Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX54994.1
JCVISYN3A_0834
Replicative DNA helicase.
M. mycoides homolog: Q6MS26.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 74
Unique PROST Go: 30
Unique BLAST Go: 4
Unique Foldseek Go: 24
Total Homologs: 925
Unique PROST Homologs: 22
Unique BLAST Homologs: 3
Unique Foldseek Homologs: 858
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q46437
(Probable plasmid replicative DNA helicase) with a FATCAT P-Value: 0 and RMSD of 2.56 angstrom. The sequence alignment identity is 32.3%.
Structural alignment shown in left. Query protein AVX54994.1 colored as red in alignment, homolog Q46437 colored as blue.
Query protein AVX54994.1 is also shown in right top, homolog Q46437 showed in right bottom. They are colored based on secondary structures.
AVX54994.1 MK--QEL--TVAELLYAERFVLGVAMSFSNALADIVSVLKVD-DFSIPANKYIYQAII--DLNNKNKSISPISV------I--NRLEAINKLEQVGGDVV 85 Q46437 MKTNSEIENRMQDIEYA---LLGKALVFEDCTEYILRQL-VNYEFKCSRHKNIF--IVFKHL--KDNAL-PITVDSAWEELLRRRVKDIDK-SYLG--IM 88 AVX54994.1 VYEIAAENYTDQGLEEYIDIIHKAGVIRKLDIVIKELEI---KRNNSN------TDVDE-LLKVAQTKLLD-----IDLSI-KRFEIEPI-G----EVAK 164 Q46437 LHD-AM--FNDK-LR---PISHT--VL--LD----DLSVCSAEENLTNFIFRSFNEYNENPLRRSPFLLLDRIKDRLDRTIAKTFSTRSVRGRSVYDIFS 173 AVX54994.1 R----VVEKIKEL-----EMKAEIISGVPTGYNYLD----LVTSGWQESDFIILAARPSVGKTAFSLNLAFNAAM-QKYPVAFFSLEMPAEQLTQRLFTR 250 Q46437 QAELGVLARIKKRRAAYSENNDSFYDGLPTGYQDIDSKGVILANG----NFVIIAARPSIGKTALAIDIAINIAIHQRRRVGFLSLEMSAGQIVERIISN 269 AVX54994.1 LTSVDSTNLRTGKGLSKQNWEKI-QI--AKEKLEEIPIYI--DATPGIS--TQEIRSKLYKMKRDHNIKLCVIDYLQLI---VGSQNKDRQNEVSEISRQ 340 Q46437 LTGVSGEKLQRG-SLSE---EEIFCIEEAGNTIRDSHLYICSDNQYKLNLIANQIR--L--LKRDDRVDVIFIDYLQLINSSVG-EN--RQNEIADISRT 358 AVX54994.1 LKQIARETSIPIICLSQLSRRAETREDKRPMLSDLRDSGAIEQDADIVAFLYRDDYYKKDLTDLDKEKTELILAKHRNGATGTVLLRFIKD-----FGVF 435 Q46437 LRGLAAELNIPIVCLSQLSRKVEDRANKVPMLSDLRDSGQIEQDADVILFINR-----KE-TS---PNCEITVGKNRHGSVFSTVLQF--DPKTSKFSAI 447 AVX54994.1 RD-W 438 Q46437 KKVW 451
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0140603 | obsolete ATP hydrolysis activity |
1. PBF | GO:0006268 | DNA unwinding involved in DNA replication |
1. PBF | GO:0016539 | intein-mediated protein splicing |
1. PBF | GO:0003678 | DNA helicase activity |
1. PBF | GO:1990077 | primosome complex |
1. PBF | GO:0005524 | ATP binding |
1. PBF | GO:0006269 | DNA replication, synthesis of RNA primer |
2. PF | GO:0008094 | ATP-dependent activity, acting on DNA |
2. PF | GO:0003697 | single-stranded DNA binding |
2. PF | GO:0006281 | DNA repair |
2. PF | GO:0016787 | hydrolase activity |
2. PF | GO:0003684 | damaged DNA binding |
3. BF | GO:0006314 | intron homing |
4. PB | GO:0039686 | bidirectional double-stranded viral DNA replication |
4. PB | GO:0003677 | DNA binding |
4. PB | GO:0017116 | single-stranded DNA helicase activity |
5. P | GO:0006312 | mitotic recombination |
5. P | GO:0006353 | DNA-templated transcription, termination |
