Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54993.1
JCVISYN3A_0833
50S ribosomal protein L9.
M. mycoides homolog: Q6MS27.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.
Statistics
Total GO Annotation: 8
Unique PROST Go: 0
Unique BLAST Go: 1
Unique Foldseek Go: 0
Total Homologs: 802
Unique PROST Homologs: 0
Unique BLAST Homologs: 1
Unique Foldseek Homologs: 2
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
A2CDR6
(50S ribosomal protein L9) with a FATCAT P-Value: 0 and RMSD of 2.24 angstrom. The sequence alignment identity is 32.9%.
Structural alignment shown in left. Query protein AVX54993.1 colored as red in alignment, homolog A2CDR6 colored as blue.
Query protein AVX54993.1 is also shown in right top, homolog A2CDR6 showed in right bottom. They are colored based on secondary structures.
AVX54993.1 M--KV-IFL-KDVPNQGKKNEIKEVSDGYARNYLLP-NQLVKIATNNSIQTLKD--HLKADQEEKELA-K--A---QTKQIKKTLEELTLHFKLQTN-DD 86 A2CDR6 MAKRVQVVLNEDVLSLGKDGDLVEVAPGYARNFLLPFGKAVPV-T-PAV--MKQVGHRRAKQAEHQAAIKQEALDFQTALV--TIGRFTV--KKQTGEDD 92 AVX54993.1 KVFGSISSQDIVNQLKDVHRIEIDKKKFIHFKNINKIGINY-VKVKLDFGIEAIIKIDVKEV-- 147 A2CDR6 VLFGTVTNGDVAEAIETATKKEIDRRNII-VPEIHRTG-SYKVQVKLHNEVNAEINLEV--VSY 152
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006412 | translation |
| 1. PBF | GO:0003735 | structural constituent of ribosome |
| 1. PBF | GO:0022625 | cytosolic large ribosomal subunit |
| 1. PBF | GO:0005829 | cytosol |
| 1. PBF | GO:0005840 | ribosome |
| 1. PBF | GO:0019843 | rRNA binding |
| 4. PB | GO:0005886 | plasma membrane |
| 7. B | GO:0000311 | plastid large ribosomal subunit |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0006412 | translation |
| GO:0003723 | RNA binding |
| GO:1990904 | ribonucleoprotein complex |
| GO:0003735 | structural constituent of ribosome |
| GO:0005840 | ribosome |
| GO:0019843 | rRNA binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | A5EXM9 | 50S ribosomal protein L9 | 2.08e-11 | 3.10e-35 | 2.30e-06 | 0.5819 |
| 1. PBF | Q9K5Q8 | 50S ribosomal protein L9 | 0.00e+00 | 3.39e-40 | 7.60e-16 | 0.9261 |
| 1. PBF | Q6ABX0 | 50S ribosomal protein L9 | 0.00e+00 | 1.09e-36 | 1.74e-11 | 0.8437 |
| 1. PBF | Q3J1L9 | 50S ribosomal protein L9 | 2.36e-10 | 1.26e-03 | 8.95e-06 | 0.5406 |
| 1. PBF | A0KG69 | 50S ribosomal protein L9 | 1.72e-13 | 1.48e-31 | 0.002 | 0.5696 |
| 1. PBF | Q3JYG5 | 50S ribosomal protein L9 | 0.00e+00 | 2.25e-37 | 2.31e-14 | 0.9043 |
| 1. PBF | Q2NW52 | 50S ribosomal protein L9 | 1.89e-13 | 3.72e-34 | 6.66e-04 | 0.5799 |
| 1. PBF | Q3KKN8 | 50S ribosomal protein L9 | 1.47e-12 | 1.40e-20 | 3.91e-07 | 0.6394 |
| 1. PBF | C0QQX0 | 50S ribosomal protein L9 | 1.11e-16 | 6.14e-37 | 2.46e-17 | 0.813 |
| 1. PBF | Q9ZEA4 | 50S ribosomal protein L9 | 0.00e+00 | 7.62e-14 | 2.47e-12 | 0.841 |
| 1. PBF | A9M8X5 | 50S ribosomal protein L9 | 1.25e-09 | 2.09e-04 | 0.043 | 0.5623 |
| 1. PBF | A7HLG3 | 50S ribosomal protein L9 | 0.00e+00 | 3.71e-38 | 1.11e-15 | 0.844 |
| 1. PBF | Q8DCL3 | 50S ribosomal protein L9 | 6.88e-13 | 4.38e-33 | 1.28e-07 | 0.5712 |
| 1. PBF | B7LCR4 | 50S ribosomal protein L9 | 1.35e-13 | 2.19e-29 | 7.01e-06 | 0.5377 |
| 1. PBF | Q4UN66 | 50S ribosomal protein L9 | 8.88e-16 | 1.60e-13 | 1.58e-10 | 0.8078 |
| 1. PBF | A8F0E7 | 50S ribosomal protein L9 | 1.11e-16 | 1.64e-13 | 1.47e-11 | 0.8374 |
| 1. PBF | A2CDR6 | 50S ribosomal protein L9 | 0.00e+00 | 4.04e-27 | 1.23e-08 | 0.8199 |
| 1. PBF | Q0SX83 | 50S ribosomal protein L9 | 1.30e-13 | 2.19e-29 | 7.01e-06 | 0.5385 |
| 1. PBF | A5VHG3 | 50S ribosomal protein L9 | 0.00e+00 | 6.50e-38 | 6.47e-22 | 0.8995 |
| 1. PBF | Q2A3H5 | 50S ribosomal protein L9 | 1.77e-13 | 2.81e-32 | 0.016 | 0.6766 |
| 1. PBF | Q9Z6V3 | 50S ribosomal protein L9 | 3.18e-11 | 2.51e-20 | 1.05e-06 | 0.6089 |
| 1. PBF | A5N434 | 50S ribosomal protein L9 | 0.00e+00 | 1.23e-36 | 1.86e-18 | 0.8303 |
| 1. PBF | C5CUP3 | 50S ribosomal protein L9 | 3.38e-13 | 1.62e-30 | 4.53e-06 | 0.5701 |
| 1. PBF | A4QI23 | 50S ribosomal protein L9 | 7.77e-16 | 1.02e-32 | 4.71e-14 | 0.8116 |
| 1. PBF | Q7MYU9 | 50S ribosomal protein L9 | 3.46e-13 | 7.83e-32 | 4.54e-05 | 0.5963 |
| 1. PBF | B3E6H6 | 50S ribosomal protein L9 | 0.00e+00 | 6.62e-36 | 2.25e-13 | 0.9299 |
| 1. PBF | B2RIG5 | 50S ribosomal protein L9 | 0.00e+00 | 1.37e-06 | 3.70e-10 | 0.8573 |
| 1. PBF | A1B0F6 | 50S ribosomal protein L9 | 2.58e-09 | 1.27e-03 | 1.68e-08 | 0.6735 |
| 1. PBF | Q07LD6 | 50S ribosomal protein L9 | 4.26e-10 | 2.95e-02 | 5.35e-09 | 0.549 |
| 1. PBF | A6TXB7 | 50S ribosomal protein L9 | 0.00e+00 | 4.63e-42 | 2.03e-25 | 0.9458 |
| 1. PBF | Q17XG2 | 50S ribosomal protein L9 | 0.00e+00 | 1.31e-39 | 8.22e-24 | 0.8876 |
| 1. PBF | A0RLP8 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-35 | 1.36e-22 | 0.9192 |
| 1. PBF | B7L2N9 | 50S ribosomal protein L9 | 9.94e-10 | 2.44e-04 | 1.13e-05 | 0.4678 |
| 1. PBF | O68128 | 50S ribosomal protein L9 | 8.18e-12 | 1.20e-04 | 6.36e-06 | 0.5407 |
| 1. PBF | Q7MH91 | 50S ribosomal protein L9 | 6.70e-13 | 4.38e-33 | 1.28e-07 | 0.5712 |
| 1. PBF | Q1LLX1 | 50S ribosomal protein L9 | 2.55e-15 | 1.30e-33 | 8.25e-07 | 0.7116 |
| 1. PBF | Q8XZT5 | 50S ribosomal protein L9 | 1.02e-14 | 2.45e-33 | 2.92e-09 | 0.6035 |
| 1. PBF | A8H8K9 | 50S ribosomal protein L9 | 7.46e-13 | 2.96e-31 | 8.87e-05 | 0.5723 |
| 1. PBF | B2HIC0 | 50S ribosomal protein L9 | 1.71e-10 | 1.87e-35 | 2.46e-12 | 0.63 |
| 1. PBF | B1LCG8 | 50S ribosomal protein L9 | 5.55e-16 | 3.72e-37 | 1.79e-18 | 0.8089 |
| 1. PBF | C0QZ40 | 50S ribosomal protein L9 | 6.33e-15 | 1.37e-19 | 6.99e-13 | 0.605 |
| 1. PBF | A5IIS0 | 50S ribosomal protein L9 | 8.88e-16 | 5.82e-37 | 3.49e-18 | 0.7988 |
| 1. PBF | P0DE61 | 50S ribosomal protein L9 | 0.00e+00 | 2.50e-36 | 5.04e-18 | 0.8908 |
| 1. PBF | B4S3C6 | 50S ribosomal protein L9 | 0.00e+00 | 1.78e-37 | 1.88e-16 | 0.8855 |
| 1. PBF | Q2YUQ6 | 50S ribosomal protein L9 | 0.00e+00 | 9.31e-35 | 7.86e-13 | 0.9027 |
| 1. PBF | B0UL32 | 50S ribosomal protein L9 | 2.66e-10 | 1.28e-04 | 3.86e-04 | 0.5467 |
| 1. PBF | A2RM59 | 50S ribosomal protein L9 | 0.00e+00 | 7.21e-37 | 1.34e-19 | 0.8977 |
| 1. PBF | Q2JMI4 | 50S ribosomal protein L9 | 1.11e-16 | 4.62e-30 | 6.77e-14 | 0.8464 |
| 1. PBF | Q630D3 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-35 | 1.36e-22 | 0.9161 |
| 1. PBF | B7VI67 | 50S ribosomal protein L9 | 3.91e-13 | 1.09e-34 | 4.38e-08 | 0.5937 |
| 1. PBF | C1CHK3 | 50S ribosomal protein L9 | 0.00e+00 | 2.09e-40 | 1.93e-15 | 0.8194 |
| 1. PBF | Q1JED8 | 50S ribosomal protein L9 | 0.00e+00 | 2.94e-36 | 4.93e-18 | 0.8898 |
| 1. PBF | A8AMJ4 | 50S ribosomal protein L9 | 2.80e-13 | 9.42e-31 | 1.46e-05 | 0.5804 |
| 1. PBF | B7NTQ8 | 50S ribosomal protein L9 | 1.60e-13 | 2.19e-29 | 7.01e-06 | 0.5374 |
| 1. PBF | Q7NHA5 | 50S ribosomal protein L9 | 9.88e-15 | 3.17e-31 | 2.10e-12 | 0.7382 |
| 1. PBF | C4Z4Q1 | 50S ribosomal protein L9 | 0.00e+00 | 1.67e-38 | 5.75e-12 | 0.9044 |
| 1. PBF | Q2KZ23 | 50S ribosomal protein L9 | 1.07e-12 | 7.05e-35 | 1.53e-08 | 0.5797 |
| 1. PBF | Q5L567 | 50S ribosomal protein L9 | 3.60e-14 | 3.24e-15 | 4.93e-09 | 0.6419 |
| 1. PBF | Q7VQN7 | 50S ribosomal protein L9 | 0.00e+00 | 7.47e-24 | 9.40e-05 | 0.862 |
| 1. PBF | P37437 | 50S ribosomal protein L9 | 0.00e+00 | 2.17e-42 | 4.23e-22 | 0.9078 |
| 1. PBF | Q4A166 | 50S ribosomal protein L9 | 0.00e+00 | 1.22e-37 | 5.07e-18 | 0.9084 |
| 1. PBF | Q0VMG2 | 50S ribosomal protein L9 | 3.47e-09 | 9.89e-32 | 5.08e-07 | 0.5754 |
| 1. PBF | Q46398 | 50S ribosomal protein L9 | 2.75e-12 | 2.44e-20 | 8.24e-09 | 0.6274 |
| 1. PBF | B1LR79 | 50S ribosomal protein L9 | 1.63e-13 | 2.19e-29 | 7.01e-06 | 0.5372 |
| 1. PBF | Q65CQ3 | 50S ribosomal protein L9 | 0.00e+00 | 6.45e-41 | 2.03e-20 | 0.9134 |
| 1. PBF | B4RAE8 | 50S ribosomal protein L9 | 1.41e-09 | 2.57e-02 | 1.12e-05 | 0.4665 |
| 1. PBF | Q1GC33 | 50S ribosomal protein L9 | 0.00e+00 | 2.53e-39 | 5.91e-21 | 0.8831 |
| 1. PBF | Q7NRZ0 | 50S ribosomal protein L9 | 6.60e-11 | 4.99e-36 | 3.91e-06 | 0.5372 |
| 1. PBF | A5CVA8 | 50S ribosomal protein L9 | 0.00e+00 | 1.32e-34 | 3.33e-07 | 0.859 |
| 1. PBF | A5INQ6 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.9016 |
| 1. PBF | A0Q6H2 | 50S ribosomal protein L9 | 1.11e-16 | 9.72e-32 | 0.005 | 0.8026 |
| 1. PBF | Q83IC2 | 50S ribosomal protein L9 | 3.22e-15 | 3.68e-32 | 3.45e-09 | 0.7893 |
| 1. PBF | A6H0P1 | 50S ribosomal protein L9 | 0.00e+00 | 4.98e-32 | 9.07e-12 | 0.8803 |
| 1. PBF | Q57GI8 | 50S ribosomal protein L9 | 2.58e-13 | 5.43e-30 | 8.35e-06 | 0.5814 |
| 1. PBF | Q7V9J9 | 50S ribosomal protein L9 | 0.00e+00 | 1.66e-27 | 2.14e-08 | 0.8377 |
| 1. PBF | Q3BV19 | 50S ribosomal protein L9 | 4.18e-11 | 3.50e-30 | 1.76e-05 | 0.5876 |
| 1. PBF | B5F3C0 | 50S ribosomal protein L9 | 2.58e-13 | 5.43e-30 | 8.35e-06 | 0.5804 |
| 1. PBF | Q2P330 | 50S ribosomal protein L9 | 4.35e-13 | 3.44e-30 | 4.01e-05 | 0.5753 |
| 1. PBF | B5Z2K8 | 50S ribosomal protein L9 | 1.42e-13 | 2.19e-29 | 7.01e-06 | 0.5198 |
| 1. PBF | Q15PE2 | 50S ribosomal protein L9 | 8.48e-13 | 5.43e-35 | 0.003 | 0.5874 |
| 1. PBF | A0PKH8 | 50S ribosomal protein L9 | 1.88e-10 | 1.25e-34 | 2.28e-12 | 0.6277 |
