Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54991.1
JCVISYN3A_0831
Phosphoribosylpyrophosphate synthetase.
M. mycoides homolog: Q6MS30.
TIGRfam Classification: 4=Probable.
Category: Essential.
Statistics
Total GO Annotation: 48
Unique PROST Go: 2
Unique BLAST Go: 0
Unique Foldseek Go: 13
Total Homologs: 281
Unique PROST Homologs: 3
Unique BLAST Homologs: 12
Unique Foldseek Homologs: 55
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q0C5A1
(Ribose-phosphate pyrophosphokinase) with a FATCAT P-Value: 0 and RMSD of 1.87 angstrom. The sequence alignment identity is 39.2%.
Structural alignment shown in left. Query protein AVX54991.1 colored as red in alignment, homolog Q0C5A1 colored as blue.
Query protein AVX54991.1 is also shown in right top, homolog Q0C5A1 showed in right bottom. They are colored based on secondary structures.
AVX54991.1 MDNKDIYVFGLSASQQLAKEVCHFLGVEQKV----VKTTRFADGEILVESID-SVRGKEIYVIQSTSMPVNENLMELLIAIDAFKRGSAEKINVVIPYYG 95 Q0C5A1 M--K---LISCNANRPLSDAIADYL--DMRLTRSEVKT--FADQEIFV-RIDENVRGEDVFVIQSTSYPANDNLMQLLIMMDALRRASARRITAVIPYFG 90 AVX54991.1 YARQDRKAKGRQPITAKLVADLLTKAGADRVIVFDIHSTQTMGFFDMPMDN-FHTSQSLANEIVDTIIREKFDPEKCILVSPDYGGLNR---VHK-VDSY 190 Q0C5A1 YARQDRKTDGRTPISAKLVANLISTAGADRVLTVDLHAGQIQGFFDIPTDNLF--GGPV---MVDD-IKERYGKEKIIVVSPDVGGVVRARSLAKRLDD- 183 AVX54991.1 TANMTNGIAVIGKRRPEPNKAEVEFVLGDIEGRTCFIIDDMIDTGGTIISGAKALKANGAKDVYIFACHGLFNGPAKERMTQAIKEGIVKNVVVTNTVEI 290 Q0C5A1 -AD----LAIVDKRRPEAGKSEVMNIIGDVRGARCIMLDDMCDSGGTLANAAAALKEHGASSVSAYVTHGVLSGSAVER----IEKSVLDELVMTDTIQ- 273 AVX54991.1 PQER--QFEGLKIVSVAPLLANMIKE-SQEHHSLTEVYNKNKDEIQLKIQDFMNHKN 344 Q0C5A1 PSEHALKSKNIRVLPISPLLGEAIRRIANE-ESVSKLFDR----------------- 312
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0009116 | nucleoside metabolic process |
| 1. PBF | GO:0009156 | ribonucleoside monophosphate biosynthetic process |
| 1. PBF | GO:0016301 | kinase activity |
| 1. PBF | GO:0006164 | purine nucleotide biosynthetic process |
| 1. PBF | GO:0006015 | 5-phosphoribose 1-diphosphate biosynthetic process |
| 1. PBF | GO:0009152 | purine ribonucleotide biosynthetic process |
| 1. PBF | GO:0005737 | cytoplasm |
| 1. PBF | GO:0005524 | ATP binding |
| 1. PBF | GO:0002189 | ribose phosphate diphosphokinase complex |
| 1. PBF | GO:0004749 | ribose phosphate diphosphokinase activity |
| 1. PBF | GO:0000287 | magnesium ion binding |
| 1. PBF | GO:0009165 | nucleotide biosynthetic process |
| 3. BF | GO:0006223 | uracil salvage |
| 3. BF | GO:0044206 | UMP salvage |
| 3. BF | GO:0004845 | uracil phosphoribosyltransferase activity |
| 4. PB | GO:0046101 | hypoxanthine biosynthetic process |
| 4. PB | GO:0042803 | protein homodimerization activity |
| 4. PB | GO:0032991 | protein-containing complex |
| 4. PB | GO:0034418 | urate biosynthetic process |
| 4. PB | GO:0019003 | GDP binding |
| 4. PB | GO:0005886 | plasma membrane |
| 4. PB | GO:0005634 | nucleus |
| 4. PB | GO:0006144 | purine nucleobase metabolic process |
| 4. PB | GO:0042802 | identical protein binding |
| 4. PB | GO:0019693 | ribose phosphate metabolic process |
| 4. PB | GO:0006139 | nucleobase-containing compound metabolic process |
| 4. PB | GO:0031505 | fungal-type cell wall organization |
| 4. PB | GO:0016208 | AMP binding |
| 4. PB | GO:0006167 | AMP biosynthetic process |
| 4. PB | GO:0004857 | enzyme inhibitor activity |
| 4. PB | GO:0031100 | animal organ regeneration |
| 4. PB | GO:0033673 | negative regulation of kinase activity |
| 4. PB | GO:0043531 | ADP binding |
| 5. P | GO:0045982 | negative regulation of purine nucleobase metabolic process |
| 5. P | GO:0003677 | DNA binding |
| 6. F | GO:0006166 | purine ribonucleoside salvage |
| 6. F | GO:0052657 | guanine phosphoribosyltransferase activity |
| 6. F | GO:0043103 | hypoxanthine salvage |
| 6. F | GO:0032264 | IMP salvage |
| 6. F | GO:0003999 | adenine phosphoribosyltransferase activity |
| 6. F | GO:0005829 | cytosol |
| 6. F | GO:0019856 | pyrimidine nucleobase biosynthetic process |
| 6. F | GO:0044205 | 'de novo' UMP biosynthetic process |
| 6. F | GO:0006168 | adenine salvage |
