC system protein B	0.00e+00	3.34e-61	0.0	0.8827
1. PBF	Q83S42	UvrABC system protein B	0.00e+00	9.62e-59	0.0	0.8923
1. PBF	P56981	UvrABC system protein B	0.00e+00	2.77e-69	0.0	0.8889
1. PBF	A7Z985	UvrABC system protein B	0.00e+00	2.32e-64	0.0	0.8897
1. PBF	Q1C942	UvrABC system protein B	0.00e+00	1.04e-60	0.0	0.8942
1. PBF	Q72XV1	UvrABC system protein B	0.00e+00	1.51e-62	0.0	0.8887
1. PBF	B2I8F9	UvrABC system protein B	0.00e+00	4.10e-64	0.0	0.8878
1. PBF	Q30ZK3	UvrABC system protein B	0.00e+00	6.43e-59	0.0	0.8826
1. PBF	A6M2Z0	UvrABC system protein B	0.00e+00	1.58e-75	0.0	0.8887
1. PBF	Q88YI8	UvrABC system protein B	0.00e+00	3.41e-67	0.0	0.9107
1. PBF	Q031G7	UvrABC system protein B	0.00e+00	2.11e-53	0.0	0.9051
1. PBF	Q1J665	UvrABC system protein B	0.00e+00	2.14e-66	0.0	0.8895
1. PBF	P72174	UvrABC system protein B	0.00e+00	1.51e-61	0.0	0.8772
1. PBF	B7MQN2	UvrABC system protein B	0.00e+00	6.03e-58	0.0	0.8937
1. PBF	Q5UYC8	UvrABC system protein B	0.00e+00	6.86e-56	0.0	0.8761
1. PBF	Q49VV6	UvrABC system protein B	0.00e+00	1.10e-67	0.0	0.8902
1. PBF	B1X7A9	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8953
1. PBF	Q4KF19	UvrABC system protein B	0.00e+00	7.43e-59	0.0	0.8805
1. PBF	B9KH59	UvrABC system protein B	0.00e+00	1.36e-65	0.0	0.8947
1. PBF	Q8PJB1	UvrABC system protein B	0.00e+00	1.40e-58	0.0	0.8904
1. PBF	Q8R8M4	UvrABC system protein B	0.00e+00	5.00e-65	0.0	0.8886
1. PBF	Q8CWX7	UvrABC system protein B	0.00e+00	8.02e-60	0.0	0.892
1. PBF	C1CEJ5	UvrABC system protein B	0.00e+00	1.80e-62	0.0	0.8883
1. PBF	Q9Z7A5	UvrABC system protein B	0.00e+00	1.04e-70	0.0	0.8742
1. PBF	A8GV86	UvrABC system protein B	0.00e+00	7.35e-68	0.0	0.8885
1. PBF	A7GIY3	UvrABC system protein B	0.00e+00	2.00e-63	0.0	0.8879
1. PBF	Q65ST2	UvrABC system protein B	0.00e+00	1.83e-63	0.0	0.8984
1. PBF	Q7W8V6	UvrABC system protein B	0.00e+00	1.09e-66	0.0	0.8845
1. PBF	B3PLX9	UvrABC system protein B	0.00e+00	9.78e-64	0.0	0.9394
1. PBF	Q62CK6	UvrABC system protein B	0.00e+00	1.50e-57	0.0	0.8861
1. PBF	P9WFC6	UvrABC system protein B	0.00e+00	4.78e-50	0.0	0.8894
1. PBF	Q0TJR9	UvrABC system protein B	0.00e+00	6.03e-58	0.0	0.8967
1. PBF	Q5ZZD9	UvrABC system protein B	0.00e+00	2.42e-61	0.0	0.8774
1. PBF	Q9PPM7	UvrABC system protein B	0.00e+00	3.32e-63	0.0	0.889
1. PBF	Q57RF9	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8937
1. PBF	Q1REF1	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8888
1. PBF	Q042E2	UvrABC system protein B	0.00e+00	8.47e-70	0.0	0.8876
1. PBF	B1IC35	UvrABC system protein B	0.00e+00	4.25e-62	0.0	0.8878
1. PBF	B6I7T4	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.896
1. PBF	B9K844	UvrABC system protein B	0.00e+00	1.99e-55	0.0	0.8763
1. PBF	Q7VFX7	UvrABC system protein B	0.00e+00	8.29e-67	0.0	0.9092
1. PBF	B1LM70	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8947
1. PBF	Q5F931	UvrABC system protein B	0.00e+00	1.19e-61	0.0	0.8778
1. PBF	Q68XG5	UvrABC system protein B	0.00e+00	5.00e-65	0.0	0.8888
1. PBF	A1JSC3	UvrABC system protein B	0.00e+00	2.82e-60	0.0	0.8948
1. PBF	Q3ITS0	UvrABC system protein B	0.00e+00	1.74e-53	0.0	0.8737
1. PBF	Q8Z889	UvrABC system protein B	0.00e+00	4.04e-58	0.0	0.8926
1. PBF	Q8NXM0	UvrABC system protein B	0.00e+00	5.51e-63	0.0	0.8919
1. PBF	P0DH39	UvrABC system protein B	0.00e+00	2.42e-65	0.0	0.8884
1. PBF	Q884C9	UvrABC system protein B	0.00e+00	7.45e-62	0.0	0.8793
1. PBF	Q6A9K7	UvrABC system protein B	0.00e+00	4.96e-49	0.0	0.8873
1. PBF	Q3A8D0	UvrABC system protein B	0.00e+00	4.93e-62	0.0	0.8848
1. PBF	Q55170	UvrABC system protein B	0.00e+00	2.31e-73	0.0	0.8939
1. PBF	Q0T6I1	UvrABC system protein B	0.00e+00	9.62e-59	0.0	0.8892
1. PBF	Q65ZT8	UvrABC system protein B	0.00e+00	3.44e-61	0.0	0.8754
1. PBF	A9MJE1	UvrABC system protein B	0.00e+00	5.56e-57	0.0	0.8928
1. PBF	B0RES6	UvrABC system protein B	0.00e+00	3.19e-53	0.0	0.9015
1. PBF	B5XLX7	UvrABC system protein B	0.00e+00	3.08e-66	0.0	0.8833
1. PBF	B7MGN7	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8896
1. PBF	Q03SM9	UvrABC system protein B	0.00e+00	4.21e-63	0.0	0.8939
1. PBF	Q928A4	UvrABC system protein B	0.00e+00	8.14e-66	0.0	0.8849
1. PBF	Q7V9M1	UvrABC system protein B	0.00e+00	2.11e-60	0.0	0.7902
1. PBF	B2S264	UvrABC system protein B	0.00e+00	2.87e-56	0.0	0.891
1. PBF	A4W8C2	UvrABC system protein B	0.00e+00	4.94e-58	0.0	0.8935
1. PBF	Q5QXB8	UvrABC system protein B	0.00e+00	7.88e-53	0.0	0.884
1. PBF	B8HQA9	UvrABC system protein B	0.00e+00	7.78e-74	0.0	0.9002
1. PBF	B2K8T5	UvrABC system protein B	0.00e+00	7.01e-59	0.0	0.8926
1. PBF	A9BD93	UvrABC system protein B	0.00e+00	5.65e-61	0.0	0.8803
1. PBF	Q6LT47	UvrABC system protein B	0.00e+00	2.51e-57	0.0	0.8891
1. PBF	Q92J03	UvrABC system protein B	0.00e+00	9.70e-65	0.0	0.8893
1. PBF	B5YRL8	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8918
1. PBF	P67424	UvrABC system protein B	0.00e+00	2.47e-63	0.0	0.8918
1. PBF	Q7VXH4	UvrABC system protein B	0.00e+00	1.63e-69	0.0	0.8747
1. PBF	Q5X906	UvrABC system protein B	0.00e+00	2.72e-61	0.0	0.8759
1. PBF	B2SUN1	UvrABC system protein B	0.00e+00	2.78e-58	0.0	0.8854
1. PBF	C0MDC6	UvrABC system protein B	0.00e+00	3.44e-61	0.0	0.8841
1. PBF	B5QX69	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8942
1. PBF	Q8Y4F5	UvrABC system protein B	0.00e+00	1.72e-66	0.0	0.8844
1. PBF	C4K6N8	UvrABC system protein B	0.00e+00	4.04e-58	0.0	0.8818
1. PBF	B0CE09	UvrABC system protein B	0.00e+00	2.39e-64	0.0	0.8939
1. PBF	Q5P0E7	UvrABC system protein B	0.00e+00	6.24e-62	0.0	0.8751
1. PBF	A5ILJ3	UvrABC system protein B	0.00e+00	2.34e-59	0.0	0.8734
1. PBF	B1JSR9	UvrABC system protein B	0.00e+00	7.01e-59	0.0	0.8931
1. PBF	Q890X8	UvrABC system protein B	0.00e+00	1.25e-58	0.0	0.8873
1. PBF	Q6D3C4	UvrABC system protein B	0.00e+00	5.66e-60	0.0	0.8922
1. PBF	B0RRD9	UvrABC system protein B	0.00e+00	5.69e-58	0.0	0.8981
1. PBF	C1FMK5	UvrABC system protein B	0.00e+00	7.04e-64	0.0	0.8871
1. PBF	B2VBW9	UvrABC system protein B	0.00e+00	9.00e-57	0.0	0.8948
1. PBF	P47319	UvrABC system protein B	0.00e+00	2.09e-71	0.0	0.9331
1. PBF	B5FP65	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8902
1. PBF	Q5P9H3	UvrABC system protein B	0.00e+00	4.30e-66	0.0	0.8928
1. PBF	A2C5S6	UvrABC system protein B	0.00e+00	3.75e-61	0.0	0.774
1. PBF	C1CR65	UvrABC system protein B	0.00e+00	8.38e-62	0.0	0.8909
1. PBF	Q6GIN3	UvrABC system protein B	0.00e+00	2.39e-63	0.0	0.8938
1. PBF	Q5KVB5	UvrABC system protein B	0.00e+00	5.74e-67	0.0	0.8901
1. PBF	Q0TUD0	UvrABC system protein B	0.00e+00	2.75e-70	0.0	0.8846
1. PBF	Q8CK11	UvrABC system protein B	0.00e+00	2.82e-42	0.0	0.9007
1. PBF	P56996	UvrABC system protein B	0.00e+00	4.23e-60	0.0	0.8763
1. PBF	Q837R9	UvrABC system protein B	0.00e+00	3.93e-65	0.0	0.8884
1. PBF	A9NC09	UvrABC system protein B	0.00e+00	5.71e-62	0.0	0.8948
1. PBF	Q3IKF4	UvrABC system protein B	0.00e+00	9.14e-65	0.0	0.887
1. PBF	A7ZY35	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8962
1. PBF	B3EFX1	UvrABC system protein B	0.00e+00	1.12e-62	0.0	0.89
1. PBF	Q74K90	UvrABC system protein B	0.00e+00	9.00e-69	0.0	0.8872
1. PBF	C4ZXV1	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8962
1. PBF	Q8EUN2	UvrABC system protein B	0.00e+00	1.62e-73	0.0	0.9461
1. PBF	Q6HBC2	UvrABC system protein B	0.00e+00	2.19e-63	0.0	0.8873
1. PBF	B7NNK9	UvrABC system protein B	0.00e+00	4.16e-58	0.0	0.8922
1. PBF	A3PFD7	UvrABC system protein B	0.00e+00	7.23e-62	0.0	0.8802