| 1. PBF | Q2RM68 | 50S ribosomal protein L9 | 1.11e-16 | 8.67e-38 | 4.39e-15 | 0.8185 |
| 1. PBF | B9L5M5 | 50S ribosomal protein L9 | 0.00e+00 | 1.07e-36 | 4.34e-21 | 0.9012 |
| 1. PBF | A0LAG5 | 50S ribosomal protein L9 | 4.05e-11 | 1.90e-35 | 3.39e-08 | 0.6046 |
| 1. PBF | A9BDB8 | 50S ribosomal protein L9 | 0.00e+00 | 2.38e-27 | 9.68e-10 | 0.7985 |
| 1. PBF | Q9CHI6 | 50S ribosomal protein L9 | 0.00e+00 | 4.11e-36 | 3.65e-16 | 0.8976 |
| 1. PBF | Q3KIX5 | 50S ribosomal protein L9 | 2.22e-11 | 8.02e-30 | 7.81e-04 | 0.5964 |
| 1. PBF | Q89A42 | 50S ribosomal protein L9 | 2.78e-15 | 2.65e-27 | 5.87e-08 | 0.723 |
| 1. PBF | Q0SP52 | 50S ribosomal protein L9 | 0.00e+00 | 6.84e-11 | 1.52e-11 | 0.8918 |
| 1. PBF | B2S208 | 50S ribosomal protein L9 | 3.70e-11 | 1.05e-27 | 1.54e-08 | 0.6197 |
| 1. PBF | Q6B909 | 50S ribosomal protein L9, chloroplastic | 0.00e+00 | 1.87e-28 | 1.21e-07 | 0.8692 |
| 1. PBF | Q6NEI5 | 50S ribosomal protein L9 | 3.55e-15 | 6.93e-33 | 5.84e-13 | 0.7892 |
| 1. PBF | Q4A943 | 50S ribosomal protein L9 | 0.00e+00 | 1.57e-34 | 1.17e-09 | 0.8954 |
| 1. PBF | A7ZAQ7 | 50S ribosomal protein L9 | 0.00e+00 | 2.17e-41 | 2.43e-21 | 0.8926 |
| 1. PBF | B6IN81 | 50S ribosomal protein L9 | 1.54e-11 | 7.58e-03 | 1.44e-07 | 0.5534 |
| 1. PBF | B1H014 | 50S ribosomal protein L9 | 0.00e+00 | 9.25e-37 | 1.19e-13 | 0.9043 |
| 1. PBF | P51334 | 50S ribosomal protein L9, chloroplastic | 1.11e-16 | 1.46e-25 | 3.75e-11 | 0.811 |
| 1. PBF | P0A7R4 | 50S ribosomal protein L9 | 1.41e-13 | 2.19e-29 | 7.01e-06 | 0.5204 |
| 1. PBF | B8E9N9 | 50S ribosomal protein L9 | 9.24e-13 | 4.34e-31 | 0.047 | 0.5543 |
| 1. PBF | B3EEB5 | 50S ribosomal protein L9 | 0.00e+00 | 1.87e-35 | 4.50e-12 | 0.87 |
| 1. PBF | B5YIM4 | 50S ribosomal protein L9 | 0.00e+00 | 2.53e-39 | 2.05e-15 | 0.9417 |
| 1. PBF | B0K8F8 | 50S ribosomal protein L9 | 0.00e+00 | 3.79e-40 | 7.62e-25 | 0.8992 |
| 1. PBF | C4LGF9 | 50S ribosomal protein L9 | 2.44e-15 | 4.41e-36 | 1.06e-09 | 0.7963 |
| 1. PBF | B0V7G5 | 50S ribosomal protein L9 | 3.45e-11 | 2.25e-33 | 1.30e-06 | 0.6007 |
| 1. PBF | A4FR29 | 50S ribosomal protein L9 | 5.55e-16 | 3.83e-36 | 7.40e-15 | 0.7575 |
| 1. PBF | Q87L75 | 50S ribosomal protein L9 | 6.01e-13 | 1.74e-33 | 2.14e-07 | 0.5916 |
| 1. PBF | B2GEV8 | 50S ribosomal protein L9 | 0.00e+00 | 4.40e-39 | 3.58e-17 | 0.8893 |
| 1. PBF | A1K3D3 | 50S ribosomal protein L9 | 4.91e-11 | 3.05e-35 | 6.95e-08 | 0.567 |
| 1. PBF | B8D883 | 50S ribosomal protein L9 | 1.11e-16 | 1.01e-30 | 5.86e-06 | 0.8274 |
| 1. PBF | Q3AGL2 | 50S ribosomal protein L9 | 0.00e+00 | 1.05e-27 | 2.75e-08 | 0.8517 |
| 1. PBF | P66317 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.8996 |
| 1. PBF | B2SIV2 | 50S ribosomal protein L9 | 4.40e-13 | 3.44e-30 | 4.01e-05 | 0.5735 |
| 1. PBF | Q3AUG8 | 50S ribosomal protein L9 | 0.00e+00 | 1.32e-28 | 9.84e-08 | 0.8344 |
| 1. PBF | A4XJI0 | 50S ribosomal protein L9 | 0.00e+00 | 1.46e-37 | 2.33e-14 | 0.8935 |
| 1. PBF | Q1QBZ2 | 50S ribosomal protein L9 | 9.32e-11 | 1.41e-11 | 7.69e-06 | 0.593 |
| 1. PBF | A5IY26 | 50S ribosomal protein L9 | 0.00e+00 | 2.61e-35 | 0.002 | 0.8348 |
| 1. PBF | A6LMW8 | 50S ribosomal protein L9 | 0.00e+00 | 1.05e-39 | 6.88e-20 | 0.8748 |
| 1. PBF | B8I4B5 | 50S ribosomal protein L9 | 0.00e+00 | 7.94e-40 | 4.04e-25 | 0.887 |
| 1. PBF | Q87A85 | 50S ribosomal protein L9 | 5.77e-13 | 1.59e-32 | 2.90e-08 | 0.5905 |
| 1. PBF | A1SQS1 | 50S ribosomal protein L9 | 4.15e-13 | 3.63e-35 | 3.46e-15 | 0.6585 |
| 1. PBF | B0BAQ9 | 50S ribosomal protein L9 | 1.13e-12 | 1.40e-20 | 3.91e-07 | 0.6437 |
| 1. PBF | Q6G063 | 50S ribosomal protein L9 | 2.39e-10 | 2.54e-02 | 1.29e-04 | 0.5549 |
| 1. PBF | B8H838 | 50S ribosomal protein L9 | 3.33e-16 | 4.65e-34 | 3.56e-10 | 0.8182 |
| 1. PBF | P75540 | 50S ribosomal protein L9 | 0.00e+00 | 7.83e-32 | 1.17e-16 | 0.8107 |
| 1. PBF | Q8KAM4 | 50S ribosomal protein L9 | 0.00e+00 | 3.47e-34 | 5.47e-14 | 0.8893 |
| 1. PBF | B1XN09 | 50S ribosomal protein L9 | 0.00e+00 | 1.18e-28 | 4.11e-13 | 0.842 |
| 1. PBF | B7MLK8 | 50S ribosomal protein L9 | 1.87e-13 | 2.19e-29 | 7.01e-06 | 0.5376 |
| 1. PBF | P0A7R2 | 50S ribosomal protein L9 | 1.44e-13 | 2.19e-29 | 7.01e-06 | 0.5381 |
| 1. PBF | Q6MS27 | 50S ribosomal protein L9 | 0.00e+00 | 6.05e-53 | 4.56e-100 | 0.994 |
| 1. PBF | A0AEN0 | 50S ribosomal protein L9 | 0.00e+00 | 1.39e-40 | 2.96e-18 | 0.9368 |
| 1. PBF | Q8K920 | 50S ribosomal protein L9 | 2.78e-15 | 1.09e-29 | 9.53e-07 | 0.6926 |
| 1. PBF | Q493V3 | 50S ribosomal protein L9 | 1.33e-15 | 7.41e-27 | 4.69e-08 | 0.7982 |
| 1. PBF | Q38ZR4 | 50S ribosomal protein L9 | 0.00e+00 | 3.92e-37 | 1.34e-20 | 0.9138 |
| 1. PBF | Q0I4E8 | 50S ribosomal protein L9 | 4.51e-13 | 2.15e-35 | 4.31e-05 | 0.5791 |
| 1. PBF | A4XQ00 | 50S ribosomal protein L9 | 1.88e-11 | 3.92e-34 | 2.00e-06 | 0.5989 |
| 1. PBF | Q328J6 | 50S ribosomal protein L9 | 2.22e-13 | 1.53e-29 | 6.80e-06 | 0.5797 |
| 1. PBF | A3NAB3 | 50S ribosomal protein L9 | 2.76e-11 | 2.02e-36 | 1.58e-07 | 0.5895 |
| 1. PBF | A5FRT0 | 50S ribosomal protein L9 | 0.00e+00 | 8.77e-37 | 3.98e-20 | 0.8596 |
| 1. PBF | Q8RI10 | 50S ribosomal protein L9 | 0.00e+00 | 1.88e-32 | 8.74e-19 | 0.8444 |
| 1. PBF | Q1MJ13 | 50S ribosomal protein L9 | 3.97e-10 | 8.79e-04 | 1.48e-04 | 0.5719 |
| 1. PBF | Q5H053 | 50S ribosomal protein L9 | 4.50e-13 | 3.44e-30 | 4.01e-05 | 0.5735 |
| 1. PBF | A7GYN5 | 50S ribosomal protein L9 | 0.00e+00 | 2.34e-41 | 1.96e-19 | 0.8832 |
| 1. PBF | A3Q8M9 | 50S ribosomal protein L9 | 1.19e-11 | 2.81e-33 | 5.43e-16 | 0.6547 |
| 1. PBF | C0R3A4 | 50S ribosomal protein L9 | 6.67e-14 | 3.75e-06 | 0.016 | 0.7494 |
| 1. PBF | Q3SH34 | 50S ribosomal protein L9 | 1.34e-12 | 2.99e-36 | 6.66e-08 | 0.5532 |
| 1. PBF | Q9PPT9 | 50S ribosomal protein L9 | 0.00e+00 | 1.27e-37 | 9.52e-15 | 0.8257 |
| 1. PBF | B5RLI6 | 50S ribosomal protein L9 | 5.66e-15 | 1.45e-16 | 5.59e-17 | 0.6139 |
| 1. PBF | Q8YFN7 | 50S ribosomal protein L9 | 1.87e-08 | 2.56e-04 | 0.040 | 0.5632 |
| 1. PBF | B0TUU6 | 50S ribosomal protein L9 | 7.69e-13 | 2.43e-31 | 1.30e-04 | 0.5715 |
| 1. PBF | B2V1T2 | 50S ribosomal protein L9 | 0.00e+00 | 5.55e-36 | 1.68e-16 | 0.8559 |
| 1. PBF | Q7VV92 | 50S ribosomal protein L9 | 2.56e-13 | 2.63e-33 | 1.40e-09 | 0.5973 |
| 1. PBF | A3PKL7 | 50S ribosomal protein L9 | 2.39e-10 | 1.26e-03 | 8.95e-06 | 0.5367 |
| 1. PBF | B4TT36 | 50S ribosomal protein L9 | 2.15e-13 | 5.43e-30 | 8.35e-06 | 0.5815 |
| 1. PBF | B2S1U6 | 50S ribosomal protein L9 | 5.22e-15 | 8.80e-17 | 1.56e-18 | 0.6145 |
| 1. PBF | A8G7H8 | 50S ribosomal protein L9 | 0.00e+00 | 1.14e-22 | 4.75e-07 | 0.8616 |
| 1. PBF | Q5NG01 | 50S ribosomal protein L9 | 1.11e-16 | 2.72e-32 | 0.004 | 0.7964 |
| 1. PBF | B5RQT9 | 50S ribosomal protein L9 | 7.33e-15 | 6.00e-16 | 2.05e-16 | 0.609 |
| 1. PBF | C5D9X1 | 50S ribosomal protein L9 | 0.00e+00 | 9.94e-37 | 4.71e-22 | 0.9105 |
| 1. PBF | Q04TH0 | 50S ribosomal protein L9 | 0.00e+00 | 1.33e-39 | 1.81e-12 | 0.8467 |
| 1. PBF | Q662Q0 | 50S ribosomal protein L9 | 4.77e-15 | 1.09e-16 | 1.88e-12 | 0.621 |
| 1. PBF | A9H1M3 | 50S ribosomal protein L9 | 8.78e-10 | 1.39e-03 | 0.005 | 0.5553 |
| 1. PBF | C5BN48 | 50S ribosomal protein L9 | 2.40e-12 | 1.88e-37 | 0.008 | 0.5673 |
| 1. PBF | B0SWK9 | 50S ribosomal protein L9 | 9.37e-12 | 8.86e-03 | 5.29e-06 | 0.4429 |
| 1. PBF | Q4LAK2 | 50S ribosomal protein L9 | 0.00e+00 | 4.98e-35 | 1.03e-17 | 0.9098 |
| 1. PBF | A8GLX8 | 50S ribosomal protein L9 | 4.11e-15 | 4.09e-15 | 8.40e-09 | 0.7841 |
| 1. PBF | B2FKJ7 | 50S ribosomal protein L9 | 1.60e-12 | 1.36e-35 | 3.87e-04 | 0.5768 |
| 1. PBF | B8FI54 | 50S ribosomal protein L9 | 1.89e-15 | 1.76e-38 | 2.64e-10 | 0.7043 |
| 1. PBF | Q72WV8 | 50S ribosomal protein L9 | 0.00e+00 | 8.69e-35 | 5.70e-22 | 0.9121 |
| 1. PBF | Q03UC7 | 50S ribosomal protein L9 | 0.00e+00 | 1.58e-36 | 1.74e-20 | 0.9304 |
| 1. PBF | B6EMP3 | 50S ribosomal protein L9 | 2.32e-11 | 8.80e-32 | 5.44e-07 | 0.6071 |
| 1. PBF | Q8FLQ0 | 50S ribosomal protein L9 | 2.22e-16 | 2.87e-34 | 2.15e-12 | 0.8395 |
| 1. PBF | P66316 | 50S ribosomal protein L9 | 1.30e-10 | 4.05e-34 | 1.21e-13 | 0.6723 |
| 1. PBF | B8ZTL4 | 50S ribosomal protein L9 | 1.82e-13 | 4.53e-33 | 1.65e-12 | 0.7168 |
| 1. PBF | A8ZRQ0 | 50S ribosomal protein L9 | 0.00e+00 | 1.20e-33 | 4.59e-08 | 0.8235 |
| 1. PBF | B4SP92 | 50S ribosomal protein L9 | 3.98e-11 | 1.53e-32 | 1.75e-04 | 0.5626 |
| 1. PBF | B2VCV8 | 50S ribosomal protein L9 | 2.38e-13 | 4.87e-31 | 2.57e-05 | 0.5824 |
| 1. PBF | A2SG02 | 50S ribosomal protein L9 | 9.66e-13 | 3.13e-34 | 1.59e-06 | 0.5648 |
| 1. PBF | A4WS83 | 50S ribosomal protein L9 | 1.05e-09 | 6.87e-04 | 2.63e-07 | 0.5397 |
| 1. PBF | Q3II82 | 50S ribosomal protein L9 | 3.12e-13 | 1.88e-32 | 9.69e-09 | 0.5367 |
| 1. PBF | A6WWE3 | 50S ribosomal protein L9 | 8.81e-10 | 1.44e-04 | 0.005 | 0.5612 |
| 1. PBF | C3LGS6 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-35 | 1.36e-22 | 0.919 |
| 1. PBF | Q5L9B7 | 50S ribosomal protein L9 | 0.00e+00 | 3.66e-34 | 4.81e-10 | 0.8698 |
| 1. PBF | Q5GSD4 | 50S ribosomal protein L9 | 1.82e-13 | 7.32e-05 | 5.27e-06 | 0.7565 |