| 6. F | GO:0004588 | orotate phosphoribosyltransferase activity |
| 6. F | GO:0006222 | UMP biosynthetic process |
| 6. F | GO:0046132 | pyrimidine ribonucleoside biosynthetic process |
| 6. F | GO:0004422 | hypoxanthine phosphoribosyltransferase activity |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0016740 | transferase activity |
| GO:0009156 | ribonucleoside monophosphate biosynthetic process |
| GO:0016310 | phosphorylation |
| GO:0009165 | nucleotide biosynthetic process |
| GO:0005524 | ATP binding |
| GO:0044249 | cellular biosynthetic process |
| GO:0046872 | metal ion binding |
| GO:0004749 | ribose phosphate diphosphokinase activity |
| GO:0000287 | magnesium ion binding |
| GO:0016301 | kinase activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q89DJ1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.21e-39 | 2.75e-81 | 0.9254 |
| 1. PBF | Q9EWS0 | Putative ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.92e-44 | 1.30e-59 | 0.9371 |
| 1. PBF | Q8UDA9 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.38e-47 | 8.29e-74 | 0.9344 |
| 1. PBF | Q8R753 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 8.92e-45 | 1.54e-92 | 0.9341 |
| 1. PBF | Q7U7L5 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.43e-37 | 4.68e-89 | 0.9102 |
| 1. PBF | Q8YIG1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.04e-44 | 1.10e-76 | 0.9399 |
| 1. PBF | O26877 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.04e-21 | 1.97e-36 | 0.8903 |
| 1. PBF | Q7VBH4 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.84e-32 | 1.66e-83 | 0.9124 |
| 1. PBF | Q9UY08 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.46e-19 | 9.99e-41 | 0.8963 |
| 1. PBF | P14193 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.52e-39 | 6.26e-98 | 0.9193 |
| 1. PBF | Q7W181 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.70e-48 | 7.28e-74 | 0.9185 |
| 1. PBF | Q8Y9L8 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 5.01e-37 | 2.96e-74 | 0.9341 |
| 1. PBF | P75044 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.16e-48 | 5.18e-93 | 0.923 |
| 1. PBF | Q9X1W3 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.08e-35 | 2.26e-87 | 0.9292 |
| 1. PBF | Q7N590 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.00e-49 | 4.51e-77 | 0.9159 |
| 1. PBF | Q7NM67 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.07e-33 | 5.49e-85 | 0.9076 |
| 1. PBF | B8GZV1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 6.36e-46 | 4.58e-77 | 0.9341 |
| 1. PBF | A5UNK4 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.71e-28 | 1.23e-44 | 0.8533 |
| 1. PBF | Q8KCQ2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.42e-57 | 2.00e-75 | 0.9024 |
| 1. PBF | P0A1V7 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.10e-49 | 6.30e-77 | 0.921 |
| 1. PBF | Q5R8F8 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 2.91e-30 | 8.04e-72 | 0.9046 |
| 1. PBF | Q8G5P2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.17e-47 | 5.19e-75 | 0.9208 |
| 1. PBF | Q8FQV2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 7.01e-40 | 2.29e-76 | 0.9116 |
| 1. PBF | P65238 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.45e-36 | 1.32e-90 | 0.924 |
| 1. PBF | Q899I8 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.12e-37 | 4.54e-96 | 0.911 |
| 1. PBF | Q92N73 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.50e-45 | 1.41e-81 | 0.9385 |
| 1. PBF | Q9YAW0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 6.47e-29 | 1.35e-21 | 0.8943 |
| 1. PBF | Q8ZU24 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.54e-21 | 8.65e-25 | 0.8797 |
| 1. PBF | Q6GBY8 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.45e-36 | 1.32e-90 | 0.9237 |
| 1. PBF | Q8EAQ9 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.86e-47 | 6.51e-80 | 0.9265 |
| 1. PBF | Q9ZLA1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.12e-33 | 1.21e-72 | 0.9035 |
| 1. PBF | Q9HN88 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.69e-20 | 2.71e-20 | 0.857 |