5. P | GO:0000724 | double-strand break repair via homologous recombination |
5. P | GO:1905334 | Swi5-Sfr1 complex binding |
5. P | GO:0004386 | helicase activity |
5. P | GO:0006311 | meiotic gene conversion |
5. P | GO:0003690 | double-stranded DNA binding |
5. P | GO:0043504 | mitochondrial DNA repair |
5. P | GO:0007130 | synaptonemal complex assembly |
5. P | GO:0033065 | Rad51C-XRCC3 complex |
5. P | GO:0005657 | replication fork |
5. P | GO:0070192 | chromosome organization involved in meiotic cell cycle |
5. P | GO:0007131 | reciprocal meiotic recombination |
5. P | GO:0000707 | meiotic DNA recombinase assembly |
5. P | GO:0006259 | DNA metabolic process |
5. P | GO:0000150 | DNA strand exchange activity |
5. P | GO:0045003 | double-strand break repair via synthesis-dependent strand annealing |
5. P | GO:0000709 | meiotic joint molecule formation |
5. P | GO:0042148 | strand invasion |
5. P | GO:0006302 | double-strand break repair |
5. P | GO:0010332 | response to gamma radiation |
5. P | GO:0000730 | DNA recombinase assembly |
5. P | GO:0033063 | Rad51B-Rad51C-Rad51D-XRCC2 complex |
5. P | GO:0000794 | condensed nuclear chromosome |
5. P | GO:0051026 | chiasma assembly |
5. P | GO:0030491 | heteroduplex formation |
5. P | GO:0008186 | ATP-dependent activity, acting on RNA |
5. P | GO:0010774 | meiotic strand invasion involved in reciprocal meiotic recombination |
5. P | GO:1990426 | mitotic recombination-dependent replication fork processing |
5. P | GO:0000722 | telomere maintenance via recombination |
6. F | GO:0005886 | plasma membrane |
6. F | GO:0009535 | chloroplast thylakoid membrane |
6. F | GO:0005829 | cytosol |
6. F | GO:0007623 | circadian rhythm |
6. F | GO:0046961 | proton-transporting ATPase activity, rotational mechanism |
6. F | GO:0015986 | ATP synthesis coupled proton transport |
6. F | GO:0005739 | mitochondrion |
6. F | GO:0045261 | proton-transporting ATP synthase complex, catalytic core F(1) |
6. F | GO:0046872 | metal ion binding |
6. F | GO:0031676 | plasma membrane-derived thylakoid membrane |
6. F | GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism |
6. F | GO:0046932 | sodium-transporting ATP synthase activity, rotational mechanism |
6. F | GO:0042170 | plastid membrane |
6. F | GO:0070297 | regulation of phosphorelay signal transduction system |
6. F | GO:0006310 | DNA recombination |
6. F | GO:0000287 | magnesium ion binding |
6. F | GO:0000725 | recombinational repair |
6. F | GO:0043531 | ADP binding |
6. F | GO:0045262 | plasma membrane proton-transporting ATP synthase complex, catalytic core F(1) |
6. F | GO:0042752 | regulation of circadian rhythm |
6. F | GO:0009432 | SOS response |
6. F | GO:0046962 | sodium-transporting ATPase activity, rotational mechanism |
6. F | GO:0045260 | plasma membrane proton-transporting ATP synthase complex |
6. F | GO:0004712 | protein serine/threonine/tyrosine kinase activity |