| 1. PBF | Q725B1 | 50S ribosomal protein L9 | 0.00e+00 | 1.22e-40 | 1.21e-17 | 0.9392 |
| 1. PBF | Q5FU59 | 50S ribosomal protein L9 | 6.07e-11 | 1.40e-02 | 1.52e-05 | 0.5528 |
| 1. PBF | Q5F922 | 50S ribosomal protein L9 | 8.25e-11 | 1.21e-36 | 2.16e-05 | 0.5724 |
| 1. PBF | P46385 | 50S ribosomal protein L9 | 2.88e-13 | 4.53e-33 | 1.65e-12 | 0.7135 |
| 1. PBF | Q5YN14 | 50S ribosomal protein L9 | 1.11e-16 | 2.68e-32 | 8.06e-11 | 0.8491 |
| 1. PBF | B1XXH2 | 50S ribosomal protein L9 | 3.15e-13 | 1.02e-31 | 1.33e-09 | 0.5772 |
| 1. PBF | Q92QZ9 | 50S ribosomal protein L9 | 4.66e-10 | 3.82e-04 | 9.30e-06 | 0.5743 |
| 1. PBF | A8FJD2 | 50S ribosomal protein L9 | 0.00e+00 | 4.69e-38 | 3.47e-15 | 0.8967 |
| 1. PBF | B7V1Z5 | 50S ribosomal protein L9 | 3.74e-11 | 6.98e-36 | 1.70e-06 | 0.588 |
| 1. PBF | Q8PM12 | 50S ribosomal protein L9 | 4.35e-13 | 3.50e-30 | 1.76e-05 | 0.5755 |
| 1. PBF | B2TRG2 | 50S ribosomal protein L9 | 0.00e+00 | 5.55e-36 | 1.68e-16 | 0.8543 |
| 1. PBF | Q1QZ60 | 50S ribosomal protein L9 | 2.03e-11 | 4.38e-33 | 0.001 | 0.6061 |
| 1. PBF | Q1XDF2 | 50S ribosomal protein L9, chloroplastic | 0.00e+00 | 2.02e-26 | 1.74e-15 | 0.8831 |
| 1. PBF | Q07XT0 | 50S ribosomal protein L9 | 7.11e-13 | 7.32e-32 | 3.57e-04 | 0.5586 |
| 1. PBF | Q57ER5 | 50S ribosomal protein L9 | 1.11e-09 | 2.05e-04 | 0.042 | 0.5613 |
| 1. PBF | B9DPY3 | 50S ribosomal protein L9 | 0.00e+00 | 7.47e-39 | 2.20e-16 | 0.897 |
| 1. PBF | Q2LUJ5 | 50S ribosomal protein L9 | 0.00e+00 | 1.29e-35 | 2.20e-12 | 0.9099 |
| 1. PBF | A3MKD3 | 50S ribosomal protein L9 | 2.77e-11 | 2.29e-36 | 1.62e-07 | 0.5898 |
| 1. PBF | A5GWP0 | 50S ribosomal protein L9 | 0.00e+00 | 2.20e-28 | 4.38e-08 | 0.8398 |
| 1. PBF | B9IT27 | 50S ribosomal protein L9 | 0.00e+00 | 8.69e-35 | 5.70e-22 | 0.9069 |
| 1. PBF | Q7MWL1 | 50S ribosomal protein L9 | 1.22e-15 | 2.89e-06 | 6.16e-10 | 0.8204 |
| 1. PBF | Q7NAM4 | 50S ribosomal protein L9 | 0.00e+00 | 2.68e-34 | 1.48e-14 | 0.8399 |
| 1. PBF | B7LLY5 | 50S ribosomal protein L9 | 1.43e-13 | 2.19e-29 | 7.01e-06 | 0.5197 |
| 1. PBF | B1XTM8 | 50S ribosomal protein L9 | 4.88e-14 | 5.60e-32 | 3.13e-07 | 0.5819 |
| 1. PBF | Q839Y6 | 50S ribosomal protein L9 | 0.00e+00 | 2.95e-37 | 2.58e-13 | 0.9262 |
| 1. PBF | Q97CX9 | 50S ribosomal protein L9 | 0.00e+00 | 1.89e-38 | 1.29e-18 | 0.8445 |
| 1. PBF | B0CAV7 | 50S ribosomal protein L9 | 0.00e+00 | 1.33e-24 | 3.94e-11 | 0.8699 |
| 1. PBF | B8DRL4 | 50S ribosomal protein L9 | 0.00e+00 | 6.24e-13 | 2.59e-10 | 0.8666 |
| 1. PBF | Q1B0W7 | 50S ribosomal protein L9 | 1.35e-11 | 2.81e-33 | 5.43e-16 | 0.6452 |
| 1. PBF | B4EBH0 | 50S ribosomal protein L9 | 6.47e-13 | 6.24e-35 | 5.01e-08 | 0.5842 |
| 1. PBF | A9AJW4 | 50S ribosomal protein L9 | 3.63e-11 | 2.75e-35 | 3.79e-08 | 0.5846 |
| 1. PBF | B1VIZ6 | 50S ribosomal protein L9 | 2.22e-16 | 2.70e-35 | 9.05e-11 | 0.8107 |
| 1. PBF | C1CXJ9 | 50S ribosomal protein L9 | 0.00e+00 | 4.98e-35 | 3.57e-15 | 0.838 |
| 1. PBF | Q6D138 | 50S ribosomal protein L9 | 3.43e-13 | 1.50e-31 | 1.44e-05 | 0.5967 |
| 1. PBF | A1TLI4 | 50S ribosomal protein L9 | 1.36e-13 | 1.35e-30 | 4.23e-05 | 0.5583 |
| 1. PBF | A5IC87 | 50S ribosomal protein L9 | 7.57e-11 | 1.94e-35 | 4.71e-07 | 0.6213 |
| 1. PBF | Q2Y7M8 | 50S ribosomal protein L9 | 1.07e-13 | 2.50e-34 | 1.67e-06 | 0.6014 |
| 1. PBF | A9BNG0 | 50S ribosomal protein L9 | 5.54e-13 | 1.90e-33 | 1.31e-07 | 0.5669 |
| 1. PBF | B9KG98 | 50S ribosomal protein L9 | 0.00e+00 | 4.71e-43 | 4.51e-17 | 0.9063 |
| 1. PBF | Q0T9J0 | 50S ribosomal protein L9 | 1.74e-13 | 2.19e-29 | 7.01e-06 | 0.5365 |
| 1. PBF | B8D8C6 | 50S ribosomal protein L9 | 1.11e-16 | 1.01e-30 | 5.86e-06 | 0.8266 |
| 1. PBF | Q0C083 | 50S ribosomal protein L9 | 1.04e-11 | 1.08e-03 | 0.043 | 0.5626 |
| 1. PBF | A9B527 | 50S ribosomal protein L9 | 2.22e-16 | 1.22e-15 | 8.33e-19 | 0.8333 |
| 1. PBF | A9WVL2 | 50S ribosomal protein L9 | 0.00e+00 | 6.17e-36 | 1.02e-10 | 0.8006 |
| 1. PBF | A5FYN6 | 50S ribosomal protein L9 | 1.37e-11 | 4.68e-04 | 1.26e-07 | 0.5561 |
| 1. PBF | P66321 | 50S ribosomal protein L9 | 0.00e+00 | 2.09e-40 | 1.93e-15 | 0.8202 |
| 1. PBF | Q1J459 | 50S ribosomal protein L9 | 0.00e+00 | 2.50e-36 | 5.04e-18 | 0.8903 |
| 1. PBF | Q31FW7 | 50S ribosomal protein L9 | 3.76e-11 | 4.20e-31 | 6.09e-04 | 0.5909 |
| 1. PBF | Q8NZ04 | 50S ribosomal protein L9 | 0.00e+00 | 6.17e-36 | 7.49e-18 | 0.8782 |
| 1. PBF | Q47K97 | 50S ribosomal protein L9 | 9.99e-16 | 2.50e-32 | 1.74e-11 | 0.7787 |
| 1. PBF | A3M6Q6 | 50S ribosomal protein L9 | 3.36e-11 | 2.25e-33 | 1.30e-06 | 0.6006 |
| 1. PBF | Q5N1S9 | 50S ribosomal protein L9 | 0.00e+00 | 8.80e-32 | 1.66e-11 | 0.8939 |
| 1. PBF | Q984U0 | 50S ribosomal protein L9 | 3.51e-10 | 9.19e-03 | 9.54e-06 | 0.499 |
| 1. PBF | B7JIJ6 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-35 | 1.36e-22 | 0.9179 |
| 1. PBF | A9KKB3 | 50S ribosomal protein L9 | 0.00e+00 | 8.17e-37 | 5.19e-17 | 0.9362 |
| 1. PBF | P47339 | 50S ribosomal protein L9 | 0.00e+00 | 8.51e-32 | 4.32e-12 | 0.8617 |
| 1. PBF | Q1BH33 | 50S ribosomal protein L9 | 5.97e-13 | 6.24e-35 | 5.01e-08 | 0.5708 |
| 1. PBF | A4SVX9 | 50S ribosomal protein L9 | 1.55e-14 | 1.40e-33 | 1.21e-07 | 0.5986 |
| 1. PBF | Q3JRJ5 | 50S ribosomal protein L9 | 1.45e-13 | 2.29e-36 | 1.62e-07 | 0.5769 |
| 1. PBF | Q8NLG1 | 50S ribosomal protein L9 | 3.33e-16 | 1.59e-32 | 1.19e-13 | 0.8197 |
| 1. PBF | A0K7Z5 | 50S ribosomal protein L9 | 3.80e-11 | 6.24e-35 | 5.01e-08 | 0.5699 |
| 1. PBF | A3N1H1 | 50S ribosomal protein L9 | 2.61e-13 | 5.33e-35 | 0.003 | 0.569 |
| 1. PBF | B5E3V0 | 50S ribosomal protein L9 | 0.00e+00 | 2.09e-40 | 1.93e-15 | 0.8239 |
| 1. PBF | Q5SLQ1 | 50S ribosomal protein L9 | 0.00e+00 | 7.10e-36 | 2.48e-22 | 0.8897 |
| 1. PBF | A8G8W7 | 50S ribosomal protein L9 | 3.54e-13 | 4.14e-32 | 2.16e-04 | 0.5102 |
| 1. PBF | A5FE75 | 50S ribosomal protein L9 | 0.00e+00 | 8.64e-34 | 1.32e-12 | 0.9166 |
| 1. PBF | B5FBQ0 | 50S ribosomal protein L9 | 3.07e-11 | 7.83e-32 | 1.20e-07 | 0.6055 |
| 1. PBF | A7ZV74 | 50S ribosomal protein L9 | 1.58e-13 | 2.19e-29 | 7.01e-06 | 0.5379 |
| 1. PBF | A8FL82 | 50S ribosomal protein L9 | 0.00e+00 | 1.16e-43 | 1.18e-17 | 0.8996 |
| 1. PBF | B0K5L4 | 50S ribosomal protein L9 | 0.00e+00 | 3.79e-40 | 7.62e-25 | 0.8978 |
| 1. PBF | A3NW31 | 50S ribosomal protein L9 | 2.63e-11 | 2.29e-36 | 1.62e-07 | 0.5904 |
| 1. PBF | B1AJJ1 | 50S ribosomal protein L9 | 0.00e+00 | 1.27e-37 | 9.52e-15 | 0.8529 |
| 1. PBF | Q814H0 | 50S ribosomal protein L9 | 0.00e+00 | 7.10e-36 | 7.80e-22 | 0.9141 |
| 1. PBF | B7JUZ9 | 50S ribosomal protein L9 | 0.00e+00 | 2.49e-27 | 9.78e-10 | 0.8972 |
| 1. PBF | Q5M252 | 50S ribosomal protein L9 | 0.00e+00 | 1.23e-36 | 3.56e-17 | 0.8789 |
| 1. PBF | Q128U4 | 50S ribosomal protein L9 | 1.50e-13 | 1.06e-32 | 4.05e-06 | 0.5961 |
| 1. PBF | Q6LM44 | 50S ribosomal protein L9 | 6.40e-13 | 1.57e-33 | 9.05e-07 | 0.5854 |
| 1. PBF | B7IDU7 | 50S ribosomal protein L9 | 0.00e+00 | 8.04e-39 | 5.56e-17 | 0.8616 |
| 1. PBF | C3PM74 | 50S ribosomal protein L9 | 1.11e-16 | 7.50e-13 | 4.41e-11 | 0.8364 |
| 1. PBF | Q2YMH2 | 50S ribosomal protein L9 | 1.63e-11 | 2.05e-04 | 0.042 | 0.5589 |
| 1. PBF | A8GY14 | 50S ribosomal protein L9 | 0.00e+00 | 1.83e-12 | 1.05e-10 | 0.8758 |
| 1. PBF | A7NC56 | 50S ribosomal protein L9 | 1.11e-16 | 2.81e-32 | 0.016 | 0.7924 |
| 1. PBF | B4U0N8 | 50S ribosomal protein L9 | 0.00e+00 | 1.85e-37 | 1.23e-17 | 0.885 |
| 1. PBF | O07816 | 50S ribosomal protein L9 | 2.71e-12 | 4.04e-35 | 0.004 | 0.5737 |
| 1. PBF | A7H4F0 | 50S ribosomal protein L9 | 0.00e+00 | 1.87e-43 | 3.55e-18 | 0.9047 |
| 1. PBF | Q6MRP1 | 50S ribosomal protein L9 | 0.00e+00 | 4.87e-37 | 3.85e-12 | 0.8812 |
| 1. PBF | Q39RR5 | 50S ribosomal protein L9 | 0.00e+00 | 1.85e-36 | 1.19e-12 | 0.9288 |
| 1. PBF | A1AM21 | 50S ribosomal protein L9 | 0.00e+00 | 2.54e-32 | 8.56e-12 | 0.9217 |
| 1. PBF | B3PUT4 | 50S ribosomal protein L9 | 9.12e-10 | 2.00e-03 | 1.70e-04 | 0.5597 |
| 1. PBF | A8LXG0 | 50S ribosomal protein L9 | 1.11e-15 | 1.85e-36 | 3.85e-14 | 0.7683 |
| 1. PBF | C5C7U8 | 50S ribosomal protein L9 | 0.00e+00 | 1.71e-31 | 7.86e-07 | 0.8379 |
| 1. PBF | B0KKY0 | 50S ribosomal protein L9 | 3.20e-13 | 1.56e-32 | 8.15e-06 | 0.5951 |
| 1. PBF | Q7U3Q2 | 50S ribosomal protein L9 | 1.11e-16 | 6.65e-27 | 7.18e-11 | 0.8329 |
| 1. PBF | C6BVB0 | 50S ribosomal protein L9 | 0.00e+00 | 1.16e-06 | 6.04e-10 | 0.8678 |
| 1. PBF | Q48QN2 | 50S ribosomal protein L9 | 0.00e+00 | 2.94e-36 | 4.93e-18 | 0.8867 |
| 1. PBF | Q0TM14 | 50S ribosomal protein L9 | 0.00e+00 | 1.58e-36 | 1.51e-14 | 0.8668 |
| 1. PBF | A0R7F6 | 50S ribosomal protein L9 | 9.31e-14 | 7.05e-35 | 4.11e-16 | 0.7388 |
| 1. PBF | B1YG95 | 50S ribosomal protein L9 | 0.00e+00 | 7.62e-36 | 1.86e-18 | 0.8978 |
| 1. PBF | Q4JSG1 | 50S ribosomal protein L9 | 0.00e+00 | 1.33e-33 | 1.14e-11 | 0.8519 |
| 1. PBF | A4XDG5 | 50S ribosomal protein L9 | 1.54e-13 | 1.24e-37 | 1.60e-12 | 0.6731 |
| 1. PBF | Q5QY04 | 50S ribosomal protein L9 | 8.43e-13 | 1.39e-32 | 6.47e-04 | 0.5549 |
| 1. PBF | Q1JJD9 | 50S ribosomal protein L9 | 0.00e+00 | 2.50e-36 | 5.04e-18 | 0.8826 |
| 1. PBF | Q2ST15 | 50S ribosomal protein L9 | 0.00e+00 | 1.86e-64 | 7.80e-96 | 0.9965 |