| 1. PBF | Q49V09 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.52e-37 | 4.36e-94 | 0.9097 |
| 1. PBF | Q8PC63 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.99e-45 | 3.04e-74 | 0.9176 |
| 1. PBF | Q7V111 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.69e-31 | 1.89e-84 | 0.9087 |
| 1. PBF | Q4R4U3 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 5.26e-33 | 1.10e-70 | 0.9045 |
| 1. PBF | B7IFM5 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.22e-39 | 2.91e-78 | 0.926 |
| 1. PBF | P65243 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 7.76e-47 | 3.87e-81 | 0.9237 |
| 1. PBF | Q9HVC5 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 9.83e-44 | 1.28e-78 | 0.9328 |
| 1. PBF | Q888C6 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.38e-43 | 5.38e-77 | 0.9333 |
| 1. PBF | P65245 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 7.76e-47 | 3.87e-81 | 0.9235 |
| 1. PBF | Q55848 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.20e-35 | 4.86e-85 | 0.9093 |
| 1. PBF | Q8U458 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 9.02e-21 | 4.13e-36 | 0.8995 |
| 1. PBF | Q97Z86 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.96e-22 | 1.87e-32 | 0.9107 |
| 1. PBF | Q88Z84 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.88e-49 | 1.24e-92 | 0.9144 |
| 1. PBF | Q723E1 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 3.45e-37 | 4.61e-75 | 0.9346 |
| 1. PBF | Q9AAV6 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 6.36e-46 | 4.58e-77 | 0.9326 |
| 1. PBF | Q83TK1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.01e-34 | 5.45e-90 | 0.9183 |
| 1. PBF | Q8DWM2 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 2.28e-43 | 1.19e-77 | 0.9131 |
| 1. PBF | Q81VZ0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.94e-38 | 3.97e-93 | 0.9183 |
| 1. PBF | P47304 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.47e-50 | 1.92e-90 | 0.9155 |
| 1. PBF | Q8DFF5 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.91e-45 | 3.19e-80 | 0.9113 |
| 1. PBF | Q5ZL26 | Phosphoribosyl pyrophosphate synthase-associated protein 2 | 0.00e+00 | 2.45e-25 | 6.43e-35 | 0.8076 |
| 1. PBF | Q9XGA1 | Ribose-phosphate pyrophosphokinase 4 | 0.00e+00 | 1.38e-19 | 1.05e-15 | 0.8082 |
| 1. PBF | Q8Y2E1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.85e-46 | 5.48e-75 | 0.9333 |
| 1. PBF | Q92EF1 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 5.60e-36 | 4.16e-77 | 0.9351 |
| 1. PBF | Q8DU94 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 9.30e-43 | 3.54e-72 | 0.8876 |
| 1. PBF | Q7WNY4 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.70e-48 | 7.28e-74 | 0.9212 |
| 1. PBF | Q5XGI0 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 1.05e-30 | 4.11e-71 | 0.9042 |
| 1. PBF | Q8PUX3 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 9.45e-17 | 2.07e-36 | 0.8549 |
| 1. PBF | P65242 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 4.06e-40 | 1.05e-68 | 0.9141 |
| 1. PBF | P46585 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.64e-30 | 8.25e-53 | 0.8963 |
| 1. PBF | Q5XC85 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 2.76e-44 | 7.26e-74 | 0.899 |
| 1. PBF | Q8K9X2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.59e-39 | 5.27e-79 | 0.9189 |
| 1. PBF | Q5ZI49 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 1.92e-29 | 1.64e-68 | 0.8833 |
| 1. PBF | O59586 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.74e-23 | 3.29e-40 | 0.891 |
| 1. PBF | Q973F3 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.20e-21 | 6.90e-30 | 0.8984 |
| 1. PBF | Q9HLV6 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.29e-23 | 9.15e-33 | 0.8973 |
| 1. PBF | O67556 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.32e-41 | 1.00e-88 | 0.9335 |
| 1. PBF | O29666 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 9.72e-18 | 3.84e-14 | 0.8896 |
| 1. PBF | Q8CQU7 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.98e-38 | 7.21e-91 | 0.9238 |
| 1. PBF | Q7MMZ1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.91e-45 | 3.19e-80 | 0.9119 |