1. PBF	Q8ZQQ4	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8942
1. PBF	Q2GID5	UvrABC system protein B	0.00e+00	1.52e-64	0.0	0.8836
1. PBF	B9MS82	UvrABC system protein B	0.00e+00	2.16e-56	0.0	0.8848
1. PBF	B1AIA9	UvrABC system protein B	0.00e+00	4.17e-72	0.0	0.9203
1. PBF	A8EXS6	UvrABC system protein B	0.00e+00	3.87e-64	0.0	0.8925
1. PBF	B2TVF1	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8966
1. PBF	A5I9P3	UvrABC system protein B	0.00e+00	1.60e-61	0.0	0.8769
1. PBF	Q87AT6	UvrABC system protein B	0.00e+00	4.10e-64	0.0	0.8975
1. PBF	Q56998	UvrABC system protein B	0.00e+00	1.35e-40	0.0	0.8938
1. PBF	A7ZJI8	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8957
1. PBF	Q64T09	UvrABC system protein B	0.00e+00	7.93e-64	0.0	0.8847
1. PBF	Q4QJX4	UvrABC system protein B	0.00e+00	3.35e-60	0.0	0.8969
1. PBF	B2A713	UvrABC system protein B	0.00e+00	1.79e-65	0.0	0.887
1. PBF	B5F076	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8916
1. PBF	Q054D2	UvrABC system protein B	0.00e+00	1.07e-55	0.0	0.8803
1. PBF	Q6YQE1	UvrABC system protein B	0.00e+00	6.84e-74	0.0	0.8827
1. PBF	Q5GXX4	UvrABC system protein B	0.00e+00	3.63e-57	0.0	0.8971
1. PBF	Q6GB72	UvrABC system protein B	0.00e+00	5.51e-63	0.0	0.893
1. PBF	Q5E6B5	UvrABC system protein B	0.00e+00	1.75e-61	0.0	0.8861
1. PBF	B8DJT9	UvrABC system protein B	0.00e+00	4.34e-61	0.0	0.8884
1. PBF	C0MBD7	UvrABC system protein B	0.00e+00	3.98e-61	0.0	0.8827
1. PBF	C1C7L7	UvrABC system protein B	0.00e+00	2.57e-62	0.0	0.8884
1. PBF	Q38YA4	UvrABC system protein B	0.00e+00	3.89e-62	0.0	0.8906
1. PBF	B0SDE2	UvrABC system protein B	0.00e+00	9.35e-49	0.0	0.8751
1. PBF	Q8Y0N2	UvrABC system protein B	0.00e+00	1.57e-58	0.0	0.8713
1. PBF	Q12TR7	UvrABC system protein B	0.00e+00	1.14e-72	0.0	0.8789
1. PBF	C5BEJ2	UvrABC system protein B	0.00e+00	3.75e-61	0.0	0.8895
1. PBF	C1A4H0	UvrABC system protein B	0.00e+00	9.05e-47	0.0	0.8856
1. PBF	Q7M806	UvrABC system protein B	0.00e+00	1.35e-66	0.0	0.9014
1. PBF	O67708	UvrABC system protein B	0.00e+00	9.69e-68	0.0	0.894
1. PBF	Q3Z405	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.896
1. PBF	A7FKM4	UvrABC system protein B	0.00e+00	7.01e-59	0.0	0.8935
1. PBF	A9IR19	UvrABC system protein B	0.00e+00	5.48e-66	0.0	0.8709
1. PBF	C4ZHN1	UvrABC system protein B	0.00e+00	8.80e-73	0.0	0.8822
1. PBF	A6T6L9	UvrABC system protein B	0.00e+00	2.98e-57	0.0	0.8946
1. PBF	Q7N6Q1	UvrABC system protein B	0.00e+00	2.90e-60	0.0	0.8921
1. PBF	Q72N95	UvrABC system protein B	0.00e+00	2.42e-55	0.0	0.8935
1. PBF	A9KCU2	UvrABC system protein B	0.00e+00	4.34e-61	0.0	0.8944
1. PBF	Q5PG52	UvrABC system protein B	0.00e+00	5.10e-57	0.0	0.893
1. PBF	P67425	UvrABC system protein B	0.00e+00	2.47e-63	0.0	0.888
1. PBF	P37954	UvrABC system protein B	0.00e+00	4.84e-69	0.0	0.8858
1. PBF	Q9CI06	UvrABC system protein B	0.00e+00	1.44e-53	0.0	0.9085
1. PBF	A5CRU3	UvrABC system protein B	0.00e+00	1.12e-53	0.0	0.8987
1. PBF	Q2NGT1	UvrABC system protein B	0.00e+00	3.46e-62	0.0	0.8948
1. PBF	B2TQS8	UvrABC system protein B	0.00e+00	4.98e-70	0.0	0.8931
1. PBF	A0RPB3	UvrABC system protein B	0.00e+00	7.80e-67	0.0	0.9059
1. PBF	A9R3D3	UvrABC system protein B	0.00e+00	2.95e-58	0.0	0.8931
1. PBF	B7GSZ2	UvrABC system protein B	0.00e+00	9.59e-51	0.0	0.8988
1. PBF	Q3SIK7	UvrABC system protein B	0.00e+00	1.28e-58	0.0	0.8853
1. PBF	B0U4J3	UvrABC system protein B	0.00e+00	2.62e-63	0.0	0.8981
1. PBF	Q63NE3	UvrABC system protein B	0.00e+00	1.50e-57	0.0	0.8839
1. PBF	A3N031	UvrABC system protein B	0.00e+00	7.40e-65	0.0	0.8914
1. PBF	A8AX17	UvrABC system protein B	0.00e+00	1.01e-60	0.0	0.8922
1. PBF	Q5GRL3	UvrABC system protein B	0.00e+00	1.70e-54	0.0	0.9019
1. PBF	Q50939	UvrABC system protein B	0.00e+00	3.44e-61	0.0	0.877
1. PBF	Q5HHR0	UvrABC system protein B	0.00e+00	2.39e-63	0.0	0.8897
1. PBF	Q03AL7	UvrABC system protein B	0.00e+00	3.22e-59	0.0	0.8933
1. PBF	Q81X47	UvrABC system protein B	0.00e+00	1.70e-62	0.0	0.8885
1. PBF	Q9K6X9	UvrABC system protein B	0.00e+00	1.19e-71	0.0	0.8904
1. PBF	Q97LQ2	UvrABC system protein B	0.00e+00	4.05e-71	0.0	0.8889
1. PBF	B7LJY3	UvrABC system protein B	0.00e+00	1.28e-58	0.0	0.8871
1. PBF	Q9X282	UvrABC system protein B	0.00e+00	8.26e-60	0.0	0.8785
1. PBF	B0SLS0	UvrABC system protein B	0.00e+00	9.35e-49	0.0	0.8759
1. PBF	Q6MEV1	UvrABC system protein B	0.00e+00	7.64e-59	0.0	0.8901
1. PBF	Q6MS38	UvrABC system protein B	0.00e+00	7.37e-117	0.0	0.9893
1. PBF	Q7VLL3	UvrABC system protein B	0.00e+00	1.94e-64	0.0	0.8918
1. PBF	Q6AF52	UvrABC system protein B	0.00e+00	1.05e-51	0.0	0.9013
1. PBF	Q631I6	UvrABC system protein B	0.00e+00	1.57e-64	0.0	0.8876
1. PBF	A1A921	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8959
1. PBF	A5GHU1	UvrABC system protein B	0.00e+00	2.73e-65	0.0	0.8853
1. PBF	Q2L244	UvrABC system protein B	0.00e+00	2.25e-64	0.0	0.879
1. PBF	C4K0Z4	UvrABC system protein B	0.00e+00	1.72e-63	0.0	0.8954
1. PBF	Q4UKL6	UvrABC system protein B	0.00e+00	8.67e-64	0.0	0.889
1. PBF	Q65ED8	UvrABC system protein B	0.00e+00	5.08e-67	0.0	0.8876
1. PBF	Q8D891	UvrABC system protein B	0.00e+00	8.12e-56	0.0	0.892
1. PBF	Q98I01	UvrABC system protein B	0.00e+00	1.35e-04	0.0	0.8709
1. PBF	B2UZZ0	UvrABC system protein B	0.00e+00	5.38e-72	0.0	0.8867
1. PBF	Q8DHC6	UvrABC system protein B	0.00e+00	2.16e-69	0.0	0.8821
1. PBF	Q1RHI9	UvrABC system protein B	0.00e+00	1.00e-67	0.0	0.8879
1. PBF	Q7UFR2	UvrABC system protein B	0.00e+00	6.47e-47	0.0	0.8864
1. PBF	Q72BN0	UvrABC system protein B	0.00e+00	1.83e-63	0.0	0.8778
1. PBF	B0JR86	UvrABC system protein B	0.00e+00	3.02e-70	0.0	0.7918
1. PBF	B1IFX3	UvrABC system protein B	0.00e+00	2.00e-63	0.0	0.8876
1. PBF	Q54986	UvrABC system protein B	0.00e+00	1.80e-62	0.0	0.8921
1. PBF	Q9PER1	UvrABC system protein B	0.00e+00	5.83e-66	0.0	0.8933
1. PBF	A7I3X8	UvrABC system protein B	0.00e+00	1.72e-70	0.0	0.8972
1. PBF	Q8ZGW7	UvrABC system protein B	0.00e+00	2.95e-58	0.0	0.8913
1. PBF	Q0IE10	UvrABC system protein B	0.00e+00	1.70e-61	0.0	0.8831
1. PBF	Q7NTA7	UvrABC system protein B	0.00e+00	3.15e-61	0.0	0.8906
1. PBF	B3EMK1	UvrABC system protein B	0.00e+00	8.26e-57	0.0	0.8852
1. PBF	Q47EI2	UvrABC system protein B	0.00e+00	4.89e-63	0.0	0.88
1. PBF	Q8KC79	UvrABC system protein B	0.00e+00	1.03e-62	0.0	0.8797
1. PBF	B8G8R1	UvrABC system protein B	0.00e+00	5.32e-66	0.0	0.8797
1. PBF	A3CNJ9	UvrABC system protein B	0.00e+00	1.17e-60	0.0	0.891
1. PBF	A4XKY5	UvrABC system protein B	0.00e+00	3.06e-61	0.0	0.8815
1. PBF	Q17YL7	UvrABC system protein B	0.00e+00	2.22e-67	0.0	0.9068
1. PBF	B4SZK1	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8931
1. PBF	C3KV20	UvrABC system protein B	0.00e+00	1.70e-62	0.0	0.8905
1. PBF	Q5X0E6	UvrABC system protein B	0.00e+00	3.85e-63	0.0	0.8777
1. PBF	Q0SW76	UvrABC system protein B	0.00e+00	2.50e-70	0.0	0.8874
1. PBF	Q7NJH7	UvrABC system protein B	0.00e+00	1.04e-75	0.0	0.7878
1. PBF	Q04K81	UvrABC system protein B	0.00e+00	1.23e-62	0.0	0.8966
1. PBF	B6J1E8	UvrABC system protein B	0.00e+00	5.71e-62	0.0	0.8953
1. PBF	A2RIP3	UvrABC system protein B	0.00e+00	6.10e-54	0.0	0.9044
1. PBF	Q6KH72	UvrABC system protein B	0.00e+00	9.38e-73	0.0	0.9661
1. PBF	Q46323	UvrABC system protein B	0.00e+00	1.47e-70	0.0	0.887
1. PBF	Q3ZZK7	UvrABC system protein B	0.00e+00	1.85e-69	0.0	0.8834
1. PBF	P94846	UvrABC system protein B	0.00e+00	7.25e-64	0.0	0.9004
1. PBF	Q324B3	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8959