| 1. PBF | Q0ADI9 | 50S ribosomal protein L9 | 0.00e+00 | 1.85e-32 | 2.22e-06 | 0.7917 |
| 1. PBF | B0SB37 | 50S ribosomal protein L9 | 1.11e-16 | 9.83e-39 | 1.15e-15 | 0.7949 |
| 1. PBF | Q5X4X3 | 50S ribosomal protein L9 | 1.42e-11 | 3.50e-36 | 3.79e-07 | 0.6208 |
| 1. PBF | Q056Y0 | 50S ribosomal protein L9 | 4.44e-16 | 8.29e-30 | 2.26e-09 | 0.7363 |
| 1. PBF | B7J145 | 50S ribosomal protein L9 | 5.44e-15 | 4.39e-10 | 1.07e-12 | 0.6259 |
| 1. PBF | B8ESI1 | 50S ribosomal protein L9 | 9.83e-12 | 1.73e-03 | 1.84e-05 | 0.5436 |
| 1. PBF | A1SA57 | 50S ribosomal protein L9 | 1.27e-12 | 1.99e-31 | 0.005 | 0.5518 |
| 1. PBF | Q1D289 | 50S ribosomal protein L9 | 0.00e+00 | 1.88e-37 | 2.17e-10 | 0.8799 |
| 1. PBF | B9E913 | 50S ribosomal protein L9 | 0.00e+00 | 2.63e-38 | 4.76e-17 | 0.9187 |
| 1. PBF | A9N521 | 50S ribosomal protein L9 | 2.57e-13 | 2.21e-30 | 8.97e-06 | 0.5811 |
| 1. PBF | Q0BPY8 | 50S ribosomal protein L9 | 2.96e-11 | 1.32e-02 | 6.27e-04 | 0.544 |
| 1. PBF | A4Y3F3 | 50S ribosomal protein L9 | 8.60e-13 | 4.16e-33 | 2.72e-04 | 0.5732 |
| 1. PBF | Q890J8 | 50S ribosomal protein L9 | 0.00e+00 | 3.05e-37 | 1.25e-21 | 0.8971 |
| 1. PBF | Q74M23 | 50S ribosomal protein L9 | 0.00e+00 | 4.21e-42 | 1.69e-25 | 0.9103 |
| 1. PBF | Q3Z914 | 50S ribosomal protein L9 | 0.00e+00 | 3.32e-36 | 4.88e-20 | 0.866 |
| 1. PBF | B1VPC1 | 50S ribosomal protein L9 | 1.37e-14 | 3.38e-36 | 2.20e-08 | 0.7325 |
| 1. PBF | Q82XQ9 | 50S ribosomal protein L9 | 0.00e+00 | 4.48e-31 | 1.53e-04 | 0.8721 |
| 1. PBF | B4RMH7 | 50S ribosomal protein L9 | 8.61e-11 | 1.21e-36 | 2.16e-05 | 0.5724 |
| 1. PBF | C0ZV42 | 50S ribosomal protein L9 | 2.11e-15 | 9.09e-32 | 8.38e-12 | 0.7914 |
| 1. PBF | B7MT77 | 50S ribosomal protein L9 | 1.59e-13 | 2.19e-29 | 7.01e-06 | 0.5373 |
| 1. PBF | A2S245 | 50S ribosomal protein L9 | 3.34e-11 | 2.29e-36 | 1.62e-07 | 0.575 |
| 1. PBF | Q13ZG9 | 50S ribosomal protein L9 | 5.75e-13 | 8.62e-36 | 1.10e-05 | 0.5411 |
| 1. PBF | Q21LV8 | 50S ribosomal protein L9 | 6.78e-13 | 7.83e-35 | 2.03e-05 | 0.5378 |
| 1. PBF | B2V6V8 | 50S ribosomal protein L9 | 1.11e-16 | 4.47e-40 | 1.69e-11 | 0.8203 |
| 1. PBF | B0US46 | 50S ribosomal protein L9 | 0.00e+00 | 2.15e-35 | 4.31e-05 | 0.8466 |
| 1. PBF | Q9RY49 | 50S ribosomal protein L9 | 0.00e+00 | 2.81e-33 | 2.07e-15 | 0.8386 |
| 1. PBF | Q48NZ0 | 50S ribosomal protein L9 | 3.97e-11 | 7.36e-31 | 3.53e-04 | 0.5957 |
| 1. PBF | Q72DH1 | 50S ribosomal protein L9 | 0.00e+00 | 6.23e-14 | 5.03e-13 | 0.8409 |
| 1. PBF | B7GMU4 | 50S ribosomal protein L9 | 0.00e+00 | 2.15e-38 | 2.77e-14 | 0.9147 |
| 1. PBF | Q5P2M2 | 50S ribosomal protein L9 | 0.00e+00 | 4.11e-36 | 2.41e-11 | 0.7693 |
| 1. PBF | A8GQJ6 | 50S ribosomal protein L9 | 1.11e-16 | 1.49e-12 | 6.48e-12 | 0.837 |
| 1. PBF | Q1LSR5 | 50S ribosomal protein L9 | 1.11e-16 | 6.73e-32 | 2.38e-06 | 0.7261 |
| 1. PBF | Q5HK14 | 50S ribosomal protein L9 | 0.00e+00 | 9.09e-37 | 7.39e-17 | 0.9044 |
| 1. PBF | Q21WD3 | 50S ribosomal protein L9 | 2.06e-11 | 4.28e-32 | 1.79e-07 | 0.5537 |
| 1. PBF | B9DWD0 | 50S ribosomal protein L9 | 0.00e+00 | 1.95e-36 | 3.58e-17 | 0.8906 |
| 1. PBF | Q11H14 | 50S ribosomal protein L9 | 1.57e-09 | 5.53e-03 | 0.003 | 0.557 |
| 1. PBF | Q9HUN2 | 50S ribosomal protein L9 | 3.80e-11 | 6.98e-36 | 1.70e-06 | 0.5872 |
| 1. PBF | A9IT92 | 50S ribosomal protein L9 | 1.33e-12 | 4.57e-34 | 1.67e-06 | 0.5751 |
| 1. PBF | B0SSV9 | 50S ribosomal protein L9 | 5.55e-16 | 9.83e-39 | 1.15e-15 | 0.7699 |
| 1. PBF | B1KU91 | 50S ribosomal protein L9 | 0.00e+00 | 5.26e-36 | 1.31e-22 | 0.8726 |
| 1. PBF | Q83D73 | 50S ribosomal protein L9 | 4.42e-11 | 3.57e-33 | 0.005 | 0.5682 |
| 1. PBF | Q9JU26 | 50S ribosomal protein L9 | 7.32e-11 | 1.69e-36 | 2.52e-05 | 0.5694 |
| 1. PBF | Q4UTA5 | 50S ribosomal protein L9 | 5.15e-13 | 4.12e-30 | 3.41e-05 | 0.5748 |
| 1. PBF | B3R2P4 | 50S ribosomal protein L9 | 2.66e-13 | 2.00e-34 | 5.08e-06 | 0.5488 |
| 1. PBF | Q5WWL7 | 50S ribosomal protein L9 | 1.20e-11 | 2.80e-35 | 1.64e-06 | 0.6195 |
| 1. PBF | Q744X5 | 50S ribosomal protein L9 | 2.35e-10 | 4.23e-33 | 3.62e-11 | 0.6684 |
| 1. PBF | B3PCS0 | 50S ribosomal protein L9 | 4.23e-11 | 7.03e-34 | 1.04e-04 | 0.5743 |
| 1. PBF | Q8G759 | 50S ribosomal protein L9 | 6.34e-14 | 1.23e-23 | 2.51e-06 | 0.7125 |
| 1. PBF | Q5HVB0 | 50S ribosomal protein L9 | 0.00e+00 | 1.01e-43 | 3.33e-18 | 0.908 |
| 1. PBF | C4L012 | 50S ribosomal protein L9 | 0.00e+00 | 1.37e-33 | 1.12e-11 | 0.901 |
| 1. PBF | A2C5D9 | 50S ribosomal protein L9 | 0.00e+00 | 2.60e-23 | 3.36e-10 | 0.8266 |
| 1. PBF | Q30QS9 | 50S ribosomal protein L9 | 0.00e+00 | 4.15e-40 | 1.06e-14 | 0.8725 |
| 1. PBF | B4ULB9 | 50S ribosomal protein L9 | 0.00e+00 | 6.24e-34 | 1.63e-11 | 0.9282 |
| 1. PBF | Q8R6M7 | 50S ribosomal protein L9 | 0.00e+00 | 9.20e-40 | 4.32e-26 | 0.9086 |
| 1. PBF | Q12RW6 | 50S ribosomal protein L9 | 7.51e-13 | 2.04e-30 | 0.001 | 0.5352 |
| 1. PBF | P02417 | 50S ribosomal protein L9 | 0.00e+00 | 3.63e-35 | 3.40e-19 | 0.9256 |
| 1. PBF | Q03I50 | 50S ribosomal protein L9 | 0.00e+00 | 7.88e-37 | 8.11e-22 | 0.919 |
| 1. PBF | B1LYI1 | 50S ribosomal protein L9 | 4.69e-10 | 9.42e-05 | 0.002 | 0.541 |
| 1. PBF | B3DU42 | 50S ribosomal protein L9 | 5.50e-14 | 1.23e-23 | 2.51e-06 | 0.7132 |
| 1. PBF | C3M9A8 | 50S ribosomal protein L9 | 6.73e-10 | 2.29e-04 | 1.78e-05 | 0.5629 |
| 1. PBF | A9KFL8 | 50S ribosomal protein L9 | 1.79e-12 | 2.67e-33 | 0.001 | 0.5717 |
| 1. PBF | A7GVN2 | 50S ribosomal protein L9 | 0.00e+00 | 2.92e-34 | 2.41e-24 | 0.9153 |
| 1. PBF | A2BZ59 | 50S ribosomal protein L9 | 0.00e+00 | 1.52e-25 | 2.99e-07 | 0.8741 |
| 1. PBF | B5FSA4 | 50S ribosomal protein L9 | 2.72e-13 | 2.21e-30 | 8.97e-06 | 0.5793 |
| 1. PBF | Q4QN04 | 50S ribosomal protein L9 | 5.25e-13 | 2.00e-34 | 0.009 | 0.5309 |
| 1. PBF | C1ER62 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-35 | 1.36e-22 | 0.9228 |
| 1. PBF | Q1R357 | 50S ribosomal protein L9 | 1.27e-13 | 2.19e-29 | 7.01e-06 | 0.538 |
| 1. PBF | A9LZQ0 | 50S ribosomal protein L9 | 7.01e-11 | 1.11e-36 | 2.35e-05 | 0.5731 |
| 1. PBF | Q115S4 | 50S ribosomal protein L9 | 0.00e+00 | 1.25e-25 | 7.22e-10 | 0.8461 |
| 1. PBF | Q46ZR6 | 50S ribosomal protein L9 | 5.05e-13 | 1.36e-34 | 3.77e-06 | 0.5411 |
| 1. PBF | Q6MAT5 | 50S ribosomal protein L9 | 3.83e-12 | 6.19e-30 | 7.33e-15 | 0.6073 |
| 1. PBF | Q81JI7 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-35 | 1.36e-22 | 0.9217 |
| 1. PBF | B2KEF9 | 50S ribosomal protein L9 | 0.00e+00 | 8.77e-37 | 2.25e-13 | 0.9047 |
| 1. PBF | Q2W5H3 | 50S ribosomal protein L9 | 2.63e-10 | 8.79e-03 | 0.017 | 0.5579 |
| 1. PBF | B2HUA4 | 50S ribosomal protein L9 | 3.64e-11 | 2.25e-33 | 1.30e-06 | 0.5986 |
| 1. PBF | B2A451 | 50S ribosomal protein L9 | 0.00e+00 | 9.04e-40 | 8.64e-16 | 0.84 |
| 1. PBF | O83099 | 50S ribosomal protein L9 | 3.08e-11 | 1.05e-27 | 1.54e-08 | 0.6214 |
| 1. PBF | Q64PH9 | 50S ribosomal protein L9 | 0.00e+00 | 9.42e-34 | 3.51e-10 | 0.8655 |
| 1. PBF | Q8DRS8 | 50S ribosomal protein L9 | 0.00e+00 | 1.03e-36 | 6.22e-21 | 0.8588 |
| 1. PBF | C4K161 | 50S ribosomal protein L9 | 1.11e-16 | 7.86e-13 | 2.96e-11 | 0.8335 |
| 1. PBF | B9JCB6 | 50S ribosomal protein L9 | 3.19e-10 | 4.30e-02 | 1.96e-05 | 0.5766 |
| 1. PBF | Q7M8Z5 | 50S ribosomal protein L9 | 0.00e+00 | 5.69e-40 | 3.88e-20 | 0.8938 |
| 1. PBF | Q8DWS3 | 50S ribosomal protein L9 | 0.00e+00 | 2.51e-37 | 7.64e-15 | 0.9087 |
| 1. PBF | A7I280 | 50S ribosomal protein L9 | 0.00e+00 | 6.96e-45 | 1.20e-19 | 0.8568 |
| 1. PBF | C1CUC1 | 50S ribosomal protein L9 | 1.11e-16 | 2.09e-40 | 1.93e-15 | 0.8124 |
| 1. PBF | B7HZF6 | 50S ribosomal protein L9 | 0.00e+00 | 8.69e-35 | 5.70e-22 | 0.9106 |
| 1. PBF | C0MGP8 | 50S ribosomal protein L9 | 0.00e+00 | 1.85e-37 | 1.23e-17 | 0.8846 |
| 1. PBF | B8G0I9 | 50S ribosomal protein L9 | 0.00e+00 | 4.06e-38 | 3.50e-15 | 0.9093 |
| 1. PBF | Q66F99 | 50S ribosomal protein L9 | 2.43e-13 | 5.99e-32 | 2.91e-05 | 0.5106 |
| 1. PBF | B1IHP8 | 50S ribosomal protein L9 | 0.00e+00 | 5.26e-36 | 1.31e-22 | 0.8788 |
| 1. PBF | A3DHN0 | 50S ribosomal protein L9 | 0.00e+00 | 1.21e-39 | 2.18e-22 | 0.859 |
| 1. PBF | B6JL96 | 50S ribosomal protein L9 | 0.00e+00 | 6.57e-39 | 1.46e-18 | 0.8721 |
| 1. PBF | A9VTK5 | 50S ribosomal protein L9 | 0.00e+00 | 1.08e-37 | 8.41e-26 | 0.9344 |
| 1. PBF | A9QYL3 | 50S ribosomal protein L9 | 2.44e-13 | 5.99e-32 | 2.91e-05 | 0.5108 |
| 1. PBF | B1IT03 | 50S ribosomal protein L9 | 1.56e-13 | 2.19e-29 | 7.01e-06 | 0.5375 |
| 1. PBF | B3QVR4 | 50S ribosomal protein L9 | 0.00e+00 | 2.21e-36 | 5.24e-14 | 0.8851 |
| 1. PBF | Q8EAH5 | 50S ribosomal protein L9 | 1.42e-12 | 2.20e-31 | 1.44e-04 | 0.5702 |
| 1. PBF | A8EXA9 | 50S ribosomal protein L9 | 0.00e+00 | 3.42e-12 | 1.28e-11 | 0.8483 |
| 1. PBF | B5XJA2 | 50S ribosomal protein L9 | 0.00e+00 | 2.50e-36 | 5.04e-18 | 0.8892 |
| 1. PBF | B1HPK6 | 50S ribosomal protein L9 | 0.00e+00 | 3.04e-38 | 4.58e-20 | 0.9225 |
| 1. PBF | Q03I91 | 50S ribosomal protein L9 | 0.00e+00 | 2.13e-36 | 9.93e-17 | 0.8795 |
| 1. PBF | A8F7L9 | 50S ribosomal protein L9 | 9.99e-16 | 4.23e-40 | 1.69e-21 | 0.8035 |