| 1. PBF | P65233 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.41e-43 | 2.92e-78 | 0.8977 |
| 1. PBF | Q724L4 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 4.12e-37 | 1.31e-88 | 0.9248 |
| 1. PBF | Q9PP15 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.38e-39 | 1.29e-78 | 0.9302 |
| 1. PBF | Q4J9A6 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.67e-23 | 8.17e-27 | 0.9044 |
| 1. PBF | Q82TQ4 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.02e-43 | 3.23e-79 | 0.9271 |
| 1. PBF | Q9KQ22 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.13e-45 | 1.90e-80 | 0.9123 |
| 1. PBF | Q0C5A1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 6.07e-45 | 1.51e-82 | 0.9243 |
| 1. PBF | Q9CD45 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.28e-44 | 3.50e-79 | 0.8985 |
| 1. PBF | Q9KGJ5 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.27e-38 | 2.97e-88 | 0.9233 |
| 1. PBF | Q5RFJ7 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.86e-32 | 2.04e-71 | 0.9033 |
| 1. PBF | P56184 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 9.54e-33 | 1.18e-73 | 0.903 |
| 1. PBF | Q82ZA5 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 1.81e-46 | 1.27e-93 | 0.9085 |
| 1. PBF | Q8TRK8 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.89e-21 | 1.37e-34 | 0.8848 |
| 1. PBF | P65235 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 7.81e-53 | 8.84e-80 | 0.8989 |
| 1. PBF | Q4L3F7 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.19e-38 | 5.04e-90 | 0.9167 |
| 1. PBF | Q9PA76 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 7.13e-37 | 3.96e-75 | 0.9067 |
| 1. PBF | Q08DW2 | Phosphoribosyl pyrophosphate synthase-associated protein 1 | 0.00e+00 | 5.14e-27 | 4.82e-33 | 0.7995 |
| 1. PBF | B0R7B4 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.69e-20 | 2.71e-20 | 0.8582 |
| 1. PBF | Q87RN8 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.27e-45 | 6.42e-81 | 0.9161 |
| 1. PBF | Q8RHM2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.50e-40 | 6.52e-95 | 0.9282 |
| 1. PBF | Q6AJL7 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.81e-32 | 2.03e-80 | 0.9195 |
| 1. PBF | O52958 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.69e-20 | 3.70e-37 | 0.8807 |
| 1. PBF | Q9CP22 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.01e-46 | 1.42e-81 | 0.9262 |
| 1. PBF | Q9RUD2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.06e-43 | 2.00e-62 | 0.9244 |
| 1. PBF | Q8P137 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 1.15e-44 | 6.03e-73 | 0.8986 |
| 1. PBF | Q92F68 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 5.64e-37 | 5.50e-88 | 0.9253 |
| 1. PBF | Q83AQ1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.19e-37 | 5.04e-69 | 0.9127 |
| 1. PBF | P65239 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.53e-49 | 2.06e-84 | 0.9048 |
| 1. PBF | Q5RBA8 | Phosphoribosyl pyrophosphate synthase-associated protein 2 | 0.00e+00 | 2.85e-25 | 1.08e-34 | 0.8103 |
| 1. PBF | Q59988 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 9.24e-38 | 1.06e-89 | 0.9085 |
| 1. PBF | Q9CEI4 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 8.30e-44 | 2.77e-72 | 0.9116 |
| 1. PBF | P9WKE2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.41e-43 | 2.92e-78 | 0.9032 |
| 1. PBF | P65234 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 7.81e-53 | 8.84e-80 | 0.9004 |
| 1. PBF | Q1LTH2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.79e-45 | 3.36e-71 | 0.915 |
| 1. PBF | Q88VA5 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 3.46e-42 | 1.74e-73 | 0.9336 |
| 1. PBF | Q8YN97 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.16e-34 | 3.23e-88 | 0.9083 |
| 1. PBF | P44328 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.66e-48 | 9.77e-83 | 0.9147 |
| 1. PBF | P0A718 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.36e-48 | 4.09e-77 | 0.9208 |
| 1. PBF | Q9PQV0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.06e-47 | 8.94e-98 | 0.8878 |
| 1. PBF | Q7MT83 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.89e-39 | 9.44e-71 | 0.921 |