1. PBF	B7IEY7	UvrABC system protein B	0.00e+00	9.26e-58	0.0	0.8767
1. PBF	Q56243	UvrABC system protein B	0.00e+00	2.63e-59	0.0	0.8729
1. PBF	B5XYX2	UvrABC system protein B	0.00e+00	9.25e-57	0.0	0.8902
1. PBF	Q6LZA2	UvrABC system protein B	0.00e+00	9.66e-67	0.0	0.9139
1. PBF	P57844	UvrABC system protein B	0.00e+00	1.17e-60	0.0	0.8905
1. PBF	A8GR53	UvrABC system protein B	0.00e+00	1.53e-63	0.0	0.8899
1. PBF	Q8PRZ9	UvrABC system protein B	0.00e+00	5.69e-58	0.0	0.8877
1. PBF	A0JWN0	UvrABC system protein B	0.00e+00	4.95e-53	0.0	0.8978
1. PBF	Q48SZ1	UvrABC system protein B	0.00e+00	1.10e-65	0.0	0.8897
1. PBF	Q2JRR3	UvrABC system protein B	0.00e+00	3.07e-62	0.0	0.8929
1. PBF	B3WCQ5	UvrABC system protein B	0.00e+00	3.22e-59	0.0	0.8971
1. PBF	Q8YXS9	UvrABC system protein B	0.00e+00	7.25e-70	0.0	0.896
1. PBF	Q815I3	UvrABC system protein B	0.00e+00	1.80e-62	0.0	0.888
1. PBF	A5UNK6	UvrABC system protein B	0.00e+00	4.36e-64	0.0	0.8966
1. PBF	A0PP48	UvrABC system protein B	0.00e+00	4.15e-46	0.0	0.892
1. PBF	Q4L4I5	UvrABC system protein B	0.00e+00	5.48e-66	0.0	0.8933
1. PBF	Q5XBN4	UvrABC system protein B	0.00e+00	6.19e-66	0.0	0.8888
1. PBF	B7NA78	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8955
1. PBF	Q3K051	UvrABC system protein B	0.00e+00	4.36e-67	0.0	0.8875
1. PBF	Q7TV80	UvrABC system protein B	0.00e+00	4.66e-58	0.0	0.8814
1. PBF	B9DSH1	UvrABC system protein B	0.00e+00	1.14e-63	0.0	0.8923
1. PBF	Q480C7	UvrABC system protein B	0.00e+00	1.29e-53	0.0	0.8908
1. PBF	Q2NJ77	UvrABC system protein B	0.00e+00	4.04e-76	0.0	0.8791
1. PBF	Q8DYL6	UvrABC system protein B	0.00e+00	1.01e-65	0.0	0.8881
1. PBF	Q821H8	UvrABC system protein B	0.00e+00	1.95e-68	0.0	0.8846
1. PBF	Q31QS4	UvrABC system protein B	0.00e+00	6.30e-71	0.0	0.7879
1. PBF	Q1JLB5	UvrABC system protein B	0.00e+00	2.42e-65	0.0	0.8899
1. PBF	P58174	UvrABC system protein B	0.00e+00	2.16e-62	0.0	0.9671
1. PBF	A4W1F7	UvrABC system protein B	0.00e+00	1.16e-64	0.0	0.8875
1. PBF	Q9HMT9	UvrABC system protein B	0.00e+00	1.18e-49	0.0	0.8782
1. PBF	Q5LYS1	UvrABC system protein B	0.00e+00	4.62e-60	0.0	0.8877
1. PBF	Q0SM15	UvrABC system protein B	0.00e+00	1.62e-64	0.0	0.8727
1. PBF	Q04QJ9	UvrABC system protein B	0.00e+00	1.07e-55	0.0	0.882
1. PBF	A9B464	UvrABC system protein B	0.00e+00	6.37e-48	0.0	0.8768
1. PBF	A9WT85	UvrABC system protein B	0.00e+00	2.73e-54	0.0	0.9012
1. PBF	Q83E18	UvrABC system protein B	0.00e+00	5.71e-62	0.0	0.8974
1. PBF	P45125	UvrABC system protein B	0.00e+00	5.11e-59	0.0	0.8979
1. PBF	Q747K3	UvrABC system protein B	0.00e+00	5.16e-66	0.0	0.8826
1. PBF	B7M751	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8948
1. PBF	Q3AFF4	UvrABC system protein B	0.00e+00	4.13e-70	0.0	0.8864
1. PBF	A1VDN0	UvrABC system protein B	0.00e+00	3.32e-63	0.0	0.8826
1. PBF	C6DDU0	UvrABC system protein B	0.00e+00	6.36e-60	0.0	0.8953
1. PBF	Q3KF38	UvrABC system protein B	0.00e+00	2.79e-59	0.0	0.8837
1. PBF	Q5HVA1	UvrABC system protein B	0.00e+00	3.63e-63	0.0	0.8886
1. PBF	Q71WT9	UvrABC system protein B	0.00e+00	3.69e-66	0.0	0.8833
1. PBF	Q5HQX0	UvrABC system protein B	0.00e+00	1.67e-66	0.0	0.8932
1. PBF	B5R765	UvrABC system protein B	0.00e+00	6.59e-57	0.0	0.8921
1. PBF	C1CKX8	UvrABC system protein B	0.00e+00	2.43e-62	0.0	0.8903
1. PBF	A1BI09	UvrABC system protein B	0.00e+00	3.82e-58	0.0	0.8828
1. PBF	B1L280	UvrABC system protein B	0.00e+00	2.49e-61	0.0	0.8899
1. PBF	Q8RGR2	UvrABC system protein B	0.00e+00	2.58e-57	0.0	0.9003
1. PBF	Q99ZA5	UvrABC system protein B	0.00e+00	3.08e-66	0.0	0.8882
1. PBF	Q8P0J7	UvrABC system protein B	0.00e+00	1.68e-65	0.0	0.8884
1. PBF	P0A8F9	UvrABC system protein B	0.00e+00	1.97e-58	0.0	0.8955
1. PBF	B6EGH8	UvrABC system protein B	0.00e+00	3.86e-61	0.0	0.8924
1. PBF	Q7UA24	UvrABC system protein B	0.00e+00	7.04e-64	0.0	0.7785
1. PBF	A1R6F3	UvrABC system protein B	0.00e+00	1.44e-53	0.0	0.9041
3. BF	Q8NXZ6	Transcription-repair-coupling factor	6.69e-06	NA	2.36e-13	0.5911
3. BF	Q9WY22	Primosomal protein N'	2.76e-02	NA	2.19e-06	0.3771
3. BF	Q92H58	Transcription-repair-coupling factor	4.49e-05	NA	0.001	0.4556
3. BF	Q4UMJ0	Transcription-repair-coupling factor	4.43e-05	NA	3.28e-06	0.47
3. BF	Q4L3G0	Transcription-repair-coupling factor	6.12e-06	NA	1.18e-15	0.5143
3. BF	Q9ZJ57	Transcription-repair-coupling factor	6.16e-03	NA	0.008	0.2679
3. BF	Q55750	Transcription-repair-coupling factor	7.69e-06	NA	5.07e-04	0.4863
3. BF	A2QC74	ATP-dependent RNA helicase dbp2	1.39e-03	NA	5.90e-05	0.3836
3. BF	Q2HGF7	ATP-dependent RNA helicase DBP5	4.95e-03	NA	0.048	0.4226
3. BF	O26066	Transcription-repair-coupling factor	5.71e-05	NA	0.008	0.2666
3. BF	O52236	Transcription-repair-coupling factor	6.52e-06	NA	3.37e-05	0.5355
3. BF	C4LB49	ATP-dependent RNA helicase RhlB	3.75e-04	NA	1.20e-04	0.4651
3. BF	Q4L7W0	DEAD-box ATP-dependent RNA helicase CshA	8.18e-05	NA	3.52e-04	0.4039
3. BF	Q6GBY5	Transcription-repair-coupling factor	6.20e-06	NA	2.36e-13	0.5026
3. BF	Q7A7B2	Transcription-repair-coupling factor	4.52e-06	NA	5.11e-14	0.5058
3. BF	Q8CMT1	Transcription-repair-coupling factor	5.25e-06	NA	1.35e-13	0.6173
3. BF	Q6FP38	ATP-dependent RNA helicase DBP1	7.64e-04	NA	6.25e-05	0.3481
3. BF	Q6GHK8	ATP-dependent DNA helicase RecG	4.07e-03	NA	0.034	0.423
3. BF	Q6GJG8	Transcription-repair-coupling factor	6.06e-06	NA	1.52e-14	0.5964
3. BF	Q1RI82	Transcription-repair-coupling factor	3.97e-05	NA	5.65e-05	0.3791
3. BF	Q7RY59	ATP-dependent rRNA helicase rrp-3	8.31e-04	NA	0.011	0.3847
3. BF	Q2FJD8	Transcription-repair-coupling factor	6.55e-06	NA	7.21e-14	0.6041
3. BF	Q2YVY2	Transcription-repair-coupling factor	7.11e-06	NA	1.59e-13	0.59
3. BF	A6RW56	ATP-dependent rRNA helicase rrp3	5.82e-04	NA	0.010	0.43
3. BF	B2VG58	ATP-dependent RNA helicase RhlB	2.11e-04	NA	0.014	0.4552
3. BF	O05955	Transcription-repair-coupling factor	9.31e-06	NA	6.04e-05	0.4749
3. BF	A0KEG9	ATP-dependent RNA helicase RhlB	1.87e-04	NA	0.004	0.4798
3. BF	A7EML8	ATP-dependent rRNA helicase rrp3	4.75e-04	NA	0.006	0.4202
3. BF	P37474	Transcription-repair-coupling factor	7.48e-07	NA	3.14e-21	0.6379
3. BF	Q9AKD5	Transcription-repair-coupling factor	3.20e-06	NA	2.02e-07	0.4638
3. BF	Q6BRF0	ATP-dependent DNA helicase MPH1	1.42e-02	NA	0.006	0.2977
3. BF	Q0UK12	ATP-dependent rRNA helicase RRP3	2.42e-03	NA	0.007	0.3911
3. BF	Q99WA0	Transcription-repair-coupling factor	4.34e-06	NA	5.11e-14	0.5942
3. BF	Q49V12	Transcription-repair-coupling factor	7.12e-06	NA	2.02e-13	0.6102
3. BF	Q9DF36	Nucleolar RNA helicase 2-B	6.98e-03	NA	4.56e-05	0.334
3. BF	Q5HRQ2	Transcription-repair-coupling factor	7.41e-06	NA	1.42e-13	0.5212
3. BF	A4RIF1	ATP-dependent RNA helicase DBP5	3.21e-03	NA	0.009	0.462
3. BF	O69460	ATP-dependent DNA helicase RecG	2.09e-04	NA	5.28e-05	0.3967
3. BF	A5DBI5	ATP-dependent RNA helicase DBP5	1.36e-03	NA	0.004	0.4152
3. BF	Q89AK2	Transcription-repair-coupling factor	2.22e-02	NA	0.016	0.4383
3. BF	Q7RZ35	ATP-dependent RNA helicase dbp-4	5.06e-03	NA	0.020	0.3157
3. BF	P45128	Transcription-repair-coupling factor	2.89e-06	NA	1.72e-05	0.3993
3. BF	Q5HIH2	Transcription-repair-coupling factor	6.66e-06	NA	7.72e-14	0.6036
3. BF	Q2H1Q8	ATP-dependent rRNA helicase RRP3	6.45e-04	NA	2.44e-04	0.3937
4. PB	O51776	UvrABC system protein B	NA	1.17e-63	0.0	NA
4. PB	P9WFC7	UvrABC system protein B	0.00e+00	4.78e-50	0.0	NA
4. PB	Q8FJP8	UvrABC system protein B	NA	2.28e-58	0.0	NA
4. PB	P0A8F8	UvrABC system protein B	0.00e+00	1.97e-58	0.0	NA
5. P	Q6BZD9	ATP-dependent DNA helicase CHL1	1.30e-02	2.37e-02	NA	NA