| 1. PBF | P66319 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.8991 |
| 1. PBF | Q04HX2 | 50S ribosomal protein L9 | 0.00e+00 | 2.09e-40 | 1.93e-15 | 0.818 |
| 1. PBF | Q72GV5 | 50S ribosomal protein L9 | 0.00e+00 | 1.49e-35 | 1.50e-22 | 0.8896 |
| 1. PBF | Q8UGF0 | 50S ribosomal protein L9 | 1.05e-08 | 1.06e-03 | 5.10e-04 | 0.5676 |
| 1. PBF | A6KWD5 | 50S ribosomal protein L9 | 0.00e+00 | 3.32e-36 | 2.57e-09 | 0.8889 |
| 1. PBF | B7NGD7 | 50S ribosomal protein L9 | 1.48e-13 | 2.19e-29 | 7.01e-06 | 0.5195 |
| 1. PBF | Q7V406 | 50S ribosomal protein L9 | 0.00e+00 | 4.04e-27 | 1.23e-08 | 0.8292 |
| 1. PBF | Q255R8 | 50S ribosomal protein L9 | 1.52e-12 | 4.73e-15 | 3.04e-09 | 0.6133 |
| 1. PBF | Q0SPS2 | 50S ribosomal protein L9 | 0.00e+00 | 1.58e-36 | 1.51e-14 | 0.8478 |
| 1. PBF | B7GTS5 | 50S ribosomal protein L9 | 8.90e-14 | 7.47e-24 | 2.87e-06 | 0.7163 |
| 1. PBF | Q8YAR2 | 50S ribosomal protein L9 | 0.00e+00 | 1.22e-40 | 1.21e-17 | 0.9354 |
| 1. PBF | A1RNI6 | 50S ribosomal protein L9 | 9.45e-13 | 4.16e-33 | 2.72e-04 | 0.5562 |
| 1. PBF | Q2JUA5 | 50S ribosomal protein L9 | 0.00e+00 | 1.12e-25 | 5.47e-13 | 0.8795 |
| 1. PBF | C6DE12 | 50S ribosomal protein L9 | 2.41e-13 | 1.23e-32 | 0.001 | 0.5979 |
| 1. PBF | C0ZA42 | 50S ribosomal protein L9 | 0.00e+00 | 4.56e-39 | 1.25e-29 | 0.8813 |
| 1. PBF | A7FZG5 | 50S ribosomal protein L9 | 0.00e+00 | 1.27e-36 | 2.61e-22 | 0.8813 |
| 1. PBF | B2I9S7 | 50S ribosomal protein L9 | 7.28e-13 | 1.59e-32 | 2.90e-08 | 0.5871 |
| 1. PBF | Q6A5N2 | 50S ribosomal protein L9 | 1.11e-16 | 2.89e-37 | 2.06e-13 | 0.8099 |
| 1. PBF | A4TRM3 | 50S ribosomal protein L9 | 2.67e-13 | 5.99e-32 | 2.91e-05 | 0.5115 |
| 1. PBF | Q317W9 | 50S ribosomal protein L9 | 0.00e+00 | 1.06e-23 | 1.01e-07 | 0.88 |
| 1. PBF | A4JEU8 | 50S ribosomal protein L9 | 4.10e-13 | 2.04e-35 | 7.43e-08 | 0.5881 |
| 1. PBF | Q62JR2 | 50S ribosomal protein L9 | 3.08e-11 | 2.29e-36 | 1.62e-07 | 0.5882 |
| 1. PBF | C3P3E0 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-35 | 1.36e-22 | 0.9194 |
| 1. PBF | Q04HQ3 | 50S ribosomal protein L9 | 0.00e+00 | 5.23e-38 | 1.87e-19 | 0.9 |
| 1. PBF | Q01QR6 | 50S ribosomal protein L9 | 1.11e-16 | 7.41e-34 | 1.98e-11 | 0.817 |
| 1. PBF | B0U5H0 | 50S ribosomal protein L9 | 6.51e-13 | 1.59e-32 | 2.90e-08 | 0.5812 |
| 1. PBF | A5GPH9 | 50S ribosomal protein L9 | 0.00e+00 | 3.69e-26 | 2.07e-10 | 0.8301 |
| 1. PBF | Q6HAG7 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-35 | 1.36e-22 | 0.9194 |
| 1. PBF | O84809 | 50S ribosomal protein L9 | 9.11e-13 | 1.40e-20 | 3.91e-07 | 0.6462 |
| 1. PBF | A4G709 | 50S ribosomal protein L9 | 5.12e-13 | 1.07e-34 | 1.68e-05 | 0.5442 |
| 1. PBF | A0K2H2 | 50S ribosomal protein L9 | 7.77e-16 | 5.06e-35 | 9.30e-09 | 0.8 |
| 1. PBF | O67830 | 50S ribosomal protein L9 | 0.00e+00 | 1.52e-38 | 1.55e-16 | 0.8692 |
| 1. PBF | A9IRT7 | 50S ribosomal protein L9 | 4.18e-10 | 4.94e-03 | 1.10e-05 | 0.4991 |
| 1. PBF | A6SXJ7 | 50S ribosomal protein L9 | 5.50e-13 | 5.72e-35 | 1.78e-05 | 0.554 |
| 1. PBF | Q63UY3 | 50S ribosomal protein L9 | 2.99e-11 | 2.29e-36 | 1.62e-07 | 0.5899 |
| 1. PBF | Q0HF42 | 50S ribosomal protein L9 | 1.25e-12 | 3.99e-31 | 0.002 | 0.571 |
| 1. PBF | B3EKG2 | 50S ribosomal protein L9 | 0.00e+00 | 3.73e-39 | 2.86e-14 | 0.8799 |
| 1. PBF | Q2FKP1 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.902 |
| 1. PBF | A7MM80 | 50S ribosomal protein L9 | 2.26e-13 | 9.58e-31 | 2.99e-05 | 0.5121 |
| 1. PBF | A5CY78 | 50S ribosomal protein L9 | 0.00e+00 | 2.04e-38 | 2.13e-18 | 0.8351 |
| 1. PBF | A0Q8Y8 | 50S ribosomal protein L9 | 2.01e-13 | 2.82e-34 | 1.56e-11 | 0.7149 |
| 1. PBF | A1VZ23 | 50S ribosomal protein L9 | 0.00e+00 | 1.18e-42 | 2.55e-17 | 0.905 |
| 1. PBF | P56035 | 50S ribosomal protein L9 | 0.00e+00 | 4.61e-38 | 3.28e-21 | 0.8727 |
| 1. PBF | A9ND50 | 50S ribosomal protein L9 | 2.26e-12 | 3.57e-33 | 0.005 | 0.5677 |
| 1. PBF | A6WJ82 | 50S ribosomal protein L9 | 9.88e-13 | 4.34e-31 | 0.047 | 0.5541 |
| 1. PBF | Q8D2U4 | 50S ribosomal protein L9 | 0.00e+00 | 1.36e-35 | 1.16e-06 | 0.8371 |
| 1. PBF | C1B716 | 50S ribosomal protein L9 | 7.77e-16 | 6.26e-33 | 1.97e-10 | 0.784 |
| 1. PBF | Q5PJ55 | 50S ribosomal protein L9 | 2.61e-13 | 5.43e-30 | 8.35e-06 | 0.5794 |
| 1. PBF | Q181R0 | 50S ribosomal protein L9 | 0.00e+00 | 1.67e-44 | 7.28e-23 | 0.8978 |
| 1. PBF | A9L123 | 50S ribosomal protein L9 | 9.56e-13 | 4.34e-31 | 0.047 | 0.5551 |
| 1. PBF | C3KWH4 | 50S ribosomal protein L9 | 0.00e+00 | 5.26e-36 | 1.31e-22 | 0.9022 |
| 1. PBF | Q39FK1 | 50S ribosomal protein L9 | 5.82e-13 | 1.90e-35 | 4.91e-08 | 0.5832 |
| 1. PBF | A6U7G4 | 50S ribosomal protein L9 | 7.99e-10 | 2.00e-04 | 2.82e-06 | 0.5667 |
| 1. PBF | A0PX93 | 50S ribosomal protein L9 | 0.00e+00 | 8.17e-37 | 3.23e-16 | 0.8553 |
| 1. PBF | A1KEM4 | 50S ribosomal protein L9 | 1.81e-10 | 4.05e-34 | 1.21e-13 | 0.6623 |
| 1. PBF | Q899Q8 | 50S ribosomal protein L9 | 0.00e+00 | 3.91e-38 | 6.16e-21 | 0.8543 |
| 1. PBF | B6YQ10 | 50S ribosomal protein L9 | 0.00e+00 | 7.32e-32 | 1.59e-06 | 0.8973 |
| 1. PBF | Q3YUE4 | 50S ribosomal protein L9 | 1.68e-13 | 2.19e-29 | 7.01e-06 | 0.6108 |
| 1. PBF | B1MMH9 | 50S ribosomal protein L9 | 1.94e-11 | 9.09e-36 | 1.26e-14 | 0.6233 |
| 1. PBF | A8L8T1 | 50S ribosomal protein L9 | 2.22e-16 | 1.82e-32 | 2.30e-13 | 0.7867 |
| 1. PBF | B9MQN7 | 50S ribosomal protein L9 | 0.00e+00 | 7.49e-41 | 1.16e-11 | 0.847 |
| 1. PBF | Q1WRG9 | 50S ribosomal protein L9 | 0.00e+00 | 2.02e-26 | 2.00e-13 | 0.8869 |
| 1. PBF | B8DAL3 | 50S ribosomal protein L9 | 0.00e+00 | 1.29e-40 | 1.15e-17 | 0.9355 |
| 1. PBF | Q9PHK8 | 50S ribosomal protein L9 | 0.00e+00 | 1.01e-43 | 3.33e-18 | 0.9087 |
| 1. PBF | A5I7Z5 | 50S ribosomal protein L9 | 0.00e+00 | 1.27e-36 | 2.61e-22 | 0.8815 |
| 1. PBF | Q5E2E1 | 50S ribosomal protein L9 | 3.09e-11 | 7.83e-32 | 1.20e-07 | 0.6042 |
| 1. PBF | B0CKD6 | 50S ribosomal protein L9 | 1.18e-09 | 2.09e-04 | 0.043 | 0.5606 |
| 1. PBF | B5BKL2 | 50S ribosomal protein L9 | 2.71e-13 | 5.43e-30 | 8.35e-06 | 0.5794 |
| 1. PBF | B5R0S1 | 50S ribosomal protein L9 | 2.62e-13 | 2.21e-30 | 8.97e-06 | 0.582 |
| 1. PBF | A6M3K7 | 50S ribosomal protein L9 | 0.00e+00 | 2.44e-39 | 8.86e-18 | 0.8355 |
| 1. PBF | A0RPN3 | 50S ribosomal protein L9 | 0.00e+00 | 3.34e-39 | 3.13e-17 | 0.9201 |
| 1. PBF | C4K4M9 | 50S ribosomal protein L9 | 5.31e-13 | 1.34e-34 | 3.45e-05 | 0.5861 |
| 1. PBF | B0RZP8 | 50S ribosomal protein L9 | 0.00e+00 | 1.49e-30 | 1.77e-14 | 0.8632 |
| 1. PBF | A0M0D9 | 50S ribosomal protein L9 | 0.00e+00 | 1.16e-35 | 8.23e-12 | 0.8626 |
| 1. PBF | C1AJ79 | 50S ribosomal protein L9 | 1.16e-10 | 4.05e-34 | 1.21e-13 | 0.6732 |
| 1. PBF | Q0SB54 | 50S ribosomal protein L9 | 4.44e-16 | 4.16e-33 | 5.71e-14 | 0.793 |
| 1. PBF | Q4KJ59 | 50S ribosomal protein L9 | 1.87e-11 | 7.92e-29 | 2.85e-04 | 0.5985 |
| 1. PBF | A4ITV1 | 50S ribosomal protein L9 | 0.00e+00 | 3.32e-36 | 4.95e-19 | 0.8972 |
| 1. PBF | Q68XR7 | 50S ribosomal protein L9 | 1.11e-16 | 3.43e-14 | 5.78e-12 | 0.8248 |
| 1. PBF | P66322 | 50S ribosomal protein L9 | 0.00e+00 | 2.50e-36 | 5.04e-18 | 0.8891 |
| 1. PBF | Q5ZZP2 | 50S ribosomal protein L9 | 0.00e+00 | 2.63e-34 | 4.73e-10 | 0.8945 |
| 1. PBF | Q821W9 | 50S ribosomal protein L9 | 5.50e-14 | 7.15e-16 | 6.03e-08 | 0.6419 |
| 1. PBF | O51139 | 50S ribosomal protein L9 | 4.88e-15 | 4.39e-10 | 1.07e-12 | 0.6251 |
| 1. PBF | B5ZWC6 | 50S ribosomal protein L9 | 4.67e-10 | 6.10e-03 | 3.82e-04 | 0.5617 |
| 1. PBF | Q8ZK80 | 50S ribosomal protein L9 | 2.79e-13 | 2.21e-30 | 8.97e-06 | 0.5821 |
| 1. PBF | B8GNS5 | 50S ribosomal protein L9 | 1.31e-12 | 2.46e-37 | 4.49e-06 | 0.5658 |
| 1. PBF | A5CWE1 | 50S ribosomal protein L9 | 5.11e-15 | 1.77e-33 | 1.24e-04 | 0.7497 |
| 1. PBF | A4T4P0 | 50S ribosomal protein L9 | 6.44e-12 | 1.10e-35 | 2.81e-13 | 0.6268 |
| 1. PBF | Q9F9K6 | 50S ribosomal protein L9 | 4.09e-10 | 1.11e-03 | 1.96e-04 | 0.5652 |
| 1. PBF | Q14HF3 | 50S ribosomal protein L9 | 1.11e-16 | 2.72e-32 | 0.004 | 0.7908 |
| 1. PBF | Q6AJZ9 | 50S ribosomal protein L9 | 2.11e-15 | 8.65e-32 | 1.18e-08 | 0.6224 |
| 1. PBF | A5F3I8 | 50S ribosomal protein L9 | 4.19e-13 | 1.44e-34 | 6.52e-08 | 0.5922 |
| 1. PBF | P0A499 | 50S ribosomal protein L9 | 0.00e+00 | 1.82e-27 | 3.38e-12 | 0.8717 |
| 1. PBF | Q1J992 | 50S ribosomal protein L9 | 0.00e+00 | 2.50e-36 | 5.04e-18 | 0.8901 |
| 1. PBF | Q4A782 | 50S ribosomal protein L9 | 0.00e+00 | 2.59e-34 | 5.37e-10 | 0.8983 |
| 1. PBF | B8IEC9 | 50S ribosomal protein L9 | 2.06e-10 | 9.50e-05 | 0.004 | 0.5579 |
| 1. PBF | C3KE70 | 50S ribosomal protein L9 | 4.15e-11 | 5.09e-30 | 0.003 | 0.5978 |
| 1. PBF | B2IVH8 | 50S ribosomal protein L9 | 0.00e+00 | 1.15e-24 | 1.39e-10 | 0.8595 |
| 1. PBF | B3W7F8 | 50S ribosomal protein L9 | 0.00e+00 | 2.46e-37 | 7.04e-18 | 0.8799 |
| 1. PBF | A2BTQ4 | 50S ribosomal protein L9 | 0.00e+00 | 6.07e-24 | 1.08e-06 | 0.8662 |
| 1. PBF | C1DCR1 | 50S ribosomal protein L9 | 4.96e-11 | 3.70e-35 | 5.43e-09 | 0.5677 |
| 1. PBF | A1AWV1 | 50S ribosomal protein L9 | 3.33e-16 | 2.03e-33 | 1.23e-06 | 0.787 |
| 1. PBF | A7H6J2 | 50S ribosomal protein L9 | 0.00e+00 | 4.58e-32 | 9.20e-11 | 0.9369 |