| 1. PBF | O33924 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.81e-39 | 2.93e-93 | 0.9219 |
| 1. PBF | P65241 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 4.06e-40 | 1.05e-68 | 0.9157 |
| 1. PBF | P65236 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.45e-36 | 1.32e-90 | 0.9238 |
| 1. PBF | B9KPJ0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 9.23e-47 | 1.37e-75 | 0.8991 |
| 1. PBF | Q8E2H0 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.85e-48 | 3.54e-78 | 0.9104 |
| 1. PBF | Q8NRU9 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.50e-43 | 7.69e-75 | 0.9004 |
| 1. PBF | P0DB98 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 7.76e-47 | 3.87e-81 | 0.9201 |
| 1. PBF | P57266 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 8.68e-39 | 5.62e-74 | 0.9184 |
| 1. PBF | Q82HE7 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.48e-43 | 3.44e-85 | 0.9056 |
| 1. PBF | Q98R83 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.13e-52 | 8.83e-84 | 0.9386 |
| 1. PBF | Q9CHB8 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 5.85e-50 | 5.14e-92 | 0.9303 |
| 1. PBF | P0DC00 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 9.93e-45 | 2.74e-73 | 0.9081 |
| 1. PBF | Q72V73 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.47e-47 | 2.75e-91 | 0.9308 |
| 1. PBF | Q7UPM4 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.83e-45 | 3.07e-78 | 0.9226 |
| 1. PBF | Q5HRQ5 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.98e-38 | 7.21e-91 | 0.9237 |
| 1. PBF | Q7VUH1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 7.81e-49 | 9.75e-74 | 0.9201 |
| 1. PBF | Q7ZXC9 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 1.70e-29 | 2.45e-69 | 0.904 |
| 1. PBF | Q83YI7 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.00e-35 | 1.22e-89 | 0.9266 |
| 1. PBF | Q0ARN5 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.45e-40 | 1.47e-80 | 0.9366 |
| 1. PBF | P59512 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 9.31e-45 | 3.79e-71 | 0.9224 |
| 1. PBF | Q7VL55 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 8.13e-48 | 2.03e-79 | 0.912 |
| 1. PBF | Q99ZR0 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 4.13e-44 | 1.39e-72 | 0.8939 |
| 1. PBF | Q8E568 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 3.13e-43 | 5.88e-75 | 0.8846 |
| 1. PBF | Q7VR76 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.15e-46 | 2.69e-71 | 0.9187 |
| 1. PBF | A6W1C7 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.72e-42 | 4.62e-75 | 0.9196 |
| 1. PBF | Q7M8J0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.54e-39 | 5.31e-81 | 0.928 |
| 1. PBF | P65237 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.45e-36 | 1.32e-90 | 0.9236 |
| 1. PBF | P0A719 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.36e-48 | 4.09e-77 | 0.9131 |
| 1. PBF | P42816 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 5.81e-39 | 3.25e-95 | 0.9318 |
| 1. PBF | Q81J97 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.94e-38 | 3.97e-93 | 0.921 |
| 1. PBF | Q6GJH1 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.45e-36 | 1.32e-90 | 0.9236 |
| 1. PBF | Q98HW3 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.23e-46 | 5.11e-77 | 0.9389 |
| 1. PBF | Q2HJ58 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.86e-32 | 2.04e-71 | 0.9098 |
| 1. PBF | Q0BPP0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 9.99e-36 | 1.03e-74 | 0.9345 |
| 1. PBF | Q87A22 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.16e-37 | 3.22e-75 | 0.9004 |
| 1. PBF | Q9XG98 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.12e-24 | 2.70e-83 | 0.9144 |
| 1. PBF | Q8EZN0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.18e-46 | 5.64e-92 | 0.9314 |
| 1. PBF | Q4R4R7 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 2.91e-30 | 8.04e-72 | 0.9047 |
| 1. PBF | Q8ZEY2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.92e-49 | 3.75e-77 | 0.9155 |