5. P	Q6CAX3	ATP-dependent DNA helicase CHL1	4.03e-02	8.40e-03	NA	NA
5. P	A5DUW8	ATP-dependent DNA helicase CHL1	2.18e-02	9.70e-03	NA	NA
5. P	Q6CIF0	ATP-dependent DNA helicase CHL1	1.02e-02	4.54e-02	NA	NA
5. P	Q4WWE9	ATP-dependent DNA helicase chl1	1.13e-01	4.18e-02	NA	NA
6. F	A9MJ29	ATP-dependent RNA helicase RhlB	3.32e-04	NA	NA	0.4592
6. F	A6ZPU3	ATP-dependent RNA helicase DBP4	5.64e-03	NA	NA	0.3287
6. F	Q7MGP7	ATP-dependent RNA helicase RhlB	7.18e-04	NA	NA	0.4583
6. F	Q6LLL5	ATP-dependent RNA helicase RhlB	5.42e-04	NA	NA	0.4788
6. F	Q57AV4	Protein translocase subunit SecA	3.67e-02	NA	NA	0.3509
6. F	B1LG35	Protein translocase subunit SecA	7.17e-04	NA	NA	0.3544
6. F	B7M141	Protein translocase subunit SecA	9.08e-04	NA	NA	0.3237
6. F	B2K046	ATP-dependent RNA helicase RhlB	3.21e-04	NA	NA	0.4368
6. F	Q0SYX0	ATP-dependent RNA helicase RhlB	3.18e-04	NA	NA	0.4454
6. F	A9CRJ7	General transcription and DNA repair factor IIH helicase subunit XPB	1.00e-03	NA	NA	0.4049
6. F	Q8X0X2	ATP-dependent RNA helicase dbp-5	1.96e-04	NA	NA	0.4414
6. F	Q68WJ4	Primosomal protein N'	1.52e-02	NA	NA	0.3874
6. F	B5QVH2	ATP-dependent RNA helicase RhlB	3.20e-04	NA	NA	0.4544
6. F	A9R0R9	Protein translocase subunit SecA	7.23e-04	NA	NA	0.3394
6. F	Q8ZRT7	Protein translocase subunit SecA	8.03e-04	NA	NA	0.3379
6. F	Q2UTQ9	Chromatin-remodeling ATPase INO80	8.92e-02	NA	NA	0.2869
6. F	P0A8J9	ATP-dependent RNA helicase RhlB	3.71e-04	NA	NA	0.4531
6. F	A2R9H9	Chromatin-remodeling ATPase INO80	1.74e-01	NA	NA	0.2924
6. F	A5DEZ5	ATP-dependent RNA helicase MSS116, mitochondrial	1.31e-03	NA	NA	0.3341
6. F	A3LS22	ATP-dependent rRNA helicase RRP3	2.64e-03	NA	NA	0.4197
6. F	Q580W5	TFIIH basal transcription factor complex helicase XPB subunit	2.44e-02	NA	NA	0.3666
6. F	B7VME9	ATP-dependent RNA helicase RhlB	7.56e-04	NA	NA	0.4525
6. F	Q9DEY9	Bloom syndrome protein homolog	2.56e-02	NA	NA	0.3701
6. F	P43809	ATP-dependent DNA helicase RecG	2.10e-03	NA	NA	0.3775
6. F	P45345	Penicillin-binding protein 1B	2.39e-01	NA	NA	0.3563
6. F	Q5ARK3	Helicase swr1	2.32e-01	NA	NA	0.2982
6. F	P74759	Reverse gyrase	2.41e-02	NA	NA	0.2457
6. F	B7LU75	ATP-dependent RNA helicase RhlB	3.28e-04	NA	NA	0.46
6. F	B2VD75	Protein translocase subunit SecA	1.36e-03	NA	NA	0.3283
6. F	A7ICM7	Protein translocase subunit SecA	8.55e-02	NA	NA	0.3343
6. F	Q92HH1	Primosomal protein N'	4.89e-02	NA	NA	0.3823
6. F	A5UDI1	ATP-dependent RNA helicase RhlB	1.42e-04	NA	NA	0.4695
6. F	Q9Z6Y2	Primosomal protein N'	1.23e-02	NA	NA	0.3772
6. F	P54509	Uncharacterized ATP-dependent helicase YqhH	1.01e-03	NA	NA	0.3262
6. F	A7TJS7	ATP-dependent rRNA helicase SPB4	3.48e-04	NA	NA	0.3277
6. F	P9WMQ6	ATP-dependent DNA helicase RecG	3.68e-04	NA	NA	0.4012
6. F	Q6CGD1	ATP-dependent RNA helicase DBP4	4.19e-03	NA	NA	0.329
6. F	Q7A366	Protein translocase subunit SecA 2	1.23e-03	NA	NA	0.3409
6. F	A5E6W6	ATP-dependent rRNA helicase RRP3	1.21e-03	NA	NA	0.3817
6. F	Q2NL08	ATP-dependent RNA helicase DDX55	3.28e-03	NA	NA	0.3563
6. F	Q6CN92	ATP-dependent rRNA helicase SPB4	2.23e-04	NA	NA	0.31
6. F	A7ZTY2	ATP-dependent RNA helicase RhlB	3.78e-04	NA	NA	0.4522
6. F	A7TGU7	ATP-dependent RNA helicase DHH1	4.95e-04	NA	NA	0.4069
6. F	A7ESL8	ATP-dependent RNA helicase dbp4	9.36e-03	NA	NA	0.3277
6. F	Q82W86	Protein translocase subunit SecA	8.40e-03	NA	NA	0.3415
6. F	Q9CJS1	ATP-dependent RNA helicase RhlB	1.35e-04	NA	NA	0.4659
6. F	Q7NJJ6	Protein translocase subunit SecA	2.40e-02	NA	NA	0.3095
6. F	P9WL20	Uncharacterized protein MT2985	9.76e-04	NA	NA	0.3451
6. F	P57296	Penicillin-binding protein 1B	1.82e-01	NA	NA	0.3765
6. F	Q32743	Protein translocase subunit SecA	3.76e-03	NA	NA	0.3385
6. F	Q5B5E7	ATP-dependent rRNA helicase rrp3	6.57e-04	NA	NA	0.4116
6. F	C0Q5J4	Protein translocase subunit SecA	7.28e-04	NA	NA	0.3395
6. F	Q6CZD9	ATP-dependent RNA helicase RhlB	1.84e-04	NA	NA	0.4575
6. F	Q381F9	DNA repair helicase XPB-R	5.62e-04	NA	NA	0.3434
6. F	A7FM57	Protein translocase subunit SecA	1.40e-03	NA	NA	0.3467
6. F	Q15N18	ATP-dependent RNA helicase RhlB	3.22e-04	NA	NA	0.4583
6. F	Q5RF63	ATP-dependent DNA helicase Q1	1.31e-03	NA	NA	0.4045
6. F	B7MR01	ATP-dependent RNA helicase RhlB	3.77e-04	NA	NA	0.4534
6. F	Q87KH5	ATP-dependent RNA helicase RhlB	7.47e-04	NA	NA	0.4402
6. F	B5RFS3	ATP-dependent RNA helicase RhlB	3.16e-04	NA	NA	0.4648
6. F	Q0CMM5	ATP-dependent RNA helicase dbp4	7.47e-03	NA	NA	0.3322
6. F	Q25BN1	Endoribonuclease Dicer	1.05e-01	NA	NA	0.2201
6. F	B4RWX1	Protein translocase subunit SecA	7.11e-04	NA	NA	0.3543
6. F	Q8XAT4	ATP-dependent RNA helicase RhlB	3.16e-04	NA	NA	0.4595
6. F	Q8P4D4	ATP-dependent RNA helicase RhlB	4.17e-03	NA	NA	0.3456
6. F	Q5ZJF6	Probable ATP-dependent RNA helicase DDX10	6.81e-03	NA	NA	0.3263
6. F	Q7VQI2	Protein translocase subunit SecA	4.05e-02	NA	NA	0.332
6. F	Q5RA62	General transcription and DNA repair factor IIH helicase subunit XPB	3.55e-03	NA	NA	0.3729
6. F	Q6FPT7	ATP-dependent RNA helicase DBP4	5.73e-03	NA	NA	0.3245
6. F	Q0TLP1	Protein translocase subunit SecA	1.62e-02	NA	NA	0.3303
6. F	Q1RMT1	General transcription and DNA repair factor IIH helicase subunit XPB	5.26e-03	NA	NA	0.3564
6. F	Q1C223	Protein translocase subunit SecA	1.47e-03	NA	NA	0.3575
6. F	O51568	Transcription-repair-coupling factor	4.36e-03	NA	NA	0.4379
6. F	Q1RG97	Protein translocase subunit SecA	6.82e-04	NA	NA	0.3361
6. F	A2QS00	ATP-dependent RNA helicase dbp4	5.19e-03	NA	NA	0.3297
6. F	Q74Z27	Chromatin-remodeling ATPase INO80	7.07e-02	NA	NA	0.2929
6. F	A1DNF9	ATP-dependent RNA helicase dbp4	1.05e-02	NA	NA	0.3278
6. F	Q9CMB4	ATP-dependent DNA helicase RecG	1.36e-03	NA	NA	0.373
6. F	C4V922	General transcription and DNA repair factor IIH helicase subunit XPB	4.22e-03	NA	NA	0.3685
6. F	Q0UR48	ATP-dependent RNA helicase HAS1	2.25e-03	NA	NA	0.3366
6. F	Q2KVH9	Protein translocase subunit SecA 1	5.19e-03	NA	NA	0.3573
6. F	Q89AR2	Penicillin-binding protein 1B	8.15e-02	NA	NA	0.3929
6. F	P44680	Probable ATP-dependent DNA helicase HI_0387	8.86e-05	NA	NA	0.408
6. F	B7N7X1	Protein translocase subunit SecA	1.27e-03	NA	NA	0.3517
6. F	Q9HPZ2	Putative DNA helicase Rad25	8.18e-03	NA	NA	0.3939
6. F	A7ZW50	Protein translocase subunit SecA	1.46e-03	NA	NA	0.3352
6. F	Q7CSN9	Protein translocase subunit SecA	1.16e-02	NA	NA	0.3594
6. F	Q7SCC1	Dicer-like protein 2	2.09e-01	NA	NA	0.321
6. F	P40724	ATP-dependent DNA helicase RecQ	4.20e-04	NA	NA	0.3875
6. F	O67226	Reverse gyrase 2	6.21e-02	NA	NA	0.2377
6. F	Q8ZAD8	ATP-dependent RNA helicase RhlB	1.81e-04	NA	NA	0.457
6. F	A7A237	ATP-dependent rRNA helicase SPB4	2.64e-03	NA	NA	0.3379
6. F	A7ZHI9	Protein translocase subunit SecA	7.88e-04	NA	NA	0.3608
6. F	A5DQF1	ATP-dependent rRNA helicase RRP3	7.47e-04	NA	NA	0.4252
6. F	E1BB03	DNA annealing helicase and endonuclease ZRANB3	2.52e-02	NA	NA	0.3359
6. F	B0RWT6	ATP-dependent RNA helicase RhlB	4.42e-03	NA	NA	0.3447
6. F	Q6TUI4	Endoribonuclease Dicer	1.69e-01	NA	NA	0.222
6. F	A4R227	Chromatin-remodeling ATPase INO80	2.65e-01	NA	NA	0.2913
6. F	A3KMX0	DNA excision repair protein ERCC-6-like 2	2.13e-01	NA	NA	0.2672
6. F	A7H8E6	Protein translocase subunit SecA	5.51e-03	NA	NA	0.3341
6. F	B7M5C7	ATP-dependent RNA helicase RhlB	3.15e-04	NA	NA	0.479
6. F	A1CW14	ATP-dependent RNA helicase has1	4.88e-03	NA	NA	0.331
6. F	P0CO19	Helicase SWR1	5.08e-02	NA	NA	0.2873
6. F	A4QTR1	ATP-dependent RNA helicase DBP9	1.38e-02	NA	NA	0.314
6. F	Q2UHB7	ATP-dependent RNA helicase dbp4	8.47e-03	NA	NA	0.3333