| 1. PBF | A5G7R0 | 50S ribosomal protein L9 | 0.00e+00 | 4.78e-37 | 5.41e-14 | 0.9211 |
| 1. PBF | Q0RAR7 | 50S ribosomal protein L9 | 1.11e-16 | 4.90e-32 | 6.84e-14 | 0.8132 |
| 1. PBF | P27151 | 50S ribosomal protein L9 | 0.00e+00 | 8.04e-36 | 6.73e-23 | 0.8837 |
| 1. PBF | Q6GKT0 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.9023 |
| 1. PBF | Q1J218 | 50S ribosomal protein L9 | 1.11e-16 | 1.34e-36 | 1.84e-14 | 0.8273 |
| 1. PBF | Q82FG6 | 50S ribosomal protein L9 | 5.23e-13 | 2.61e-35 | 2.63e-12 | 0.6743 |
| 1. PBF | B2G4Z5 | 50S ribosomal protein L9 | 0.00e+00 | 6.50e-38 | 6.47e-22 | 0.9006 |
| 1. PBF | B3QRL8 | 50S ribosomal protein L9 | 0.00e+00 | 2.14e-18 | 6.66e-14 | 0.9073 |
| 1. PBF | Q47GQ6 | 50S ribosomal protein L9 | 1.41e-13 | 1.79e-32 | 3.30e-07 | 0.5757 |
| 1. PBF | Q1H1P0 | 50S ribosomal protein L9 | 3.29e-11 | 8.21e-33 | 3.82e-06 | 0.592 |
| 1. PBF | A8A7U9 | 50S ribosomal protein L9 | 1.38e-13 | 2.19e-29 | 7.01e-06 | 0.5929 |
| 1. PBF | B3CLJ5 | 50S ribosomal protein L9 | 1.10e-14 | 5.19e-04 | 0.017 | 0.7904 |
| 1. PBF | Q3B6M4 | 50S ribosomal protein L9 | 0.00e+00 | 7.74e-37 | 2.62e-16 | 0.8776 |
| 1. PBF | Q74FE1 | 50S ribosomal protein L9 | 0.00e+00 | 3.90e-36 | 8.13e-11 | 0.9367 |
| 1. PBF | A1WGK4 | 50S ribosomal protein L9 | 1.59e-13 | 5.01e-30 | 1.58e-07 | 0.5803 |
| 1. PBF | B0B930 | 50S ribosomal protein L9 | 5.87e-12 | 1.40e-20 | 3.91e-07 | 0.6247 |
| 1. PBF | A7GJL8 | 50S ribosomal protein L9 | 0.00e+00 | 5.26e-36 | 1.31e-22 | 0.8742 |
| 1. PBF | A4SCJ8 | 50S ribosomal protein L9 | 0.00e+00 | 3.28e-37 | 9.16e-15 | 0.8856 |
| 1. PBF | B0RUY7 | 50S ribosomal protein L9 | 4.33e-13 | 4.12e-30 | 3.41e-05 | 0.5753 |
| 1. PBF | A6VD45 | 50S ribosomal protein L9 | 3.21e-11 | 6.98e-36 | 1.70e-06 | 0.589 |
| 1. PBF | Q1MRG7 | 50S ribosomal protein L9 | 1.55e-15 | 1.13e-09 | 1.20e-13 | 0.8164 |
| 1. PBF | A2RH01 | 50S ribosomal protein L9 | 0.00e+00 | 4.98e-35 | 6.59e-18 | 0.8792 |
| 1. PBF | B8J3A8 | 50S ribosomal protein L9 | 0.00e+00 | 1.67e-11 | 3.62e-14 | 0.8691 |
| 1. PBF | B0JQ94 | 50S ribosomal protein L9 | 0.00e+00 | 5.09e-30 | 5.74e-15 | 0.8722 |
| 1. PBF | A1VF28 | 50S ribosomal protein L9 | 0.00e+00 | 6.23e-14 | 5.03e-13 | 0.846 |
| 1. PBF | Q9WZW7 | 50S ribosomal protein L9 | 4.44e-16 | 6.59e-37 | 1.34e-18 | 0.8161 |
| 1. PBF | Q135M5 | 50S ribosomal protein L9 | 2.82e-10 | 1.39e-02 | 8.63e-06 | 0.5512 |
| 1. PBF | Q87VK6 | 50S ribosomal protein L9 | 3.68e-11 | 1.21e-30 | 3.39e-04 | 0.5985 |
| 1. PBF | Q8F5K3 | 50S ribosomal protein L9 | 0.00e+00 | 1.05e-39 | 4.52e-14 | 0.8466 |
| 1. PBF | B2GJD5 | 50S ribosomal protein L9 | 7.77e-16 | 1.60e-31 | 4.31e-08 | 0.7978 |
| 1. PBF | B1YRJ1 | 50S ribosomal protein L9 | 3.27e-11 | 1.09e-34 | 2.05e-08 | 0.5841 |
| 1. PBF | B8GVN4 | 50S ribosomal protein L9 | 2.11e-11 | 1.33e-02 | 1.60e-06 | 0.4704 |
| 1. PBF | A1WAR1 | 50S ribosomal protein L9 | 1.95e-13 | 1.07e-27 | 2.30e-05 | 0.5576 |
| 1. PBF | A7IK08 | 50S ribosomal protein L9 | 3.65e-10 | 1.00e-02 | 5.62e-11 | 0.5745 |
| 1. PBF | C3PKC8 | 50S ribosomal protein L9 | 6.66e-16 | 8.39e-35 | 7.71e-16 | 0.815 |
| 1. PBF | A6VMD3 | 50S ribosomal protein L9 | 7.37e-13 | 7.88e-37 | 2.07e-06 | 0.519 |
| 1. PBF | B1JMM1 | 50S ribosomal protein L9 | 2.57e-13 | 5.99e-32 | 2.91e-05 | 0.5104 |
| 1. PBF | Q7W7P5 | 50S ribosomal protein L9 | 3.92e-13 | 4.77e-33 | 1.51e-09 | 0.5924 |
| 1. PBF | B8DSK3 | 50S ribosomal protein L9 | 3.59e-11 | 1.29e-23 | 2.19e-06 | 0.466 |
| 1. PBF | C0QBV1 | 50S ribosomal protein L9 | 0.00e+00 | 1.02e-32 | 0.001 | 0.8739 |
| 1. PBF | P66318 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.8984 |
| 1. PBF | P42352 | 50S ribosomal protein L9 | 0.00e+00 | 2.07e-30 | 1.09e-07 | 0.9057 |
| 1. PBF | B7IBC3 | 50S ribosomal protein L9 | 3.35e-11 | 2.25e-33 | 1.30e-06 | 0.6001 |
| 1. PBF | A8FR98 | 50S ribosomal protein L9 | 9.56e-13 | 8.56e-30 | 1.07e-05 | 0.5699 |
| 1. PBF | C1FP10 | 50S ribosomal protein L9 | 0.00e+00 | 5.26e-36 | 1.31e-22 | 0.8748 |
| 1. PBF | C4ZR80 | 50S ribosomal protein L9 | 1.60e-13 | 2.19e-29 | 7.01e-06 | 0.5371 |
| 1. PBF | Q4FMR7 | 50S ribosomal protein L9 | 1.82e-11 | 3.33e-32 | 5.82e-05 | 0.6579 |
| 1. PBF | B0TA56 | 50S ribosomal protein L9 | 0.00e+00 | 3.26e-38 | 1.01e-14 | 0.8705 |
| 1. PBF | A5WFZ1 | 50S ribosomal protein L9 | 5.32e-11 | 2.92e-20 | 1.53e-06 | 0.5855 |
| 1. PBF | Q0HYW3 | 50S ribosomal protein L9 | 9.37e-13 | 3.99e-31 | 0.002 | 0.5718 |
| 1. PBF | B1WTN1 | 50S ribosomal protein L9 | 0.00e+00 | 1.42e-26 | 1.00e-12 | 0.8909 |
| 1. PBF | Q9JZ31 | 50S ribosomal protein L9 | 5.70e-11 | 1.13e-36 | 2.88e-05 | 0.5796 |
| 1. PBF | B2TY76 | 50S ribosomal protein L9 | 1.50e-13 | 2.19e-29 | 7.01e-06 | 0.5384 |
| 1. PBF | Q6N5A1 | 50S ribosomal protein L9 | 3.97e-10 | 1.25e-02 | 1.56e-10 | 0.547 |
| 1. PBF | Q2S2U0 | 50S ribosomal protein L9 | 0.00e+00 | 3.91e-38 | 1.02e-23 | 0.9583 |
| 1. PBF | C1CNH8 | 50S ribosomal protein L9 | 1.11e-16 | 2.09e-40 | 1.93e-15 | 0.8087 |
| 1. PBF | Q2SLB3 | 50S ribosomal protein L9 | 6.38e-13 | 2.77e-34 | 3.43e-05 | 0.5309 |
| 1. PBF | Q8G276 | 50S ribosomal protein L9 | 1.05e-09 | 2.09e-04 | 0.043 | 0.5616 |
| 1. PBF | A9W8G1 | 50S ribosomal protein L9 | 7.35e-10 | 2.44e-04 | 1.13e-05 | 0.5443 |
| 1. PBF | A6W0Y6 | 50S ribosomal protein L9 | 8.67e-11 | 8.54e-35 | 7.10e-06 | 0.559 |
| 1. PBF | A8AU89 | 50S ribosomal protein L9 | 0.00e+00 | 5.89e-39 | 6.09e-11 | 0.8625 |
| 1. PBF | A1KUE7 | 50S ribosomal protein L9 | 5.70e-11 | 9.94e-37 | 3.38e-05 | 0.5678 |
| 1. PBF | Q9PAF9 | 50S ribosomal protein L9 | 6.67e-13 | 9.40e-32 | 4.47e-07 | 0.5846 |
| 1. PBF | Q9KUY9 | 50S ribosomal protein L9 | 4.33e-13 | 1.44e-34 | 6.52e-08 | 0.5756 |
| 1. PBF | B4S010 | 50S ribosomal protein L9 | 1.12e-12 | 5.46e-33 | 3.78e-05 | 0.5869 |
| 1. PBF | B3CRZ9 | 50S ribosomal protein L9 | 2.98e-13 | 3.02e-12 | 4.26e-14 | 0.7083 |
| 1. PBF | B4U7M7 | 50S ribosomal protein L9 | 0.00e+00 | 7.24e-38 | 4.48e-15 | 0.8771 |
| 1. PBF | B7M9G5 | 50S ribosomal protein L9 | 1.71e-13 | 2.19e-29 | 7.01e-06 | 0.5371 |
| 1. PBF | Q1CU17 | 50S ribosomal protein L9 | 0.00e+00 | 3.10e-35 | 8.50e-18 | 0.864 |
| 1. PBF | Q73GZ5 | 50S ribosomal protein L9 | 5.31e-14 | 3.37e-06 | 0.025 | 0.7579 |
| 1. PBF | Q02F86 | 50S ribosomal protein L9 | 3.74e-11 | 6.98e-36 | 1.70e-06 | 0.5874 |
| 1. PBF | Q1AXR0 | 50S ribosomal protein L9 | 0.00e+00 | 4.95e-37 | 6.97e-19 | 0.8621 |
| 1. PBF | Q24MC2 | 50S ribosomal protein L9 | 0.00e+00 | 4.06e-38 | 3.50e-15 | 0.91 |
| 1. PBF | B0VM08 | 50S ribosomal protein L9 | 3.41e-11 | 5.24e-35 | 1.27e-06 | 0.6022 |
| 1. PBF | B1JAG8 | 50S ribosomal protein L9 | 2.85e-13 | 4.77e-33 | 7.28e-06 | 0.5987 |
| 1. PBF | A7FMW2 | 50S ribosomal protein L9 | 2.56e-13 | 5.99e-32 | 2.91e-05 | 0.5102 |
| 1. PBF | Q46IB6 | 50S ribosomal protein L9 | 0.00e+00 | 4.09e-23 | 3.12e-10 | 0.8128 |
| 1. PBF | Q3ANR2 | 50S ribosomal protein L9 | 0.00e+00 | 6.45e-34 | 2.27e-13 | 0.8767 |
| 1. PBF | Q11RW8 | 50S ribosomal protein L9 | 0.00e+00 | 4.28e-32 | 2.57e-06 | 0.8918 |
| 1. PBF | Q1IHW5 | 50S ribosomal protein L9 | 0.00e+00 | 3.22e-30 | 9.28e-09 | 0.8589 |
| 1. PBF | B1MWV4 | 50S ribosomal protein L9 | 0.00e+00 | 4.34e-34 | 3.43e-17 | 0.8906 |
| 1. PBF | B5EP97 | 50S ribosomal protein L9 | 1.68e-11 | 1.32e-38 | 1.91e-04 | 0.5943 |
| 1. PBF | B7KAD1 | 50S ribosomal protein L9 | 0.00e+00 | 1.25e-27 | 6.15e-14 | 0.9089 |
| 1. PBF | Q31K30 | 50S ribosomal protein L9 | 0.00e+00 | 8.80e-32 | 1.66e-11 | 0.8833 |
| 1. PBF | Q92JK1 | 50S ribosomal protein L9 | 0.00e+00 | 2.74e-13 | 2.51e-11 | 0.8426 |
| 1. PBF | Q8XH49 | 50S ribosomal protein L9 | 0.00e+00 | 1.58e-36 | 1.51e-14 | 0.8547 |
| 1. PBF | Q8EKX1 | 50S ribosomal protein L9 | 0.00e+00 | 7.37e-38 | 1.43e-20 | 0.9254 |
| 1. PBF | Q3AG23 | 50S ribosomal protein L9 | 0.00e+00 | 2.55e-36 | 2.11e-20 | 0.9159 |
| 1. PBF | B5R9F1 | 50S ribosomal protein L9 | 2.57e-13 | 2.21e-30 | 8.97e-06 | 0.5812 |
| 1. PBF | B2UTX4 | 50S ribosomal protein L9 | 0.00e+00 | 6.57e-39 | 1.30e-21 | 0.8685 |
| 1. PBF | B5Z6N7 | 50S ribosomal protein L9 | 0.00e+00 | 2.07e-39 | 4.66e-22 | 0.8476 |
| 1. PBF | B9MDJ2 | 50S ribosomal protein L9 | 4.45e-13 | 1.07e-27 | 2.30e-05 | 0.4913 |
| 1. PBF | B7IS13 | 50S ribosomal protein L9 | 0.00e+00 | 3.65e-37 | 1.34e-21 | 0.9286 |
| 1. PBF | C5CD93 | 50S ribosomal protein L9 | 0.00e+00 | 8.81e-39 | 3.74e-17 | 0.8547 |
| 1. PBF | B2T3N6 | 50S ribosomal protein L9 | 6.06e-13 | 2.52e-35 | 1.99e-05 | 0.5735 |
| 1. PBF | Q2SWJ6 | 50S ribosomal protein L9 | 4.93e-13 | 7.76e-36 | 7.68e-07 | 0.5869 |
| 1. PBF | B2SGH2 | 50S ribosomal protein L9 | 0.00e+00 | 2.72e-32 | 0.004 | 0.8063 |
| 1. PBF | B4F278 | 50S ribosomal protein L9 | 2.40e-13 | 2.55e-31 | 2.22e-04 | 0.5303 |
| 1. PBF | A4SIZ9 | 50S ribosomal protein L9 | 1.27e-13 | 1.09e-31 | 0.002 | 0.5818 |
| 1. PBF | Q88DF1 | 50S ribosomal protein L9 | 3.84e-11 | 6.51e-32 | 1.18e-04 | 0.5968 |
| 1. PBF | A6LIX9 | 50S ribosomal protein L9 | 0.00e+00 | 3.70e-35 | 3.30e-09 | 0.8795 |
| 1. PBF | A6TXG5 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.8962 |
| 1. PBF | Q31TD4 | 50S ribosomal protein L9 | 1.38e-13 | 2.19e-29 | 7.01e-06 | 0.5374 |