| 1. PBF | P0DB99 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 7.76e-47 | 3.87e-81 | 0.9208 |
| 1. PBF | Q8PNU0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.70e-41 | 1.77e-75 | 0.9147 |
| 1. PBF | Q8E7X8 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.85e-48 | 3.54e-78 | 0.9098 |
| 1. PBF | Q48793 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 4.12e-37 | 1.31e-88 | 0.9273 |
| 1. PBF | Q5XEL0 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 7.76e-47 | 3.87e-81 | 0.923 |
| 1. PBF | O28853 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 2.48e-18 | 3.43e-27 | 0.8768 |
| 1. PBF | Q8DZK4 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 3.13e-43 | 5.88e-75 | 0.8963 |
| 1. PBF | Q88PX6 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 7.31e-44 | 3.26e-78 | 0.9328 |
| 1. PBF | P65240 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.53e-49 | 2.06e-84 | 0.9022 |
| 1. PBF | Q5HIH5 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 8.23e-36 | 1.31e-90 | 0.9239 |
| 1. PBF | Q8EU34 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 6.30e-39 | 8.32e-91 | 0.93 |
| 1. PBF | Q9K3U0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.81e-42 | 3.11e-82 | 0.9056 |
| 1. PBF | A2VDS0 | Phosphoribosyl pyrophosphate synthase-associated protein 2 | 0.00e+00 | 1.19e-24 | 1.56e-34 | 0.8212 |
| 1. PBF | Q832Z5 | Putative ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.92e-44 | 1.20e-72 | 0.9022 |
| 1. PBF | Q7NQS9 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.25e-46 | 1.61e-81 | 0.9025 |
| 1. PBF | Q97E93 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.19e-45 | 3.66e-86 | 0.9411 |
| 1. PBF | Q7V6S2 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 8.57e-31 | 1.49e-87 | 0.9095 |
| 1. PBF | Q8TUT6 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 3.94e-30 | 3.06e-42 | 0.873 |
| 1. PBF | P0DC01 | Putative ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 9.93e-45 | 2.74e-73 | 0.904 |
| 1. PBF | Q8FZF0 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 6.76e-45 | 1.03e-76 | 0.9372 |
| 1. PBF | P0A1V6 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.10e-49 | 6.30e-77 | 0.9196 |
| 1. PBF | Q63XL8 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.43e-44 | 1.04e-76 | 0.9188 |
| 1. PBF | Q8XHJ4 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.17e-42 | 2.75e-91 | 0.9162 |
| 1. PBF | Q97CA5 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.47e-26 | 1.89e-34 | 0.8749 |
| 1. PBF | Q7VFY9 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 2.66e-39 | 5.05e-73 | 0.9278 |
| 1. PBF | Q28DH0 | Phosphoribosyl pyrophosphate synthase-associated protein 2 | 0.00e+00 | 1.26e-27 | 5.98e-34 | 0.8022 |
| 3. BF | Q15ZS0 | Uracil phosphoribosyltransferase | 2.74e-04 | NA | 0.029 | 0.5838 |
| 3. BF | Q9XG99 | Ribose-phosphate pyrophosphokinase 2, chloroplastic | 0.00e+00 | NA | 1.41e-84 | 0.9161 |
| 3. BF | Q9XGA0 | Ribose-phosphate pyrophosphokinase 3, mitochondrial | 0.00e+00 | NA | 3.04e-15 | 0.8167 |
| 4. PB | Q12265 | Ribose-phosphate pyrophosphokinase 5 | 6.80e-13 | 2.57e-06 | 6.94e-14 | NA |
| 4. PB | O94413 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 6.92e-35 | 1.91e-57 | NA |
| 4. PB | Q63468 | Phosphoribosyl pyrophosphate synthase-associated protein 1 | 0.00e+00 | 7.60e-27 | 7.28e-33 | NA |
| 4. PB | P32895 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.30e-11 | 4.58e-34 | NA |
| 4. PB | Q6Z2L5 | Ribose-phosphate pyrophosphokinase 1, chloroplastic | 0.00e+00 | 9.47e-04 | 9.33e-83 | NA |
| 4. PB | Q75JN8 | Ribose-phosphate pyrophosphokinase B | 0.00e+00 | 1.42e-30 | 2.48e-49 | NA |
| 4. PB | Q8R574 | Phosphoribosyl pyrophosphate synthase-associated protein 2 | 0.00e+00 | 2.11e-24 | 6.30e-35 | NA |
| 4. PB | Q9D7G0 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.86e-32 | 2.04e-71 | NA |
| 4. PB | P21108 | Ribose-phosphate pyrophosphokinase 3 | 0.00e+00 | 1.35e-33 | 5.08e-70 | NA |
| 4. PB | Q6ZFT5 | Ribose-phosphate pyrophosphokinase 4 | 0.00e+00 | 1.28e-17 | 1.55e-13 | NA |
| 4. PB | P87171 | Ribose-phosphate pyrophosphokinase 5 | 0.00e+00 | 2.44e-28 | 1.82e-48 | NA |