6. F	Q7S2N9	ATP-dependent RNA helicase has-1	7.11e-04	NA	NA	0.3462
6. F	Q5ZLN8	ATP-dependent RNA helicase DDX55	2.40e-03	NA	NA	0.3569
6. F	A7MXT4	ATP-dependent RNA helicase RhlB	1.40e-03	NA	NA	0.4561
6. F	Q0UMB9	ATP-dependent RNA helicase DBP4	1.17e-02	NA	NA	0.3275
6. F	A5DLF4	ATP-dependent RNA helicase DBP4	5.42e-03	NA	NA	0.3205
6. F	A6SCT6	ATP-dependent RNA helicase dbp3	9.76e-04	NA	NA	0.3836
6. F	Q97ZF5	Reverse gyrase 2	4.21e-02	NA	NA	0.2354
6. F	P0A2P1	ATP-dependent RNA helicase RhlB	3.26e-04	NA	NA	0.4602
6. F	A7MQI2	ATP-dependent RNA helicase RhlB	3.29e-04	NA	NA	0.4599
6. F	B5RH72	Protein translocase subunit SecA	7.07e-04	NA	NA	0.3406
6. F	P57297	Protein translocase subunit SecA	5.52e-04	NA	NA	0.3525
6. F	Q9TTA5	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1	1.52e-02	NA	NA	0.3427
6. F	B7UMN5	ATP-dependent RNA helicase RhlB	3.19e-04	NA	NA	0.4617
6. F	Q9ZBD8	Probable helicase HelY	2.59e-02	NA	NA	0.3182
6. F	Q8XD86	ATP-dependent DNA helicase RecG	2.34e-04	NA	NA	0.3897
6. F	Q9ZJA1	ATP-dependent DNA helicase RecG	6.13e-03	NA	NA	0.3839
6. F	Q5BCI0	ATP-dependent RNA helicase mak5	6.08e-03	NA	NA	0.3506
6. F	Q6D0J2	Protein translocase subunit SecA	6.90e-04	NA	NA	0.3439
6. F	B1JK72	Protein translocase subunit SecA	1.48e-03	NA	NA	0.3553
6. F	B7UIE8	Protein translocase subunit SecA	7.92e-04	NA	NA	0.3369
6. F	A7TJ71	ATP-dependent RNA helicase DBP4	5.78e-03	NA	NA	0.3283
6. F	Q83NT4	Protein translocase subunit SecA	6.19e-03	NA	NA	0.3383
6. F	Q5FWR0	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1	3.41e-03	NA	NA	0.3115
6. F	Q9PA24	ATP-dependent RNA helicase RhlB	4.94e-03	NA	NA	0.3834
6. F	Q2GMX1	ATP-dependent RNA helicase HAS1	2.66e-03	NA	NA	0.3482
6. F	Q1EB31	ATP-dependent RNA helicase DBP4	9.99e-03	NA	NA	0.3302
6. F	A1CR32	ATP-dependent rRNA helicase rrp3	7.43e-04	NA	NA	0.4145
6. F	B7NTG2	ATP-dependent RNA helicase RhlB	3.26e-04	NA	NA	0.4511
6. F	P39145	ComF operon protein 1	8.41e-06	NA	NA	0.5593
6. F	Q74Z73	ATP-dependent RNA helicase HAS1	2.37e-03	NA	NA	0.4085
6. F	P0CQ84	ATP-dependent RNA helicase HAS1	3.53e-03	NA	NA	0.3434
6. F	Q2A2E3	Protein translocase subunit SecA	1.51e-03	NA	NA	0.3274
6. F	Q4UL64	Primosomal protein N'	6.05e-03	NA	NA	0.3848
6. F	Q15Q25	Protein translocase subunit SecA	6.79e-04	NA	NA	0.3498
6. F	B7MAM1	Protein translocase subunit SecA	8.14e-04	NA	NA	0.356
6. F	Q5V5F7	Putative DNA helicase Rad25	4.80e-03	NA	NA	0.3669
6. F	Q8CSV3	ATP-dependent DNA helicase RecG	3.95e-03	NA	NA	0.4221
6. F	Q7WFT1	Protein translocase subunit SecA	2.20e-03	NA	NA	0.355
6. F	A4REU9	ATP-dependent RNA helicase MAK5	2.82e-03	NA	NA	0.3484
6. F	Q7W4C3	Protein translocase subunit SecA	3.03e-03	NA	NA	0.3552
6. F	B5EZ40	ATP-dependent RNA helicase RhlB	3.81e-04	NA	NA	0.4482
6. F	Q6E6J3	General transcription and DNA repair factor IIH helicase subunit XPB	2.79e-03	NA	NA	0.3833
6. F	B7MNV7	Protein translocase subunit SecA	6.97e-04	NA	NA	0.343
6. F	O84783	Primosomal protein N'	2.13e-02	NA	NA	0.3779
6. F	Q4WTV7	Chromatin-remodeling ATPase INO80	1.14e-01	NA	NA	0.2903
6. F	Q6BXG0	ATP-dependent RNA helicase DBP4	5.74e-03	NA	NA	0.319
6. F	Q9PLE5	Primosomal protein N'	2.47e-02	NA	NA	0.3832
6. F	A1CTZ2	ATP-dependent RNA helicase dbp4	9.50e-03	NA	NA	0.3206
6. F	Q0CDT1	ATP-dependent RNA helicase dbp5	2.30e-03	NA	NA	0.4119
6. F	Q57X81	Bifunctional helicase and thymine dioxygenase JBP2	9.20e-03	NA	NA	0.2962
6. F	Q0P4U8	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1	3.19e-02	NA	NA	0.3269
6. F	Q47281	Type I restriction enzyme EcoEI R protein	2.47e-01	NA	NA	0.3646
6. F	P96130	ATP-dependent DNA helicase RecG	9.31e-04	NA	NA	0.4269
6. F	O50224	ATP-dependent DNA helicase RecG	1.05e-02	NA	NA	0.6323
6. F	P64323	ATP-dependent DNA helicase RecG	2.75e-04	NA	NA	0.4054
6. F	Q1DUF9	Chromatin-remodeling ATPase INO80	2.12e-01	NA	NA	0.2851
6. F	B7L8B6	ATP-dependent RNA helicase RhlB	3.16e-04	NA	NA	0.4473
6. F	Q5RC67	Probable ATP-dependent RNA helicase DDX23	5.63e-03	NA	NA	0.3326
6. F	P0CO18	Helicase SWR1	6.38e-02	NA	NA	0.2889
6. F	Q0HE90	Protein translocase subunit SecA	7.22e-04	NA	NA	0.3511
6. F	B6I4B6	ATP-dependent RNA helicase RhlB	3.68e-04	NA	NA	0.4545
6. F	B1IR80	Protein translocase subunit SecA	6.96e-04	NA	NA	0.3313
6. F	Q8PFZ3	ATP-dependent RNA helicase RhlB	4.06e-03	NA	NA	0.3414
6. F	Q75C76	ATP-dependent RNA helicase DBP4	4.20e-03	NA	NA	0.3305
6. F	P0A2P0	ATP-dependent RNA helicase RhlB	3.17e-04	NA	NA	0.4643
6. F	Q4WM60	ATP-dependent RNA helicase dbp4	4.64e-03	NA	NA	0.3307
6. F	A4RGU2	ATP-dependent RNA helicase DBP4	5.26e-03	NA	NA	0.3244
6. F	Q2G6U3	Protein translocase subunit SecA	4.14e-02	NA	NA	0.3482
6. F	Q4WAS9	Helicase swr1	2.90e-01	NA	NA	0.2728
6. F	B2KAS3	Protein translocase subunit SecA	1.92e-02	NA	NA	0.3484
6. F	P05445	Primosomal protein N'	6.47e-02	NA	NA	0.3681
6. F	Q5GUR8	ATP-dependent RNA helicase RhlB	4.46e-03	NA	NA	0.3394
6. F	Q9I920	Bloom syndrome protein homolog	5.51e-03	NA	NA	0.3733
6. F	A8WK63	Putative ATP-dependent DNA helicase Q1	1.08e-02	NA	NA	0.3943
6. F	Q81E85	DEAD-box ATP-dependent RNA helicase CshC	1.04e-04	NA	NA	0.5505
6. F	Q6BKC2	Helicase SWR1	1.02e-01	NA	NA	0.2888
6. F	A7EFH4	ATP-dependent DNA helicase mph1	1.92e-02	NA	NA	0.3051
6. F	Q8SSK1	General transcription and DNA repair factor IIH helicase subunit XPB	3.61e-03	NA	NA	0.3796
6. F	A3MSA1	ATP-dependent DNA helicase Hel308	2.44e-03	NA	NA	0.3308
6. F	A5V9S7	Protein translocase subunit SecA	1.13e-02	NA	NA	0.3263
6. F	Q4P328	Helicase SWR1	3.61e-01	NA	NA	0.2949
6. F	Q750Q4	ATP-dependent RNA helicase MSS116, mitochondrial	1.04e-03	NA	NA	0.3393
6. F	B5YY28	ATP-dependent RNA helicase RhlB	3.27e-04	NA	NA	0.4741
6. F	Q9ZD10	Primosomal protein N'	1.62e-02	NA	NA	0.3997
6. F	Q7S133	Helicase swr-1	3.19e-01	NA	NA	0.2778
6. F	Q6BH93	ATP-dependent RNA helicase HAS1	2.91e-03	NA	NA	0.3544
6. F	Q4IAS1	ATP-dependent RNA helicase DBP4	9.23e-03	NA	NA	0.3317
6. F	Q4JC68	ATP-dependent DNA helicase Saci_0192	2.51e-03	NA	NA	0.3833
6. F	Q5HPW4	ATP-dependent DNA helicase RecG	4.40e-03	NA	NA	0.4236
6. F	Q75EW9	ATP-dependent rRNA helicase RRP3	1.18e-03	NA	NA	0.4465
6. F	Q66EJ6	Protein translocase subunit SecA	1.48e-03	NA	NA	0.3437
6. F	E1B7X9	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1	2.52e-03	NA	NA	0.3001
6. F	A8G9T6	Protein translocase subunit SecA	1.47e-03	NA	NA	0.322
6. F	B8D900	Protein translocase subunit SecA	5.93e-04	NA	NA	0.364
6. F	Q3BNH8	ATP-dependent RNA helicase RhlB	2.80e-03	NA	NA	0.3377
6. F	Q4UPY5	ATP-dependent RNA helicase RhlB	4.38e-03	NA	NA	0.3451
6. F	Q6BQ61	ATP-dependent rRNA helicase RRP3	1.03e-03	NA	NA	0.4255
6. F	P0A8K0	ATP-dependent RNA helicase RhlB	3.24e-04	NA	NA	0.4539
6. F	Q8X996	Protein translocase subunit SecA	8.33e-04	NA	NA	0.3544
6. F	Q5BFU1	ATP-dependent RNA helicase dbp4	5.23e-03	NA	NA	0.3331
6. F	P64327	Transcription-repair-coupling factor	2.85e-05	NA	NA	0.517
6. F	O34750	Probable ATP-dependent RNA helicase YfmL	4.84e-04	NA	NA	0.5843
6. F	Q498E7	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1	2.05e-02	NA	NA	0.3394
6. F	P9WMQ4	Transcription-repair-coupling factor	3.53e-05	NA	NA	0.5402
6. F	P44781	RNA polymerase-associated protein RapA	1.00e-02	NA	NA	0.2895
6. F	A3GGE9	ATP-dependent RNA helicase DBP4	6.18e-03	NA	NA	0.3165
6. F	Q8SR01	ATP-dependent RNA helicase DBP4	2.07e-04	NA	NA	0.4609
6. F	Q6CH58	ATP-dependent rRNA helicase RRP3	8.85e-04	NA	NA	0.4397
6. F	Q6CRF4	ATP-dependent RNA helicase DBP4	4.70e-03	NA	NA	0.3182