| 1. PBF | B7UQL2 | 50S ribosomal protein L9 | 1.40e-13 | 2.19e-29 | 7.01e-06 | 0.5375 |
| 1. PBF | B8D1C5 | 50S ribosomal protein L9 | 0.00e+00 | 1.96e-39 | 8.48e-10 | 0.9191 |
| 1. PBF | Q6F234 | 50S ribosomal protein L9 | 0.00e+00 | 2.92e-40 | 1.83e-56 | 0.9797 |
| 1. PBF | Q8PAC0 | 50S ribosomal protein L9 | 5.35e-11 | 4.12e-30 | 3.41e-05 | 0.5845 |
| 1. PBF | C1CBI1 | 50S ribosomal protein L9 | 0.00e+00 | 2.09e-40 | 1.93e-15 | 0.8167 |
| 1. PBF | A1BJC0 | 50S ribosomal protein L9 | 0.00e+00 | 2.75e-35 | 3.15e-16 | 0.8898 |
| 1. PBF | Q6F9Q8 | 50S ribosomal protein L9 | 3.08e-11 | 2.91e-33 | 8.06e-06 | 0.6008 |
| 1. PBF | Q03CU2 | 50S ribosomal protein L9 | 0.00e+00 | 2.46e-37 | 7.04e-18 | 0.8822 |
| 1. PBF | A9BH65 | 50S ribosomal protein L9 | 0.00e+00 | 9.19e-43 | 4.94e-24 | 0.7971 |
| 1. PBF | Q9CLP0 | 50S ribosomal protein L9 | 4.45e-13 | 2.64e-36 | 0.029 | 0.5877 |
| 1. PBF | A1VPX1 | 50S ribosomal protein L9 | 2.36e-13 | 7.77e-30 | 0.015 | 0.5523 |
| 1. PBF | C1DLR5 | 50S ribosomal protein L9 | 2.36e-13 | 1.03e-33 | 1.98e-06 | 0.5846 |
| 1. PBF | Q98Q52 | 50S ribosomal protein L9 | 0.00e+00 | 1.70e-30 | 7.84e-11 | 0.8537 |
| 1. PBF | Q5HJY1 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.9014 |
| 1. PBF | B6I2A9 | 50S ribosomal protein L9 | 1.32e-13 | 2.19e-29 | 7.01e-06 | 0.5378 |
| 1. PBF | Q2KA96 | 50S ribosomal protein L9 | 6.43e-10 | 2.54e-03 | 1.18e-04 | 0.5639 |
| 1. PBF | C6E506 | 50S ribosomal protein L9 | 0.00e+00 | 3.10e-36 | 8.64e-14 | 0.942 |
| 1. PBF | B2JG21 | 50S ribosomal protein L9 | 6.41e-13 | 7.83e-35 | 2.45e-08 | 0.5421 |
| 1. PBF | Q9ZLW3 | 50S ribosomal protein L9 | 0.00e+00 | 8.67e-38 | 8.72e-22 | 0.841 |
| 1. PBF | B4SB45 | 50S ribosomal protein L9 | 0.00e+00 | 1.34e-34 | 4.11e-13 | 0.882 |
| 1. PBF | C4LAB6 | 50S ribosomal protein L9 | 7.41e-13 | 8.94e-32 | 0.009 | 0.5722 |
| 1. PBF | B5ZC58 | 50S ribosomal protein L9 | 0.00e+00 | 1.36e-38 | 3.55e-16 | 0.806 |
| 1. PBF | A9WHR4 | 50S ribosomal protein L9 | 0.00e+00 | 8.54e-41 | 9.94e-20 | 0.911 |
| 1. PBF | A9MF07 | 50S ribosomal protein L9 | 2.77e-13 | 5.43e-30 | 8.35e-06 | 0.579 |
| 1. PBF | Q3MGD1 | 50S ribosomal protein L9 | 0.00e+00 | 2.69e-27 | 5.88e-11 | 0.8316 |
| 1. PBF | Q03UT5 | 50S ribosomal protein L9 | 0.00e+00 | 9.31e-35 | 1.21e-17 | 0.9008 |
| 1. PBF | Q7VMD5 | 50S ribosomal protein L9 | 2.37e-13 | 5.62e-35 | 7.69e-06 | 0.478 |
| 1. PBF | Q7UKV4 | 50S ribosomal protein L9 | 0.00e+00 | 1.53e-13 | 2.03e-07 | 0.8818 |
| 1. PBF | Q9A7Q3 | 50S ribosomal protein L9 | 1.02e-11 | 1.33e-02 | 1.60e-06 | 0.4428 |
| 1. PBF | B2IHD4 | 50S ribosomal protein L9 | 7.08e-12 | 1.42e-03 | 4.60e-05 | 0.5596 |
| 1. PBF | Q92FQ7 | 50S ribosomal protein L9 | 0.00e+00 | 4.56e-40 | 4.51e-18 | 0.9378 |
| 1. PBF | Q5ZV51 | 50S ribosomal protein L9 | 1.18e-11 | 1.94e-35 | 4.71e-07 | 0.6198 |
| 1. PBF | Q3JEJ4 | 50S ribosomal protein L9 | 4.00e-12 | 7.67e-33 | 8.70e-09 | 0.5627 |
| 1. PBF | P0A7R3 | 50S ribosomal protein L9 | 1.64e-13 | 2.19e-29 | 7.01e-06 | 0.5375 |
| 1. PBF | Q2GEY5 | 50S ribosomal protein L9 | 8.88e-16 | 1.08e-23 | 4.06e-06 | 0.8234 |
| 1. PBF | A8ETF6 | 50S ribosomal protein L9 | 0.00e+00 | 4.35e-41 | 5.14e-17 | 0.8956 |
| 1. PBF | A3D8Q2 | 50S ribosomal protein L9 | 1.03e-12 | 5.47e-31 | 0.047 | 0.554 |
| 1. PBF | Q4FS19 | 50S ribosomal protein L9 | 4.52e-11 | 5.90e-15 | 6.77e-06 | 0.5962 |
| 1. PBF | A4IY05 | 50S ribosomal protein L9 | 1.11e-16 | 2.72e-32 | 0.004 | 0.7982 |
| 1. PBF | Q2G8G5 | 50S ribosomal protein L9 | 5.29e-11 | 2.83e-02 | 3.25e-06 | 0.5328 |
| 1. PBF | A3PFG1 | 50S ribosomal protein L9 | 0.00e+00 | 6.07e-24 | 4.07e-07 | 0.8716 |
| 1. PBF | B5Y878 | 50S ribosomal protein L9 | 0.00e+00 | 4.64e-39 | 1.14e-12 | 0.8365 |
| 1. PBF | B9KAA5 | 50S ribosomal protein L9 | 4.44e-16 | 2.58e-38 | 6.47e-19 | 0.8161 |
| 1. PBF | B2INM2 | 50S ribosomal protein L9 | 0.00e+00 | 2.09e-40 | 1.93e-15 | 0.8244 |
| 1. PBF | B0BQB0 | 50S ribosomal protein L9 | 1.83e-11 | 1.44e-34 | 0.004 | 0.5684 |
| 1. PBF | Q489T8 | 50S ribosomal protein L9 | 5.37e-13 | 2.25e-33 | 1.23e-07 | 0.4752 |
| 1. PBF | Q1CEH3 | 50S ribosomal protein L9 | 2.53e-13 | 5.99e-32 | 2.91e-05 | 0.5102 |
| 1. PBF | B9KJP2 | 50S ribosomal protein L9 | 9.52e-12 | 1.19e-03 | 9.89e-06 | 0.5343 |
| 1. PBF | A5U9V1 | 50S ribosomal protein L9 | 4.86e-13 | 5.53e-34 | 0.016 | 0.5313 |
| 1. PBF | A0KT23 | 50S ribosomal protein L9 | 1.27e-12 | 3.99e-31 | 0.002 | 0.5699 |
| 1. PBF | Q030M6 | 50S ribosomal protein L9 | 0.00e+00 | 4.73e-36 | 1.10e-16 | 0.8979 |
| 1. PBF | Q8E2M3 | 50S ribosomal protein L9 | 0.00e+00 | 2.51e-37 | 7.64e-15 | 0.9055 |
| 1. PBF | C4XGN5 | 50S ribosomal protein L9 | 0.00e+00 | 6.77e-06 | 6.22e-12 | 0.8679 |
| 1. PBF | B9M5V1 | 50S ribosomal protein L9 | 0.00e+00 | 1.99e-37 | 3.91e-13 | 0.9011 |
| 1. PBF | Q2IM65 | 50S ribosomal protein L9 | 0.00e+00 | 2.26e-32 | 8.59e-12 | 0.9306 |
| 1. PBF | C5BF79 | 50S ribosomal protein L9 | 3.70e-13 | 1.31e-30 | 3.12e-06 | 0.5163 |
| 1. PBF | A5W9R5 | 50S ribosomal protein L9 | 3.53e-11 | 6.51e-32 | 1.18e-04 | 0.5979 |
| 1. PBF | P0A4A0 | 50S ribosomal protein L9 | 0.00e+00 | 1.82e-27 | 3.38e-12 | 0.8679 |
| 1. PBF | A5CCY5 | 50S ribosomal protein L9 | 3.81e-13 | 7.66e-10 | 3.34e-15 | 0.7115 |
| 1. PBF | C0RHF9 | 50S ribosomal protein L9 | 1.66e-08 | 2.56e-04 | 0.040 | 0.5692 |
| 1. PBF | P66320 | 50S ribosomal protein L9 | 0.00e+00 | 2.09e-40 | 1.93e-15 | 0.827 |
| 1. PBF | Q3ZZV8 | 50S ribosomal protein L9 | 0.00e+00 | 8.77e-37 | 3.98e-20 | 0.8633 |
| 1. PBF | B7HGC9 | 50S ribosomal protein L9 | 0.00e+00 | 7.10e-36 | 7.80e-22 | 0.9164 |
| 1. PBF | Q5KU74 | 50S ribosomal protein L9 | 0.00e+00 | 2.89e-37 | 2.43e-16 | 0.9047 |
| 1. PBF | B8HS22 | 50S ribosomal protein L9 | 0.00e+00 | 2.40e-30 | 2.25e-13 | 0.8803 |
| 1. PBF | Q67J52 | 50S ribosomal protein L9 | 0.00e+00 | 4.82e-36 | 1.52e-14 | 0.882 |
| 1. PBF | C4ZDL0 | 50S ribosomal protein L9 | 0.00e+00 | 7.92e-38 | 8.68e-17 | 0.9268 |
| 1. PBF | Q6GD75 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.9002 |
| 1. PBF | B1XDV3 | 50S ribosomal protein L9 | 1.68e-13 | 2.19e-29 | 7.01e-06 | 0.5375 |
| 1. PBF | A6QD54 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.901 |
| 1. PBF | A1UP83 | 50S ribosomal protein L9 | 9.51e-12 | 2.81e-33 | 5.43e-16 | 0.6574 |
| 1. PBF | A1WUS4 | 50S ribosomal protein L9 | 4.82e-13 | 4.38e-33 | 9.69e-09 | 0.5266 |
| 1. PBF | P44349 | 50S ribosomal protein L9 | 5.02e-13 | 5.53e-34 | 0.016 | 0.5313 |
| 1. PBF | A6THB4 | 50S ribosomal protein L9 | 3.16e-13 | 1.83e-31 | 1.15e-06 | 0.5114 |
| 1. PBF | A3CRA9 | 50S ribosomal protein L9 | 0.00e+00 | 2.63e-39 | 1.92e-16 | 0.863 |
| 1. PBF | Q0BEQ9 | 50S ribosomal protein L9 | 5.00e-13 | 1.09e-34 | 2.05e-08 | 0.5855 |
| 1. PBF | Q052J9 | 50S ribosomal protein L9 | 1.11e-16 | 1.33e-39 | 1.81e-12 | 0.8194 |
| 1. PBF | A0LWU2 | 50S ribosomal protein L9 | 0.00e+00 | 7.49e-36 | 1.83e-14 | 0.8385 |
| 1. PBF | B3ERG3 | 50S ribosomal protein L9 | 0.00e+00 | 3.15e-38 | 2.21e-08 | 0.8404 |
| 1. PBF | B2S9V1 | 50S ribosomal protein L9 | 1.11e-11 | 2.05e-04 | 0.042 | 0.5623 |
| 1. PBF | B1IA16 | 50S ribosomal protein L9 | 1.11e-16 | 2.09e-40 | 1.93e-15 | 0.8115 |
| 1. PBF | B9DXQ4 | 50S ribosomal protein L9 | 0.00e+00 | 1.23e-36 | 1.86e-18 | 0.8246 |
| 1. PBF | Q312D7 | 50S ribosomal protein L9 | 0.00e+00 | 2.53e-10 | 3.77e-16 | 0.859 |
| 1. PBF | A0LN56 | 50S ribosomal protein L9 | 0.00e+00 | 7.34e-37 | 8.37e-10 | 0.9426 |
| 1. PBF | C1KV60 | 50S ribosomal protein L9 | 0.00e+00 | 1.22e-40 | 1.21e-17 | 0.936 |
| 1. PBF | Q6KIB8 | 50S ribosomal protein L9 | 0.00e+00 | 1.17e-29 | 1.76e-15 | 0.8512 |
| 1. PBF | Q4A5Y3 | 50S ribosomal protein L9 | 0.00e+00 | 1.66e-33 | 7.61e-12 | 0.8635 |
| 1. PBF | Q1RKB3 | 50S ribosomal protein L9 | 0.00e+00 | 7.25e-13 | 8.71e-11 | 0.8663 |
| 1. PBF | C3LRA1 | 50S ribosomal protein L9 | 4.17e-13 | 1.44e-34 | 6.52e-08 | 0.574 |
| 1. PBF | P57625 | 50S ribosomal protein L9 | 1.11e-16 | 1.01e-30 | 5.86e-06 | 0.8248 |
| 1. PBF | Q5FN05 | 50S ribosomal protein L9 | 0.00e+00 | 2.38e-40 | 1.21e-21 | 0.8589 |
| 1. PBF | B0BVY2 | 50S ribosomal protein L9 | 1.11e-16 | 1.49e-12 | 6.48e-12 | 0.8307 |
| 1. PBF | Q0I6E0 | 50S ribosomal protein L9 | 1.11e-16 | 1.14e-26 | 1.40e-08 | 0.8299 |
| 1. PBF | B5EHW6 | 50S ribosomal protein L9 | 0.00e+00 | 1.32e-36 | 4.47e-14 | 0.9387 |
| 1. PBF | P9WH78 | 50S ribosomal protein L9 | 2.14e-10 | 4.05e-34 | 1.21e-13 | 0.6698 |
| 1. PBF | A1V4Q8 | 50S ribosomal protein L9 | 6.30e-13 | 2.29e-36 | 1.62e-07 | 0.5887 |
| 1. PBF | Q9X8U5 | 50S ribosomal protein L9 | 2.50e-13 | 6.03e-35 | 1.71e-13 | 0.6922 |
| 1. PBF | P0DE60 | 50S ribosomal protein L9 | 0.00e+00 | 2.50e-36 | 5.04e-18 | 0.886 |
| 1. PBF | C0MB49 | 50S ribosomal protein L9 | 0.00e+00 | 1.97e-35 | 2.35e-18 | 0.8879 |
| 1. PBF | A1RC67 | 50S ribosomal protein L9 | 0.00e+00 | 2.37e-36 | 0.017 | 0.8332 |
| 1. PBF | C1F902 | 50S ribosomal protein L9 | 0.00e+00 | 3.89e-33 | 6.38e-15 | 0.8978 |
| 1. PBF | B1KHY7 | 50S ribosomal protein L9 | 6.23e-13 | 9.75e-30 | 1.37e-05 | 0.5545 |
| 1. PBF | B7J913 | 50S ribosomal protein L9 | 2.08e-11 | 1.32e-38 | 1.91e-04 | 0.5897 |