| 4. PB | P60891 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.86e-32 | 2.04e-71 | NA |
| 4. PB | Q58761 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 4.31e-22 | 3.39e-25 | NA |
| 4. PB | P0A717 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.36e-48 | 4.09e-77 | NA |
| 4. PB | O60256 | Phosphoribosyl pyrophosphate synthase-associated protein 2 | 0.00e+00 | 1.17e-22 | 9.30e-36 | NA |
| 4. PB | Q54PA9 | Ribose-phosphate pyrophosphokinase A | 0.00e+00 | 2.33e-43 | 2.11e-64 | NA |
| 4. PB | P38063 | Ribose-phosphate pyrophosphokinase 4 | 0.00e+00 | 2.99e-26 | 7.08e-60 | NA |
| 4. PB | P9WKE3 | Ribose-phosphate pyrophosphokinase | 0.00e+00 | 1.41e-43 | 2.92e-78 | NA |
| 4. PB | P38689 | Ribose-phosphate pyrophosphokinase 3 | 0.00e+00 | 1.77e-31 | 9.46e-56 | NA |
| 4. PB | O08618 | Phosphoribosyl pyrophosphate synthase-associated protein 2 | 0.00e+00 | 8.80e-24 | 5.62e-35 | NA |
| 4. PB | Q54QU9 | Ribose-phosphate pyrophosphokinase C | 0.00e+00 | 2.85e-33 | 8.44e-50 | NA |
| 4. PB | P41831 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 4.10e-16 | 5.46e-36 | NA |
| 4. PB | P11908 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 2.91e-30 | 8.04e-72 | NA |
| 4. PB | Q680A5 | Ribose-phosphate pyrophosphokinase 4 | 0.00e+00 | 1.59e-12 | 1.24e-16 | NA |
| 4. PB | P60892 | Ribose-phosphate pyrophosphokinase 1 | 0.00e+00 | 1.86e-32 | 2.04e-71 | NA |
| 4. PB | Q14558 | Phosphoribosyl pyrophosphate synthase-associated protein 1 | 0.00e+00 | 2.08e-27 | 2.37e-33 | NA |
| 4. PB | O64888 | Ribose-phosphate pyrophosphokinase 5, chloroplastic | 0.00e+00 | 5.41e-03 | 3.94e-81 | NA |
| 4. PB | P38620 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 1.89e-32 | 1.21e-60 | NA |
| 4. PB | P09330 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 6.38e-30 | 1.03e-71 | NA |
| 4. PB | Q9D0M1 | Phosphoribosyl pyrophosphate synthase-associated protein 1 | 0.00e+00 | 1.55e-26 | 4.44e-33 | NA |
| 4. PB | Q9CS42 | Ribose-phosphate pyrophosphokinase 2 | 0.00e+00 | 1.92e-29 | 8.86e-72 | NA |
| 5. P | P37551 | Pur operon repressor | 8.93e-03 | 1.89e-06 | NA | NA |
| 5. P | P65832 | Pur operon repressor | 1.02e-02 | 1.01e-03 | NA | NA |
| 5. P | P65833 | Pur operon repressor | 1.02e-02 | 1.01e-03 | NA | NA |
| 6. F | A3MX27 | Orotate phosphoribosyltransferase | 2.22e-03 | NA | NA | 0.4449 |
| 6. F | Q04LJ2 | Orotate phosphoribosyltransferase | 3.90e-03 | NA | NA | 0.4526 |
| 6. F | P0CB78 | Orotate phosphoribosyltransferase | 1.22e-03 | NA | NA | 0.4506 |
| 6. F | Q3IC38 | Uracil phosphoribosyltransferase | 1.20e-04 | NA | NA | 0.4329 |
| 6. F | P65917 | Orotate phosphoribosyltransferase | 9.31e-04 | NA | NA | 0.4541 |
| 6. F | A4T0F4 | Orotate phosphoribosyltransferase | 6.04e-03 | NA | NA | 0.3963 |
| 6. F | A6URC7 | Hypoxanthine/guanine phosphoribosyltransferase | 3.72e-05 | NA | NA | 0.454 |
| 6. F | C1D6F5 | Orotate phosphoribosyltransferase | 3.30e-03 | NA | NA | 0.4436 |
| 6. F | B5E302 | Orotate phosphoribosyltransferase | 1.28e-03 | NA | NA | 0.414 |
| 6. F | D7DQT8 | Hypoxanthine/guanine phosphoribosyltransferase | 3.65e-05 | NA | NA | 0.5445 |
| 6. F | A4G043 | Hypoxanthine/guanine phosphoribosyltransferase | 4.60e-05 | NA | NA | 0.4556 |
| 6. F | A7X350 | Adenine phosphoribosyltransferase | 1.86e-03 | NA | NA | 0.4442 |
| 6. F | A9A8E9 | Hypoxanthine/guanine phosphoribosyltransferase | 3.67e-05 | NA | NA | 0.4445 |
| 6. F | Q1JM64 | Orotate phosphoribosyltransferase | 9.14e-04 | NA | NA | 0.4478 |
| 6. F | Q5M4H9 | Orotate phosphoribosyltransferase | 3.29e-03 | NA | NA | 0.4861 |
| 6. F | F0T7W2 | Hypoxanthine/guanine phosphoribosyltransferase | 2.42e-03 | NA | NA | 0.5346 |
| 6. F | P65915 | Orotate phosphoribosyltransferase | 5.24e-03 | NA | NA | 0.4501 |
| 6. F | A1WZE3 | Orotate phosphoribosyltransferase | 3.25e-04 | NA | NA | 0.4156 |
| 6. F | Q3J6V6 | Orotate phosphoribosyltransferase | 5.73e-04 | NA | NA | 0.3957 |
| 6. F | Q8Q0J4 | Orotate phosphoribosyltransferase | 3.17e-03 | NA | NA | 0.5565 |