6. F	O51767	ATP-dependent RNA helicase HrpA	7.22e-03	NA	NA	0.3819
6. F	Q60HG1	General transcription and DNA repair factor IIH helicase subunit XPB	5.82e-03	NA	NA	0.382
6. F	P57381	Transcription-repair-coupling factor	3.04e-04	NA	NA	0.4367
6. F	Q879Y6	ATP-dependent RNA helicase RhlB	4.68e-03	NA	NA	0.4015
6. F	B0S3K9	Protein translocase subunit SecA	3.96e-03	NA	NA	0.3502
6. F	A1C9W6	Chromatin-remodeling ATPase INO80	1.86e-01	NA	NA	0.2915
6. F	O26051	ATP-dependent DNA helicase RecG	6.23e-04	NA	NA	0.3842
6. F	A8A6N4	ATP-dependent RNA helicase RhlB	4.20e-04	NA	NA	0.4515
6. F	A4TQ74	Protein translocase subunit SecA	1.35e-03	NA	NA	0.343
6. F	A6TGG9	ATP-dependent RNA helicase RhlB	3.18e-04	NA	NA	0.4646
6. F	Q1RI08	Primosomal protein N'	3.11e-02	NA	NA	0.377
6. F	Q07736	Type I restriction enzyme EcoAI R protein	1.74e-02	NA	NA	0.3576
6. F	O51528	ATP-dependent DNA helicase RecG	6.26e-03	NA	NA	0.3893
6. F	Q5E8U5	ATP-dependent RNA helicase RhlB	1.97e-04	NA	NA	0.4455
6. F	Q2NB30	Protein translocase subunit SecA	6.11e-02	NA	NA	0.3331
6. F	Q4WJE9	ATP-dependent rRNA helicase rrp3	5.15e-04	NA	NA	0.4182
6. F	A5E3K3	ATP-dependent RNA helicase DBP4	5.27e-03	NA	NA	0.3241
6. F	Q6AZV7	ATP-dependent RNA helicase DDX55	4.39e-03	NA	NA	0.3419
6. F	A4WG30	ATP-dependent RNA helicase RhlB	3.28e-04	NA	NA	0.4643
6. F	Q8D301	Protein translocase subunit SecA	1.14e-03	NA	NA	0.3346
6. F	A6VQU2	RNA polymerase-associated protein RapA	2.63e-02	NA	NA	0.2729
6. F	Q2H2J1	ATP-dependent RNA helicase DBP4	1.37e-02	NA	NA	0.3183
7. B	Q2UNB7	ATP-dependent rRNA helicase rrp3	5.96e-04	NA	0.004	NA
7. B	P10081	ATP-dependent RNA helicase eIF4A	6.55e-04	NA	0.014	NA
7. B	Q6BU54	ATP-dependent RNA helicase DED1	7.80e-04	NA	0.002	NA
7. B	A4QU31	ATP-dependent RNA helicase FAL1	6.49e-04	NA	0.003	NA
7. B	Q0CMB0	ATP-dependent RNA helicase rok1	1.10e-03	NA	0.009	NA
7. B	Q914K8	Putative helicase 22	NA	NA	4.26e-04	NA
7. B	P19109	ATP-dependent RNA helicase p62	6.24e-04	NA	0.006	NA
7. B	P94461	Primosomal protein N'	5.18e-02	NA	2.80e-04	NA
7. B	Q4P184	ATP-dependent RNA helicase FAL1	6.63e-04	NA	6.05e-04	NA
7. B	Q1DW80	Dicer-like protein 2	2.67e-02	NA	0.001	NA
7. B	Q2HFP1	ATP-dependent RNA helicase eIF4A	3.51e-04	NA	0.023	NA
7. B	Q6FKN8	ATP-dependent RNA helicase DBP5	1.87e-03	NA	2.01e-06	NA
7. B	Q0CL13	ATP-dependent RNA helicase dbp3	5.58e-04	NA	2.16e-04	NA
7. B	Q9P6U9	ATP-dependent RNA helicase ded1	1.93e-03	NA	0.040	NA
7. B	Q0CNX1	ATP-dependent RNA helicase dbp8	1.21e-03	NA	0.035	NA
7. B	A7TK63	ATP-dependent RNA helicase DBP8	2.59e-04	NA	0.002	NA
7. B	O42226	Eukaryotic initiation factor 4A-III-B	7.20e-04	NA	1.05e-04	NA
7. B	A7TSV4	ATP-dependent DNA helicase MPH1	3.57e-02	NA	0.036	NA
7. B	A5DQS0	ATP-dependent RNA helicase DED1	1.55e-03	NA	1.69e-04	NA
7. B	Q6CXT4	ATP-dependent RNA helicase eIF4A	7.31e-04	NA	5.83e-04	NA
7. B	Q2FF45	DEAD-box ATP-dependent RNA helicase CshA	1.40e-04	NA	0.002	NA
7. B	Q55D61	Eukaryotic initiation factor 4A	3.64e-04	NA	0.007	NA
7. B	Q5HME0	DEAD-box ATP-dependent RNA helicase CshA	1.58e-04	NA	3.86e-04	NA
7. B	A6ZT77	ATP-dependent RNA helicase DBP8	2.72e-04	NA	1.85e-04	NA
7. B	B7ZTW1	Eukaryotic initiation factor 4A-III	6.19e-04	NA	1.07e-04	NA
7. B	Q2YUH3	DEAD-box ATP-dependent RNA helicase CshA	8.59e-05	NA	0.002	NA
7. B	Q1DTB3	ATP-dependent RNA helicase FAL1	6.40e-04	NA	0.001	NA
7. B	P87206	ATP-dependent RNA helicase eIF4A	2.37e-03	NA	0.004	NA
7. B	Q1DJF0	ATP-dependent RNA helicase DED1	1.86e-03	NA	0.020	NA
7. B	Q8TFK8	ATP-dependent RNA helicase DED1	5.66e-04	NA	0.005	NA
7. B	Q54900	ATP-dependent DNA helicase RecG	1.67e-03	NA	2.56e-05	NA
7. B	Q4IJH1	ATP-dependent RNA helicase DBP3	4.52e-04	NA	7.30e-06	NA
7. B	Q5RKI1	Eukaryotic initiation factor 4A-II	1.34e-04	NA	0.042	NA
7. B	Q6FM43	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	1.23e-03	NA	0.012	NA
7. B	Q75BL8	ATP-dependent RNA helicase eIF4A	7.00e-04	NA	0.034	NA
7. B	A3GFI4	ATP-dependent RNA helicase eIF4A	2.61e-03	NA	0.003	NA
7. B	A1DGZ7	ATP-dependent RNA helicase dbp2	1.34e-03	NA	9.47e-05	NA
7. B	Q6BT27	ATP-dependent RNA helicase FAL1	2.16e-04	NA	7.42e-04	NA
7. B	Q6CT46	ATP-dependent RNA helicase DBP3	5.80e-04	NA	0.020	NA
7. B	Q6CX73	ATP-dependent RNA helicase FAL1	3.19e-04	NA	2.00e-04	NA
7. B	Q10MH8	DEAD-box ATP-dependent RNA helicase 24	6.24e-04	NA	0.033	NA
7. B	Q49Z29	DEAD-box ATP-dependent RNA helicase CshA	1.58e-04	NA	3.85e-04	NA
7. B	Q95YF3	ATP-dependent RNA helicase cgh-1	1.43e-03	NA	0.003	NA
7. B	A5DB98	ATP-dependent RNA helicase eIF4A	2.90e-03	NA	0.001	NA
7. B	P0CQ73	ATP-dependent RNA helicase FAL1	6.54e-04	NA	0.023	NA
7. B	A6ZNQ1	ATP-dependent RNA helicase DBP5	1.66e-03	NA	1.09e-05	NA
7. B	Q756G5	ATP-dependent RNA helicase DBP8	2.44e-04	NA	0.001	NA
7. B	Q6FQZ0	ATP-dependent RNA helicase DBP8	2.57e-04	NA	0.014	NA
7. B	A4R715	ATP-dependent RNA helicase DHH1	1.15e-03	NA	0.034	NA
7. B	A2QAB5	ATP-dependent RNA helicase rok1	7.09e-03	NA	0.015	NA
7. B	P0CQ97	ATP-dependent RNA helicase SUB2	9.44e-04	NA	0.006	NA
7. B	Q6GWX0	Probable ATP-dependent RNA helicase DDX4	1.83e-03	NA	2.32e-04	NA
7. B	Q6BGU8	ATP-dependent RNA helicase DBP8	1.81e-04	NA	6.52e-05	NA
7. B	I3XHK1	DEAD-box ATP-dependent RNA helicase FANCM	2.38e-02	NA	0.001	NA
7. B	A6ZUA1	ATP-dependent RNA helicase DBP3	3.08e-04	NA	0.003	NA
7. B	Q6G7M9	DEAD-box ATP-dependent RNA helicase CshA	8.93e-05	NA	0.002	NA
7. B	Q8H136	DEAD-box ATP-dependent RNA helicase 14	1.46e-03	NA	0.006	NA
7. B	P64325	ATP-dependent DNA helicase RecG	4.40e-03	NA	0.033	NA
7. B	Q5B0J9	ATP-dependent RNA helicase dbp2	1.59e-03	NA	3.73e-05	NA
7. B	Q6FJG1	ATP-dependent RNA helicase FAL1	2.62e-04	NA	0.005	NA
7. B	Q9HGM5	ATP-dependent RNA helicase dbp8	2.04e-04	NA	0.036	NA
7. B	Q2G0R8	Transcription-repair-coupling factor	8.03e-06	NA	7.21e-14	NA
7. B	A0A1D5PRR9	Fanconi anemia group M protein	1.26e-01	NA	0.010	NA
7. B	A5DKW3	ATP-dependent RNA helicase DRS1	2.28e-03	NA	0.021	NA
7. B	Q86XP3	ATP-dependent RNA helicase DDX42	4.46e-03	NA	0.029	NA
7. B	Q4R5S7	Probable ATP-dependent RNA helicase DDX4	1.32e-03	NA	1.58e-04	NA
7. B	A1C9M6	Dicer-like protein 2	8.51e-02	NA	0.019	NA
7. B	Q4X195	ATP-dependent RNA helicase dbp2	9.15e-04	NA	8.48e-05	NA
7. B	Q99SH6	DEAD-box ATP-dependent RNA helicase CshA	1.55e-04	NA	0.002	NA
7. B	Q7ZVA6	Eukaryotic initiation factor 4A-III	5.75e-04	NA	0.002	NA
7. B	P23394	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	7.95e-04	NA	3.36e-04	NA
7. B	A5E0U9	ATP-dependent RNA helicase DBP8	1.82e-04	NA	4.71e-05	NA
7. B	Q6G9Y6	ATP-dependent DNA helicase RecG	4.32e-03	NA	0.033	NA
7. B	P74397	Primosomal protein N'	1.15e-02	NA	6.43e-04	NA
7. B	A7TEF4	ATP-dependent RNA helicase FAL1	3.52e-04	NA	3.96e-04	NA
7. B	Q754U8	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	3.82e-03	NA	0.006	NA
7. B	Q4P9P3	ATP-dependent RNA helicase DRS1	1.01e-02	NA	0.004	NA
7. B	A2QFL3	ATP-dependent RNA helicase dbp3	6.43e-04	NA	7.81e-05	NA
7. B	Q6FQQ6	ATP-dependent RNA helicase eIF4A	7.57e-04	NA	0.006	NA
7. B	A5DWJ1	ATP-dependent RNA helicase FAL1	3.45e-04	NA	8.68e-04	NA
7. B	Q9NQI0	Probable ATP-dependent RNA helicase DDX4	1.35e-03	NA	2.29e-04	NA
7. B	Q9DBN9	Probable ATP-dependent RNA helicase DDX59	1.12e-03	NA	4.76e-04	NA
7. B	Q6ZPL9	ATP-dependent RNA helicase DDX55	3.13e-03	NA	0.008	NA
7. B	A6ZVS0	ATP-dependent DNA helicase MPH1	2.89e-02	NA	0.009	NA
7. B	Q3ZBV2	ATP-dependent RNA helicase DDX19A	3.11e-03	NA	0.001	NA
7. B	Q5AUL4	ATP-dependent RNA helicase fal1	7.11e-04	NA	0.001	NA