| 1. PBF | A5UH49 | 50S ribosomal protein L9 | 4.00e-13 | 6.24e-34 | 0.017 | 0.5325 |
| 1. PBF | A6Q3Q0 | 50S ribosomal protein L9 | 0.00e+00 | 3.26e-40 | 4.36e-17 | 0.8803 |
| 1. PBF | Q1CBW7 | 50S ribosomal protein L9 | 2.73e-13 | 5.99e-32 | 2.91e-05 | 0.5101 |
| 1. PBF | A7ZDF3 | 50S ribosomal protein L9 | 0.00e+00 | 4.67e-44 | 2.51e-17 | 0.8924 |
| 1. PBF | Q7VJD2 | 50S ribosomal protein L9 | 0.00e+00 | 8.34e-39 | 1.49e-22 | 0.918 |
| 1. PBF | Q8ZB84 | 50S ribosomal protein L9 | 2.80e-13 | 5.99e-32 | 2.91e-05 | 0.5097 |
| 1. PBF | A1A3H8 | 50S ribosomal protein L9 | 2.45e-14 | 9.81e-26 | 1.63e-05 | 0.7414 |
| 1. PBF | Q5WAH8 | 50S ribosomal protein L9 | 0.00e+00 | 7.89e-43 | 6.54e-16 | 0.9281 |
| 1. PBF | A5TYC7 | 50S ribosomal protein L9 | 1.55e-10 | 4.05e-34 | 1.21e-13 | 0.6609 |
| 1. PBF | Q0K9E8 | 50S ribosomal protein L9 | 1.23e-13 | 1.33e-33 | 1.78e-06 | 0.549 |
| 1. PBF | Q4ZYW8 | 50S ribosomal protein L9 | 1.42e-13 | 1.21e-30 | 3.39e-04 | 0.6 |
| 1. PBF | A1JIT1 | 50S ribosomal protein L9 | 3.33e-13 | 1.09e-30 | 3.06e-05 | 0.5938 |
| 1. PBF | B1JTF0 | 50S ribosomal protein L9 | 6.31e-13 | 6.24e-35 | 5.01e-08 | 0.5694 |
| 1. PBF | B8ZQ95 | 50S ribosomal protein L9 | 0.00e+00 | 2.09e-40 | 1.93e-15 | 0.8188 |
| 1. PBF | B5Y305 | 50S ribosomal protein L9 | 2.68e-13 | 3.86e-31 | 1.18e-06 | 0.5131 |
| 1. PBF | B8CIQ4 | 50S ribosomal protein L9 | 1.08e-12 | 9.09e-33 | 4.28e-04 | 0.5688 |
| 1. PBF | A3QI49 | 50S ribosomal protein L9 | 1.03e-12 | 1.04e-31 | 5.14e-07 | 0.5703 |
| 1. PBF | Q8A5S7 | 50S ribosomal protein L9 | 0.00e+00 | 9.10e-34 | 1.43e-09 | 0.8647 |
| 1. PBF | Q8Z163 | 50S ribosomal protein L9 | 2.72e-13 | 5.43e-30 | 8.35e-06 | 0.5804 |
| 1. PBF | A1AJA7 | 50S ribosomal protein L9 | 1.47e-13 | 2.19e-29 | 7.01e-06 | 0.5381 |
| 1. PBF | Q3A320 | 50S ribosomal protein L9 | 0.00e+00 | 5.72e-35 | 2.68e-15 | 0.9027 |
| 1. PBF | A8MKJ7 | 50S ribosomal protein L9 | 0.00e+00 | 5.49e-40 | 8.17e-25 | 0.9471 |
| 1. PBF | B0RDN5 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-33 | 3.69e-07 | 0.8568 |
| 1. PBF | A6QAX3 | 50S ribosomal protein L9 | 1.11e-16 | 1.21e-36 | 5.75e-18 | 0.8309 |
| 1. PBF | Q5X9C4 | 50S ribosomal protein L9 | 0.00e+00 | 1.41e-37 | 1.80e-17 | 0.8947 |
| 1. PBF | Q0AB47 | 50S ribosomal protein L9 | 5.52e-11 | 1.08e-33 | 2.69e-08 | 0.5799 |
| 1. PBF | B1ZFQ5 | 50S ribosomal protein L9 | 8.31e-10 | 1.10e-04 | 1.44e-05 | 0.4678 |
| 1. PBF | C0Q6G1 | 50S ribosomal protein L9 | 2.73e-13 | 5.43e-30 | 8.35e-06 | 0.579 |
| 1. PBF | B0U081 | 50S ribosomal protein L9 | 1.11e-16 | 1.46e-32 | 1.46e-04 | 0.8231 |
| 1. PBF | Q83GX4 | 50S ribosomal protein L9 | 3.66e-15 | 5.15e-32 | 3.34e-09 | 0.7905 |
| 1. PBF | Q04CW5 | 50S ribosomal protein L9 | 0.00e+00 | 1.03e-36 | 1.40e-21 | 0.8692 |
| 1. PBF | Q5LXK2 | 50S ribosomal protein L9 | 0.00e+00 | 1.23e-36 | 3.56e-17 | 0.8789 |
| 1. PBF | A4J9Q0 | 50S ribosomal protein L9 | 0.00e+00 | 3.45e-38 | 2.73e-18 | 0.8949 |
| 1. PBF | A7WWQ0 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.8969 |
| 1. PBF | A4VQM7 | 50S ribosomal protein L9 | 2.34e-11 | 2.11e-33 | 1.12e-06 | 0.5949 |
| 1. PBF | A5VP24 | 50S ribosomal protein L9 | 1.07e-09 | 3.04e-04 | 0.042 | 0.561 |
| 1. PBF | B4TFD8 | 50S ribosomal protein L9 | 2.67e-13 | 2.21e-30 | 8.97e-06 | 0.5793 |
| 1. PBF | B1I6Q1 | 50S ribosomal protein L9 | 0.00e+00 | 5.72e-35 | 2.08e-19 | 0.827 |
| 1. PBF | B3Q9T8 | 50S ribosomal protein L9 | 3.19e-10 | 1.25e-02 | 1.56e-10 | 0.5375 |
| 1. PBF | Q7WL32 | 50S ribosomal protein L9 | 3.64e-13 | 4.77e-33 | 1.51e-09 | 0.5937 |
| 1. PBF | B2UAG7 | 50S ribosomal protein L9 | 4.87e-14 | 1.63e-33 | 2.71e-09 | 0.5521 |
| 1. PBF | Q8YZA0 | 50S ribosomal protein L9 | 0.00e+00 | 4.87e-27 | 4.52e-11 | 0.8314 |
| 1. PBF | A7MSX5 | 50S ribosomal protein L9 | 8.98e-13 | 6.47e-33 | 7.20e-08 | 0.5837 |
| 1. PBF | B7H0J8 | 50S ribosomal protein L9 | 3.62e-11 | 2.25e-33 | 1.30e-06 | 0.5998 |
| 1. PBF | A8YW53 | 50S ribosomal protein L9 | 0.00e+00 | 1.52e-41 | 4.82e-21 | 0.8807 |
| 1. PBF | A6WG60 | 50S ribosomal protein L9 | 3.89e-15 | 1.31e-29 | 4.02e-14 | 0.7616 |
| 1. PBF | B4T3F4 | 50S ribosomal protein L9 | 2.81e-13 | 2.21e-30 | 8.97e-06 | 0.579 |
| 1. PBF | A1THY4 | 50S ribosomal protein L9 | 6.09e-12 | 1.74e-33 | 6.28e-14 | 0.6338 |
| 1. PBF | B2K2L6 | 50S ribosomal protein L9 | 2.90e-13 | 5.99e-32 | 2.91e-05 | 0.5106 |
| 1. PBF | Q1I464 | 50S ribosomal protein L9 | 4.06e-11 | 5.03e-31 | 1.60e-04 | 0.5948 |
| 1. PBF | A4W5T2 | 50S ribosomal protein L9 | 1.72e-13 | 5.43e-30 | 0.002 | 0.5843 |
| 1. PBF | Q8CU90 | 50S ribosomal protein L9 | 0.00e+00 | 9.09e-37 | 7.39e-17 | 0.9031 |
| 1. PBF | A8YYT8 | 50S ribosomal protein L9 | 0.00e+00 | 9.64e-35 | 8.93e-13 | 0.8999 |
| 1. PBF | Q72QK3 | 50S ribosomal protein L9 | 0.00e+00 | 1.05e-39 | 4.52e-14 | 0.8313 |
| 1. PBF | C1A7N5 | 50S ribosomal protein L9 | 0.00e+00 | 2.10e-34 | 2.78e-11 | 0.8908 |
| 1. PBF | Q7UZJ1 | 50S ribosomal protein L9 | 0.00e+00 | 3.16e-26 | 9.19e-07 | 0.8733 |
| 1. PBF | B8J801 | 50S ribosomal protein L9 | 0.00e+00 | 6.24e-34 | 1.63e-11 | 0.9304 |
| 1. PBF | Q2J4C7 | 50S ribosomal protein L9 | 0.00e+00 | 1.26e-33 | 2.12e-14 | 0.8211 |
| 2. PF | A1US53 | 50S ribosomal protein L9 | 4.92e-10 | 3.17e-08 | NA | 0.5617 |
| 2. PF | Q606I1 | 50S ribosomal protein L9 | 1.79e-11 | 2.37e-34 | NA | 0.5884 |
| 2. PF | Q65VD1 | 50S ribosomal protein L9 | 1.81e-13 | 1.12e-35 | NA | 0.5457 |
| 2. PF | A1T041 | 50S ribosomal protein L9 | 1.07e-12 | 1.04e-31 | NA | 0.5878 |
| 2. PF | B8F5T4 | 50S ribosomal protein L9 | 2.77e-13 | 2.61e-35 | NA | 0.5108 |
| 2. PF | A1U390 | 50S ribosomal protein L9 | 3.22e-11 | 2.46e-34 | NA | 0.5475 |
| 3. BF | A5EI95 | 50S ribosomal protein L9 | 3.44e-10 | NA | 4.31e-04 | 0.5491 |
| 3. BF | P82180 | 50S ribosomal protein L9, chloroplastic | 0.00e+00 | NA | 2.13e-08 | 0.8708 |
| 3. BF | B9KHP7 | 50S ribosomal protein L9 | 3.82e-13 | NA | 3.91e-06 | 0.7736 |
| 3. BF | A5V2E0 | 50S ribosomal protein L9 | 6.17e-10 | NA | 9.90e-08 | 0.552 |
| 3. BF | Q2IX94 | 50S ribosomal protein L9 | 2.97e-10 | NA | 2.04e-06 | 0.5488 |
| 3. BF | Q1GRV8 | 50S ribosomal protein L9 | 4.02e-11 | NA | 2.70e-05 | 0.5751 |
| 3. BF | Q2GHF2 | 50S ribosomal protein L9 | 1.26e-12 | NA | 1.34e-04 | 0.7238 |
| 3. BF | B9JUT9 | 50S ribosomal protein L9 | 1.09e-08 | NA | 4.10e-05 | 0.5707 |
| 3. BF | Q89MW6 | 50S ribosomal protein L9 | 6.26e-10 | NA | 6.32e-06 | 0.5446 |
| 3. BF | Q1GHU0 | 50S ribosomal protein L9 | 2.05e-10 | NA | 3.13e-06 | 0.5568 |
| 3. BF | Q1QKP2 | 50S ribosomal protein L9 | 5.21e-10 | NA | 0.007 | 0.5493 |
| 3. BF | P11894 | 50S ribosomal protein L9, chloroplastic | 0.00e+00 | NA | 5.59e-08 | 0.9018 |
| 3. BF | B6JGW6 | 50S ribosomal protein L9 | 5.83e-10 | NA | 1.38e-04 | 0.5457 |
| 3. BF | Q3SRY6 | 50S ribosomal protein L9 | 5.00e-10 | NA | 0.002 | 0.5495 |
| 3. BF | Q2GLH4 | 50S ribosomal protein L9 | 7.22e-15 | NA | 1.99e-06 | 0.8246 |
| 3. BF | A8LQQ7 | 50S ribosomal protein L9 | 2.30e-10 | NA | 1.38e-05 | 0.6299 |
| 3. BF | Q6YRK2 | 50S ribosomal protein L9 | 2.60e-06 | NA | 1.30e-10 | 0.874 |
| 3. BF | A7HYI4 | 50S ribosomal protein L9 | 1.67e-11 | NA | 1.68e-07 | 0.5397 |
| 3. BF | Q28RX5 | 50S ribosomal protein L9 | 4.97e-10 | NA | 5.73e-05 | 0.5601 |
| 3. BF | Q3YRD0 | 50S ribosomal protein L9 | 2.29e-12 | NA | 2.16e-04 | 0.7062 |
| 3. BF | Q0AQD4 | 50S ribosomal protein L9 | 2.41e-09 | NA | 0.023 | 0.5534 |
| 3. BF | Q215T9 | 50S ribosomal protein L9 | 5.31e-10 | NA | 1.41e-07 | 0.5502 |
| 3. BF | Q5PBM9 | 50S ribosomal protein L9 | 2.22e-13 | NA | 2.71e-06 | 0.7795 |
| 3. BF | Q73M35 | 50S ribosomal protein L9 | 5.55e-14 | NA | 1.18e-09 | 0.6302 |
| 3. BF | Q5LR48 | 50S ribosomal protein L9 | 3.75e-10 | NA | 9.13e-08 | 0.5723 |
| 3. BF | Q8L803 | 50S ribosomal protein L9, chloroplastic | 0.00e+00 | NA | 1.26e-07 | 0.8721 |
| 3. BF | Q5NN59 | 50S ribosomal protein L9 | 2.00e-10 | NA | 8.65e-05 | 0.5472 |
| 3. BF | Q2RXC9 | 50S ribosomal protein L9 | 4.36e-10 | NA | 5.51e-06 | 0.5466 |
| 3. BF | Q5FG29 | 50S ribosomal protein L9 | 3.30e-13 | NA | 7.14e-04 | 0.757 |
| 3. BF | Q5HAJ6 | 50S ribosomal protein L9 | 2.35e-13 | NA | 7.14e-04 | 0.7676 |
| 3. BF | Q6G449 | 50S ribosomal protein L9 | 7.23e-10 | NA | 5.79e-04 | 0.5449 |
| 3. BF | A4YT74 | 50S ribosomal protein L9 | 5.85e-10 | NA | 1.28e-04 | 0.5522 |
| 3. BF | Q6JJ61 | 50S ribosomal protein L9, chloroplastic | 0.00e+00 | NA | 5.12e-10 | 0.8931 |
| 3. BF | Q2NKC0 | 50S ribosomal protein L9 | 2.27e-05 | NA | 9.88e-09 | 0.8097 |
| 3. BF | Q164N5 | 50S ribosomal protein L9 | 1.93e-11 | NA | 3.98e-08 | 0.4439 |
| 4. PB | Q2G2T3 | 50S ribosomal protein L9 | 0.00e+00 | 1.13e-31 | 7.52e-11 | NA |
| 4. PB | P0A7R1 | 50S ribosomal protein L9 | 1.15e-13 | 2.19e-29 | 7.01e-06 | NA |
| 4. PB | P9WH79 | 50S ribosomal protein L9 | 8.70e-11 | 4.05e-34 | 1.21e-13 | NA |
| 6. F | A9X1A9 | 39S ribosomal protein L9, mitochondrial | 2.94e-08 | NA | NA | 0.4826 |
| 6. F | Q2TBK2 | 39S ribosomal protein L9, mitochondrial | 2.54e-08 | NA | NA | 0.4989 |
| 7. B | P25864 | 50S ribosomal protein L9, chloroplastic | 1.11e-16 | NA | 3.89e-08 | NA |