| 6. F | P58859 | Orotate phosphoribosyltransferase | 2.60e-03 | NA | NA | 0.527 |
| 6. F | Q1JC80 | Orotate phosphoribosyltransferase | 9.03e-04 | NA | NA | 0.4478 |
| 6. F | B4RNV9 | Orotate phosphoribosyltransferase | 5.19e-03 | NA | NA | 0.4555 |
| 6. F | P68779 | Adenine phosphoribosyltransferase | 1.82e-03 | NA | NA | 0.4443 |
| 6. F | D5VT38 | Hypoxanthine/guanine phosphoribosyltransferase | 1.70e-03 | NA | NA | 0.47 |
| 6. F | Q8DQL5 | Orotate phosphoribosyltransferase | 3.90e-03 | NA | NA | 0.4526 |
| 6. F | C3L744 | Orotate phosphoribosyltransferase | 9.78e-04 | NA | NA | 0.4837 |
| 6. F | Q5HPY6 | Orotate phosphoribosyltransferase | 2.52e-04 | NA | NA | 0.4756 |
| 6. F | E3GW42 | Hypoxanthine/guanine phosphoribosyltransferase | 4.53e-05 | NA | NA | 0.5743 |
| 6. F | Q65ZZ7 | Adenine phosphoribosyltransferase | 2.62e-02 | NA | NA | 0.4184 |
| 6. F | P77889 | Orotate phosphoribosyltransferase | 1.29e-03 | NA | NA | 0.4375 |
| 6. F | A9M1F6 | Orotate phosphoribosyltransferase | 6.09e-03 | NA | NA | 0.439 |
| 6. F | P99144 | Orotate phosphoribosyltransferase | 2.44e-04 | NA | NA | 0.4584 |
| 6. F | Q6M0X3 | Hypoxanthine/guanine phosphoribosyltransferase | 3.44e-05 | NA | NA | 0.4461 |
| 6. F | Q8DTV2 | Orotate phosphoribosyltransferase | 8.62e-04 | NA | NA | 0.4472 |
| 6. F | A6VID5 | Hypoxanthine/guanine phosphoribosyltransferase | 3.74e-05 | NA | NA | 0.4448 |
| 6. F | Q74EM9 | Uracil phosphoribosyltransferase | 6.72e-05 | NA | NA | 0.519 |
| 6. F | Q9CGM8 | Orotate phosphoribosyltransferase | 9.48e-04 | NA | NA | 0.4615 |
| 6. F | P65914 | Orotate phosphoribosyltransferase | 5.11e-03 | NA | NA | 0.4552 |
| 6. F | P0DD69 | Orotate phosphoribosyltransferase | 9.04e-04 | NA | NA | 0.4458 |
| 6. F | Q3K146 | Orotate phosphoribosyltransferase | 1.18e-03 | NA | NA | 0.4188 |
| 6. F | C6DZH8 | Uracil phosphoribosyltransferase | 3.23e-04 | NA | NA | 0.5327 |
| 6. F | Q9A076 | Orotate phosphoribosyltransferase | 9.04e-04 | NA | NA | 0.4931 |
| 6. F | A1KS25 | Orotate phosphoribosyltransferase | 5.16e-03 | NA | NA | 0.4224 |
| 6. F | B5EBM3 | Uracil phosphoribosyltransferase | 6.98e-05 | NA | NA | 0.4392 |
| 6. F | Q7MAD7 | Orotate phosphoribosyltransferase | 1.05e-02 | NA | NA | 0.5136 |
| 6. F | Q03KS5 | Orotate phosphoribosyltransferase | 9.04e-04 | NA | NA | 0.4862 |
| 6. F | O58855 | Orotate phosphoribosyltransferase | 1.07e-03 | NA | NA | 0.5315 |
| 6. F | Q5FAK5 | Orotate phosphoribosyltransferase | 6.09e-03 | NA | NA | 0.4388 |
| 6. F | A2RLC0 | Orotate phosphoribosyltransferase | 9.65e-04 | NA | NA | 0.4287 |
| 6. F | Q5LZW8 | Orotate phosphoribosyltransferase | 9.03e-04 | NA | NA | 0.4989 |
| 6. F | P65918 | Orotate phosphoribosyltransferase | 8.94e-04 | NA | NA | 0.4545 |
| 6. F | Q3SM42 | Orotate phosphoribosyltransferase | 2.30e-03 | NA | NA | 0.4507 |
| 6. F | A1T894 | Adenine phosphoribosyltransferase | 1.77e-02 | NA | NA | 0.4393 |
| 6. F | P65920 | Orotate phosphoribosyltransferase | 8.92e-04 | NA | NA | 0.4443 |
| 7. B | Q8S2E5 | Ribose-phosphate pyrophosphokinase 3, chloroplastic | 0.00e+00 | NA | 6.21e-15 | NA |
| 7. B | B3DPH5 | Uracil phosphoribosyltransferase | 1.16e-04 | NA | 2.23e-04 | NA |
| 7. B | A0ZZM2 | Uracil phosphoribosyltransferase | 1.50e-04 | NA | 6.07e-04 | NA |
| 7. B | C5BXA3 | Uracil phosphoribosyltransferase | 2.09e-03 | NA | 0.017 | NA |
| 7. B | Q8ER35 | Orotate phosphoribosyltransferase | 4.26e-04 | NA | 0.014 | NA |
| 7. B | Q42583 | Ribose-phosphate pyrophosphokinase 2, chloroplastic | 0.00e+00 | NA | 1.87e-86 | NA |
| 7. B | B7GNR5 | Uracil phosphoribosyltransferase | 1.38e-04 | NA | 2.09e-04 | NA |
| 7. B | B8DVI9 | Uracil phosphoribosyltransferase | 1.29e-04 | NA | 5.38e-04 | NA |
| 7. B | Q93Z66 | Ribose-phosphate pyrophosphokinase 3, chloroplastic | 0.00e+00 | NA | 4.33e-16 | NA |
| 7. B | Q03EK5 | Uracil phosphoribosyltransferase | 3.17e-04 | NA | 0.021 | NA |
| 7. B | Q42581 | Ribose-phosphate pyrophosphokinase 1, chloroplastic | 0.00e+00 | NA | 5.82e-87 | NA |
| 7. B | Q69XQ6 | Ribose-phosphate pyrophosphokinase 2, chloroplastic | 0.00e+00 | NA | 7.46e-88 | NA |