7. B	Q5T1V6	Probable ATP-dependent RNA helicase DDX59	5.74e-04	NA	2.82e-04	NA
7. B	Q2HBE7	ATP-dependent RNA helicase DED1	1.80e-03	NA	0.044	NA
7. B	Q7SBC6	ATP-dependent RNA helicase dbp2	4.69e-04	NA	2.87e-04	NA
7. B	P24782	ATP-dependent RNA helicase dbp2	4.47e-04	NA	8.14e-06	NA
7. B	Q9LYJ9	DEAD-box ATP-dependent RNA helicase 46	7.24e-04	NA	0.024	NA
7. B	Q6C3X7	ATP-dependent RNA helicase DBP5	3.26e-03	NA	0.002	NA
7. B	Q4PHU9	ATP-dependent RNA helicase DBP2	4.52e-04	NA	7.67e-06	NA
7. B	P27639	Eukaryotic initiation factor 4A	7.24e-04	NA	0.006	NA
7. B	Q7A0D2	DEAD-box ATP-dependent RNA helicase CshA	1.33e-04	NA	0.002	NA
7. B	Q8SRB2	ATP-dependent RNA helicase DBP2	1.74e-04	NA	0.017	NA
7. B	Q2GUI4	ATP-dependent RNA helicase DBP3	5.35e-03	NA	4.68e-05	NA
7. B	Q8IYD8	Fanconi anemia group M protein	2.24e-01	NA	0.014	NA
7. B	P41380	Eukaryotic initiation factor 4A-3	6.51e-04	NA	0.002	NA
7. B	A7TK55	ATP-dependent RNA helicase eIF4A	7.09e-04	NA	0.002	NA
7. B	A6M931	Eukaryotic initiation factor 4A-III	6.24e-04	NA	8.30e-05	NA
7. B	Q4FZF3	Probable ATP-dependent RNA helicase DDX49	1.80e-04	NA	1.43e-04	NA
7. B	Q5HEB9	DEAD-box ATP-dependent RNA helicase CshA	9.73e-05	NA	0.002	NA
7. B	P0CQ76	ATP-dependent RNA helicase DBP2-A	2.65e-04	NA	6.02e-05	NA
7. B	P20447	ATP-dependent RNA helicase DBP3	3.09e-04	NA	0.002	NA
7. B	A2Q8R2	ATP-dependent DNA helicase mph1	2.66e-02	NA	0.027	NA
7. B	Q3EBC8	Endoribonuclease Dicer homolog 2	2.98e-02	NA	0.028	NA
7. B	Q5AWA6	ATP-dependent RNA helicase dbp3	5.73e-04	NA	0.003	NA
7. B	P24783	ATP-dependent RNA helicase DBP2	4.75e-04	NA	3.83e-04	NA
7. B	Q6BRE4	ATP-dependent RNA helicase DBP5	1.74e-03	NA	3.96e-04	NA
7. B	Q75B50	ATP-dependent RNA helicase DED1	6.87e-04	NA	0.006	NA
7. B	Q5R7D1	ATP-dependent RNA helicase DDX42	3.75e-03	NA	0.027	NA
7. B	A3LQ01	ATP-dependent RNA helicase DED1	8.65e-04	NA	0.005	NA
7. B	Q2UMH8	ATP-dependent RNA helicase dbp3	3.95e-04	NA	0.035	NA
7. B	Q4WH83	ATP-dependent RNA helicase dbp3	5.42e-04	NA	0.001	NA
7. B	Q8SR63	ATP-dependent rRNA helicase RRP3	7.03e-04	NA	0.013	NA
7. B	P06634	ATP-dependent RNA helicase DED1	7.46e-04	NA	0.005	NA
7. B	B5FZY7	Eukaryotic initiation factor 4A-III	6.28e-04	NA	9.78e-05	NA
7. B	P0CQ96	ATP-dependent RNA helicase SUB2	9.75e-04	NA	0.006	NA
7. B	Q4IAA0	ATP-dependent RNA helicase FAL1	6.60e-04	NA	0.002	NA
7. B	Q6C799	ATP-dependent RNA helicase DBP8	3.54e-04	NA	0.003	NA
7. B	F4INA9	ATP-dependent DNA helicase homolog RECG, chloroplastic	3.29e-03	NA	0.015	NA
7. B	P21507	ATP-dependent RNA helicase SrmB	3.47e-04	NA	8.33e-04	NA
7. B	Q55681	ATP-dependent DNA helicase RecG	6.95e-02	NA	0.021	NA
7. B	P0CQ92	ATP-dependent RNA helicase DRS1	3.24e-03	NA	0.020	NA
7. B	Q5A9Z6	ATP-dependent RNA helicase FAL1	6.72e-04	NA	3.39e-04	NA
7. B	A3LRW2	ATP-dependent RNA helicase DBP3	3.86e-04	NA	0.002	NA
7. B	Q66HG7	Probable ATP-dependent RNA helicase DDX59	9.34e-02	NA	8.64e-05	NA
7. B	O13370	ATP-dependent RNA helicase ded1	1.53e-03	NA	0.011	NA
7. B	Q2GWJ5	ATP-dependent RNA helicase FAL1	8.30e-04	NA	0.003	NA
7. B	Q8NX11	ATP-dependent DNA helicase RecG	4.12e-03	NA	0.033	NA
7. B	Q5B3H7	ATP-dependent RNA helicase dbp8	1.83e-03	NA	0.036	NA
7. B	A3LP87	ATP-dependent RNA helicase DBP8	2.80e-04	NA	1.78e-05	NA
7. B	A1C5V3	ATP-dependent RNA helicase dbp3	6.01e-04	NA	2.74e-04	NA
7. B	Q9UJV9	Probable ATP-dependent RNA helicase DDX41	8.78e-02	NA	0.049	NA
7. B	Q6BRN4	ATP-dependent RNA helicase eIF4A	4.16e-04	NA	0.001	NA
7. B	A7TKR8	ATP-dependent RNA helicase DED1	1.38e-03	NA	0.038	NA
7. B	P30958	Transcription-repair-coupling factor	2.68e-05	NA	6.10e-09	NA
7. B	Q3B8Q2	Eukaryotic initiation factor 4A-III	6.25e-04	NA	8.30e-05	NA
7. B	A6QXC1	ATP-dependent RNA helicase DBP3	3.92e-04	NA	0.001	NA
7. B	Q0CAS8	ATP-dependent RNA helicase fal1	6.84e-04	NA	0.001	NA
7. B	Q6H874	DEAD-box ATP-dependent RNA helicase 47A	5.08e-03	NA	0.003	NA
7. B	Q10I26	Eukaryotic initiation factor 4A-III homolog B	6.39e-04	NA	0.009	NA
7. B	Q4WA22	Dicer-like protein 2	7.85e-02	NA	0.015	NA
7. B	Q14240	Eukaryotic initiation factor 4A-II	1.45e-04	NA	0.042	NA
7. B	A5DLE0	ATP-dependent RNA helicase DBP8	1.48e-04	NA	8.57e-05	NA
7. B	Q6FPQ3	ATP-dependent DNA helicase MPH1	6.18e-02	NA	0.007	NA
7. B	Q8R5F7	Interferon-induced helicase C domain-containing protein 1	1.08e-02	NA	0.047	NA
7. B	Q5A1A0	ATP-dependent DNA helicase MPH1	1.15e-02	NA	8.96e-04	NA
7. B	P24784	ATP-dependent RNA helicase DBP1	7.87e-04	NA	4.48e-04	NA
7. B	Q755W0	ATP-dependent RNA helicase FAL1	3.99e-04	NA	8.22e-04	NA
7. B	A3GFV3	ATP-dependent RNA helicase FAL1	3.88e-04	NA	3.24e-04	NA
7. B	Q6DRI7	ATP-dependent RNA helicase DDX51	3.96e-03	NA	0.022	NA
7. B	A7E449	ATP-dependent RNA helicase dbp2	1.21e-03	NA	1.88e-04	NA
7. B	A6SFV4	ATP-dependent RNA helicase dbp8	2.26e-03	NA	0.017	NA
7. B	Q75AA7	ATP-dependent DNA helicase MPH1	5.30e-02	NA	0.006	NA
7. B	A1D071	ATP-dependent RNA helicase fal1	6.99e-04	NA	0.001	NA
7. B	Q9LUW6	DEAD-box ATP-dependent RNA helicase 9, mitochondrial	4.08e-03	NA	0.039	NA
7. B	Q810A7	ATP-dependent RNA helicase DDX42	1.70e-03	NA	0.012	NA
7. B	Q12099	ATP-dependent RNA helicase FAL1	2.78e-04	NA	6.07e-04	NA
7. B	Q4R3Q1	Eukaryotic initiation factor 4A-III	6.26e-04	NA	8.30e-05	NA
7. B	P0A4D7	DEAD-box ATP-dependent RNA helicase CshA	1.60e-03	NA	0.005	NA
7. B	Q9C551	DEAD-box ATP-dependent RNA helicase 5	2.96e-04	NA	0.007	NA
7. B	Q9NUU7	ATP-dependent RNA helicase DDX19A	2.35e-03	NA	0.001	NA
7. B	Q6C347	ATP-dependent RNA helicase FAL1	6.70e-04	NA	0.005	NA
7. B	Q1DP69	ATP-dependent RNA helicase DBP2	8.22e-04	NA	1.02e-05	NA
7. B	Q4WEB4	ATP-dependent RNA helicase fal1	6.93e-04	NA	0.001	NA
7. B	Q8NHQ9	ATP-dependent RNA helicase DDX55	2.71e-03	NA	0.048	NA
7. B	Q9P735	ATP-dependent RNA helicase fal-1	6.69e-04	NA	0.003	NA
7. B	A6ZXY5	ATP-dependent RNA helicase FAL1	2.79e-04	NA	6.07e-04	NA
7. B	Q59LU0	ATP-dependent RNA helicase DBP2	6.67e-04	NA	4.69e-04	NA
7. B	Q06683	Putative ATP-dependent helicase IRC3	2.74e-02	NA	0.004	NA
7. B	Q3MSQ8	Probable ATP-dependent RNA helicase DDX4	1.09e-03	NA	1.78e-04	NA
7. B	Q2U070	ATP-dependent RNA helicase dbp2	5.24e-04	NA	5.04e-05	NA
7. B	Q4IFI0	ATP-dependent rRNA helicase RRP3	2.17e-03	NA	7.85e-04	NA
7. B	A5DAC8	ATP-dependent RNA helicase DBP3	7.49e-04	NA	0.044	NA
7. B	A6S4N4	ATP-dependent RNA helicase fal1	6.62e-04	NA	0.002	NA
7. B	Q6C9P3	ATP-dependent RNA helicase DBP3	7.26e-04	NA	0.019	NA
7. B	P75335	Probable ATP-dependent RNA helicase MG308 homolog	5.75e-05	NA	0.006	NA
7. B	Q2UKX3	ATP-dependent RNA helicase dbp8	1.00e-03	NA	0.045	NA
7. B	Q5U526	Eukaryotic initiation factor 4A-III-A	7.19e-04	NA	5.18e-05	NA
7. B	Q55804	RNA helicase CrhR	3.45e-04	NA	0.007	NA
7. B	P20449	ATP-dependent RNA helicase DBP5	1.65e-03	NA	1.09e-05	NA
7. B	P0CQ86	ATP-dependent RNA helicase DBP5	3.22e-03	NA	0.005	NA
7. B	O76743	ATP-dependent RNA helicase glh-4	6.31e-03	NA	0.004	NA
7. B	Q4PEX7	ATP-dependent RNA helicase DBP8	2.34e-02	NA	1.98e-04	NA
7. B	Q4I662	ATP-dependent RNA helicase DBP8	1.56e-03	NA	0.024	NA
7. B	A7E436	ATP-dependent RNA helicase dbp8	2.29e-03	NA	0.022	NA
7. B	Q9VHS8	Eukaryotic initiation factor 4A-III	2.68e-04	NA	0.002	NA
7. B	C8V8H4	ATP-dependent RNA helicase ded1	1.79e-03	NA	0.017	NA
7. B	A1DG51	ATP-dependent RNA helicase dbp3	4.06e-04	NA	0.001	NA
7. B	A4STJ7	ATP-dependent RNA helicase RhlB	3.48e-04	NA	0.003	NA
7. B	Q8Y8N0	ATP-dependent RNA helicase CshA	9.09e-04	NA	0.045	NA
7. B	Q9UMR2	ATP-dependent RNA helicase DDX19B	3.25e-03	NA	0.001	NA