7. B | GO:0003896 | DNA primase activity |
7. B | GO:0039693 | viral DNA genome replication |
7. B | GO:0004519 | endonuclease activity |
7. B | GO:0010212 | response to ionizing radiation |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0003677 | DNA binding |
GO:0006260 | DNA replication |
GO:0004386 | helicase activity |
GO:0032508 | DNA duplex unwinding |
GO:0003678 | DNA helicase activity |
GO:1990077 | primosome complex |
GO:0016887 | ATP hydrolysis activity |
GO:0005524 | ATP binding |
GO:0016787 | hydrolase activity |
GO:0006269 | DNA replication, synthesis of RNA primer |
GO:0000166 | nucleotide binding |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | Q9ZJM5 | Replicative DNA helicase | 0.00e+00 | 3.31e-42 | 1.32e-64 | 0.7492 |
1. PBF | Q8K932 | Replicative DNA helicase | 0.00e+00 | 5.30e-74 | 6.22e-72 | 0.7487 |
1. PBF | O78411 | Probable replicative DNA helicase | 9.35e-13 | 2.62e-04 | 1.85e-44 | 0.81 |
1. PBF | P37469 | Replicative DNA helicase | 0.00e+00 | 1.72e-74 | 3.23e-101 | 0.7109 |
1. PBF | Q46259 | Probable plasmid replicative DNA helicase | 0.00e+00 | 9.04e-72 | 1.12e-57 | 0.679 |
1. PBF | O83097 | Replicative DNA helicase | 0.00e+00 | 2.78e-63 | 4.65e-62 | 0.7233 |
1. PBF | P0ACB1 | Replicative DNA helicase | 0.00e+00 | 1.70e-70 | 3.61e-82 | 0.8154 |
1. PBF | P45256 | Replicative DNA helicase | 0.00e+00 | 1.84e-77 | 1.80e-68 | 0.7253 |
1. PBF | P0A1Q4 | Replicative DNA helicase | 0.00e+00 | 1.81e-70 | 2.30e-81 | 0.7325 |
1. PBF | P46394 | Replicative DNA helicase | 3.33e-16 | 3.37e-27 | 2.59e-41 | 0.6962 |
1. PBF | Q68WJ2 | Replicative DNA helicase | 0.00e+00 | 1.88e-61 | 2.62e-75 | 0.795 |
1. PBF | Q89A52 | Replicative DNA helicase | 0.00e+00 | 5.90e-76 | 2.69e-70 | 0.7563 |
1. PBF | Q9ZD08 | Replicative DNA helicase | 0.00e+00 | 5.26e-65 | 2.50e-75 | 0.7848 |
1. PBF | O25916 | Replicative DNA helicase | 0.00e+00 | 4.01e-40 | 9.99e-65 | 0.8437 |
1. PBF | Q92HG8 | Replicative DNA helicase | 0.00e+00 | 2.83e-62 | 9.96e-78 | 0.7704 |
1. PBF | Q6ABX1 | Replicative DNA helicase | 0.00e+00 | 5.69e-64 | 1.13e-73 | 0.6786 |
1. PBF | P0CE16 | Probable plasmid replicative DNA helicase | 0.00e+00 | 8.97e-62 | 8.85e-50 | 0.6253 |
1. PBF | Q1RI04 | Replicative DNA helicase | 0.00e+00 | 1.40e-61 | 2.71e-73 | 0.7872 |
1. PBF | Q8FB22 | Replicative DNA helicase | 0.00e+00 | 1.24e-70 | 3.50e-82 | 0.854 |
1. PBF | P49519 | Probable replicative DNA helicase | 0.00e+00 | 2.49e-71 | 3.34e-83 | 0.7319 |
1. PBF | P75539 | Replicative DNA helicase | 0.00e+00 | 6.61e-64 | 2.33e-50 | 0.627 |
1. PBF | Q1XDF3 | Probable replicative DNA helicase | 7.88e-15 | 8.25e-04 | 2.94e-44 | 0.8618 |
1. PBF | Q9CNL6 | Replicative DNA helicase | 0.00e+00 | 2.54e-72 | 9.11e-78 | 0.7439 |
1. PBF | P47340 | Replicative DNA helicase | 0.00e+00 | 1.15e-68 | 3.79e-54 | 0.6552 |
1. PBF | Q4UL62 | Replicative DNA helicase | 0.00e+00 | 6.81e-64 | 7.63e-77 | 0.7922 |