7. B	Q2UAK1	ATP-dependent RNA helicase fal1	6.75e-04	NA	0.001	NA
7. B	P0CQ70	ATP-dependent RNA helicase eIF4A	7.44e-04	NA	0.021	NA
7. B	Q8CRP6	DEAD-box ATP-dependent RNA helicase CshA	1.61e-04	NA	4.14e-04	NA
7. B	Q5ZM36	Eukaryotic initiation factor 4A-III	6.41e-04	NA	9.65e-05	NA
7. B	Q4JG17	Probable ATP-dependent RNA helicase vasa-like	1.36e-03	NA	0.008	NA
7. B	P24125	51.5 kDa protein	NA	NA	0.003	NA
7. B	B5DG42	Eukaryotic initiation factor 4A-III	6.71e-04	NA	1.12e-04	NA
7. B	A7EY76	ATP-dependent RNA helicase dbp5	1.08e-03	NA	0.001	NA
7. B	A1C595	ATP-dependent RNA helicase fal1	6.85e-04	NA	0.001	NA
7. B	Q0UAT0	ATP-dependent RNA helicase FAL1	3.38e-03	NA	0.013	NA
7. B	Q5A4E2	ATP-dependent RNA helicase DED1	1.05e-03	NA	0.004	NA
7. B	Q59PR3	ATP-dependent RNA helicase DBP8	3.05e-04	NA	2.43e-07	NA
7. B	A4R8G3	ATP-dependent RNA helicase DBP8	1.69e-03	NA	0.033	NA
7. B	Q84T03	DEAD-box ATP-dependent RNA helicase 27	3.67e-03	NA	0.010	NA
7. B	Q4WRH5	ATP-dependent RNA helicase rok1	5.69e-02	NA	0.023	NA
7. B	Q6CXW0	ATP-dependent RNA helicase DBP8	1.91e-04	NA	0.028	NA
7. B	A6SFW7	ATP-dependent RNA helicase dbp2	2.28e-04	NA	2.45e-04	NA
7. B	Q7A4G0	DEAD-box ATP-dependent RNA helicase CshA	9.61e-05	NA	0.002	NA
7. B	P44586	ATP-dependent RNA helicase DeaD	1.65e-03	NA	0.003	NA
7. B	Q7ZY47	ATP-dependent RNA helicase DDX42	3.95e-03	NA	0.002	NA
7. B	Q0UN57	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	2.44e-02	NA	0.011	NA
7. B	Q5R4X1	Eukaryotic initiation factor 4A-II	1.37e-04	NA	0.042	NA
7. B	Q54KG1	Probable ATP-dependent RNA helicase ddx41	1.88e-02	NA	0.003	NA
7. B	P0CQ71	ATP-dependent RNA helicase eIF4A	7.42e-04	NA	0.021	NA
7. B	A1CNK1	ATP-dependent RNA helicase rok1	7.13e-03	NA	0.019	NA
7. B	A7TJM9	ATP-dependent RNA helicase DRS1	1.25e-03	NA	0.018	NA
7. B	Q6CQX2	ATP-dependent DNA helicase MPH1	4.28e-02	NA	8.04e-04	NA
7. B	Q2FWH5	DEAD-box ATP-dependent RNA helicase CshA	1.01e-04	NA	0.002	NA
7. B	Q501J6	Probable ATP-dependent RNA helicase DDX17	1.10e-03	NA	3.95e-04	NA
7. B	P64324	ATP-dependent DNA helicase RecG	3.64e-03	NA	0.033	NA
7. B	P0CR01	ATP-dependent rRNA helicase RRP3	2.54e-03	NA	0.020	NA
7. B	A1C6C4	ATP-dependent RNA helicase dbp2	1.12e-03	NA	8.63e-06	NA
7. B	A6ZRX0	ATP-dependent RNA helicase DBP2	4.89e-04	NA	3.96e-04	NA
7. B	P0CQ93	ATP-dependent RNA helicase DRS1	3.34e-03	NA	0.020	NA
7. B	A6SBT4	ATP-dependent RNA helicase dbp5	1.22e-03	NA	0.008	NA
7. B	Q1DZK8	ATP-dependent RNA helicase DBP3	4.69e-04	NA	0.005	NA
7. B	Q91VN6	Probable ATP-dependent RNA helicase DDX41	1.09e-02	NA	0.048	NA
7. B	Q4I7K4	ATP-dependent RNA helicase DED1	1.85e-03	NA	0.021	NA
7. B	Q9DF35	Nucleolar RNA helicase 2-A	5.31e-03	NA	3.94e-05	NA
7. B	Q94A52	Eukaryotic initiation factor 4A-III homolog	6.58e-04	NA	0.021	NA
7. B	A4RHF1	ATP-dependent RNA helicase DED1	4.16e-03	NA	0.013	NA
7. B	P40562	ATP-dependent DNA helicase MPH1	5.17e-02	NA	0.009	NA
7. B	P44701	ATP-dependent RNA helicase SrmB	1.11e-03	NA	0.001	NA
7. B	G0SFM2	ATP-dependent RNA helicase DBP2	5.26e-04	NA	6.88e-04	NA
7. B	A6RGE3	ATP-dependent RNA helicase DBP2	9.61e-04	NA	4.27e-05	NA
7. B	Q8BGE5	Fanconi anemia group M protein homolog	1.84e-01	NA	0.022	NA
7. B	P0A4D8	DEAD-box ATP-dependent RNA helicase CshA	1.59e-03	NA	0.005	NA
7. B	P38719	ATP-dependent RNA helicase DBP8	2.27e-04	NA	1.85e-04	NA
7. B	Q09775	ATP-dependent RNA helicase rok1	1.46e-04	NA	1.89e-04	NA
7. B	A5AAE5	ATP-dependent RNA helicase fal1	6.83e-04	NA	0.001	NA
7. B	D0PV95	ATP-dependent RNA helicase laf-1	2.77e-03	NA	0.001	NA
7. B	Q10055	ATP-dependent RNA helicase fal1	6.56e-04	NA	0.002	NA
7. B	P0CQ77	ATP-dependent RNA helicase DBP2-A	2.91e-04	NA	6.02e-05	NA
7. B	A6ZQJ1	ATP-dependent RNA helicase eIF4A	6.65e-04	NA	0.014	NA
7. B	Q0DBS1	Putative DEAD-box ATP-dependent RNA helicase 51	3.27e-03	NA	0.009	NA
7. B	Q9SA27	DEAD-box ATP-dependent RNA helicase 36	7.34e-04	NA	0.008	NA
7. B	Q61496	ATP-dependent RNA helicase DDX4	1.69e-03	NA	2.84e-05	NA
7. B	Q10PV9	DEAD-box ATP-dependent RNA helicase 47B	1.59e-03	NA	5.82e-04	NA
7. B	A7EJY3	ATP-dependent RNA helicase ded1	1.81e-03	NA	0.034	NA
7. B	Q6CT49	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	2.02e-04	NA	0.002	NA
7. B	A1D1E3	ATP-dependent RNA helicase rok1	4.32e-02	NA	0.027	NA
7. B	Q5W5U4	Probable ATP-dependent RNA helicase DDX4	1.42e-03	NA	1.55e-04	NA
7. B	A5DZX2	ATP-dependent RNA helicase DBP5	1.80e-03	NA	0.028	NA
7. B	Q0ILZ4	DEAD-box ATP-dependent RNA helicase 9	4.47e-03	NA	0.046	NA
7. B	Q6C024	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	1.68e-03	NA	0.021	NA
7. B	Q5VNM3	Eukaryotic initiation factor 4A-III homolog A	5.81e-04	NA	0.009	NA
7. B	C4K8M8	ATP-dependent RNA helicase RhlB	7.14e-04	NA	3.05e-04	NA
7. B	A6QSQ0	ATP-dependent RNA helicase FAL1	3.62e-04	NA	0.001	NA
7. B	A3GH91	ATP-dependent RNA helicase DBP5	1.79e-03	NA	0.004	NA
7. B	Q6FLF3	ATP-dependent RNA helicase DBP2	5.64e-04	NA	0.002	NA
7. B	Q2NL22	Eukaryotic initiation factor 4A-III	6.29e-04	NA	8.30e-05	NA
7. B	Q7S5D9	ATP-dependent RNA helicase dhh1	4.47e-03	NA	0.044	NA
7. B	A5DZE6	ATP-dependent RNA helicase DED1	1.91e-03	NA	0.005	NA
7. B	Q3SZ65	Eukaryotic initiation factor 4A-II	1.57e-04	NA	0.042	NA
7. B	A5DS77	ATP-dependent RNA helicase DBP2	2.07e-04	NA	0.027	NA
7. B	A6ZWD3	ATP-dependent RNA helicase DBP1	7.55e-04	NA	5.09e-04	NA
7. B	A5DVM3	ATP-dependent RNA helicase eIF4A	4.12e-04	NA	0.009	NA
7. B	Q92841	Probable ATP-dependent RNA helicase DDX17	1.83e-03	NA	5.31e-04	NA
7. B	Q4P3U9	ATP-dependent rRNA helicase RRP3	2.92e-03	NA	0.005	NA
7. B	Q91VC3	Eukaryotic initiation factor 4A-III	6.21e-04	NA	8.23e-05	NA
7. B	Q4R4Y9	Eukaryotic initiation factor 4A-II	4.32e-04	NA	0.044	NA
7. B	Q6C4D4	ATP-dependent RNA helicase DBP2	7.55e-04	NA	1.92e-05	NA
7. B	P10630	Eukaryotic initiation factor 4A-II	1.40e-04	NA	0.042	NA
7. B	A6ZP47	ATP-dependent RNA helicase DED1	6.56e-04	NA	0.005	NA
7. B	P38919	Eukaryotic initiation factor 4A-III	4.81e-04	NA	8.30e-05	NA
7. B	Q6CIV2	ATP-dependent RNA helicase DBP2	6.02e-04	NA	0.003	NA
7. B	A3GH78	ATP-dependent DNA helicase MPH1	3.14e-03	NA	0.005	NA
7. B	A7EM88	ATP-dependent RNA helicase fal1	6.54e-04	NA	0.002	NA
7. B	Q84934	Genome polyprotein	NA	NA	0.031	NA
7. B	Q9Y6V7	Probable ATP-dependent RNA helicase DDX49	1.83e-04	NA	5.63e-04	NA
7. B	Q7S5R1	ATP-dependent RNA helicase dbp-3	1.88e-03	NA	4.80e-06	NA
7. B	Q2UQW3	ATP-dependent RNA helicase rok1	4.22e-03	NA	0.016	NA
7. B	Q61655	ATP-dependent RNA helicase DDX19A	2.43e-03	NA	0.001	NA
7. B	Q6CJU1	ATP-dependent RNA helicase DBP5	2.59e-03	NA	1.43e-04	NA
7. B	Q0DB53	DEAD-box ATP-dependent RNA helicase 52A	3.84e-04	NA	0.025	NA
7. B	A5DE68	ATP-dependent RNA helicase FAL1	3.73e-04	NA	0.008	NA
7. B	Q64060	Probable ATP-dependent RNA helicase DDX4	1.24e-03	NA	1.85e-04	NA
7. B	Q10202	ATP-dependent RNA helicase dbp3	2.91e-03	NA	0.034	NA
7. B	Q75C39	ATP-dependent RNA helicase DBP5	1.70e-03	NA	2.67e-04	NA
7. B	Q72DX8	UvrABC system protein C	2.10e-01	NA	0.043	NA
7. B	P0CR00	ATP-dependent rRNA helicase RRP3	1.56e-03	NA	0.020	NA
7. B	P0CQ72	ATP-dependent RNA helicase FAL1	6.50e-04	NA	0.023	NA
7. B	Q6FS54	ATP-dependent RNA helicase DBP3	1.77e-04	NA	0.004	NA
7. B	Q755N4	ATP-dependent RNA helicase DBP2	1.17e-03	NA	3.45e-04	NA
7. B	A4RGD1	ATP-dependent rRNA helicase RRP3	1.17e-03	NA	0.019	NA
7. B	Q6GEZ3	DEAD-box ATP-dependent RNA helicase CshA	8.72e-05	NA	0.002	NA
7. B	P0CQ87	ATP-dependent RNA helicase DBP5	3.45e-03	NA	0.005	NA