1. PBF | Q8X5V3 | Replicative DNA helicase | 0.00e+00 | 8.79e-71 | 2.88e-82 | 0.8604 |
1. PBF | Q46437 | Probable plasmid replicative DNA helicase | 0.00e+00 | 8.97e-62 | 3.26e-45 | 0.6498 |
1. PBF | P57611 | Replicative DNA helicase | 0.00e+00 | 5.38e-79 | 1.80e-73 | 0.766 |
1. PBF | P51333 | Probable replicative DNA helicase | 1.39e-13 | 1.11e-05 | 1.06e-44 | 0.711 |
1. PBF | P0A1Q5 | Replicative DNA helicase | 0.00e+00 | 1.81e-70 | 2.30e-81 | 0.851 |
1. PBF | B0BCM3 | Probable plasmid replicative DNA helicase | 0.00e+00 | 8.97e-62 | 8.85e-50 | 0.6548 |
2. PF | O31905 | SPbeta prophage-derived uncharacterized protein YorI | 5.77e-14 | 1.38e-31 | NA | 0.5481 |
3. BF | P59966 | Replicative DNA helicase | 2.74e-10 | NA | 2.71e-54 | 0.6753 |
3. BF | Q9F5P4 | Replicative DNA helicase (Fragment) | 8.67e-07 | NA | 4.29e-44 | 0.9378 |
3. BF | O30477 | Replicative DNA helicase | 3.64e-09 | NA | 7.32e-63 | 0.7335 |
3. BF | P9WMR2 | Replicative DNA helicase | 6.91e-12 | NA | 2.71e-54 | 0.6518 |
3. BF | Q8YZA1 | Replicative DNA helicase | 3.85e-12 | NA | 2.18e-61 | 0.6144 |
3. BF | Q55418 | Replicative DNA helicase | 2.18e-13 | NA | 1.05e-57 | 0.6124 |
4. PB | P0ACB0 | Replicative DNA helicase | 0.00e+00 | 1.70e-70 | 3.61e-82 | NA |
4. PB | P20315 | DNA helicase/primase | NA | 2.34e-03 | 0.047 | NA |
4. PB | P04530 | DnaB-like replicative helicase | NA | 1.77e-20 | 0.005 | NA |
4. PB | P03006 | Replicative DNA helicase | NA | 2.45e-46 | 6.33e-41 | NA |
5. P | P25454 | DNA repair protein RAD51 | 8.31e-06 | 4.39e-03 | NA | NA |
5. P | Q7EAG4 | Meiotic recombination protein DMC1 homolog B | 2.35e-06 | 1.12e-02 | NA | NA |
5. P | Q1ZXF0 | Probable DNA repair protein RAD51 homolog 4 | 4.59e-05 | 1.93e-03 | NA | NA |
5. P | Q96449 | Meiotic recombination protein DMC1 homolog | 6.84e-06 | 1.78e-03 | NA | NA |
5. P | Q8GXF0 | DNA repair protein RAD51 homolog 3 | 1.56e-05 | 1.64e-03 | NA | NA |
5. P | Q8ZYR9 | DNA repair and recombination protein RadA | 8.24e-07 | 4.68e-02 | NA | NA |
5. P | Q7GBF8 | Meiotic recombination protein DMC1 homolog A | 6.54e-06 | 7.38e-03 | NA | NA |
5. P | P37384 | Meiotic recombination protein DMC1 homolog | 2.49e-06 | 4.75e-03 | NA | NA |
5. P | P94102 | DNA repair protein RAD51 homolog 1 | 3.75e-06 | 2.29e-03 | NA | NA |
5. P | Q39009 | Meiotic recombination protein DMC1 homolog | 5.52e-06 | 1.21e-03 | NA | NA |
5. P | Q7GBF7 | Meiotic recombination protein DMC1 homolog B | 3.50e-06 | 1.12e-02 | NA | NA |
5. P | B8BM09 | Meiotic recombination protein DMC1 homolog A | 4.25e-06 | 6.25e-03 | NA | NA |
5. P | P0AG32 | Transcription termination factor Rho | 2.38e-02 | 4.51e-02 | NA | NA |
5. P | Q7UGV0 | Transcription termination factor Rho | 1.65e-02 | 4.68e-02 | NA | NA |
5. P | Q7NXP1 | Transcription termination factor Rho | 2.32e-02 | 4.27e-02 | NA | NA |
5. P | P0AG30 | Transcription termination factor Rho | 2.39e-02 | 4.51e-02 | NA | NA |
5. P | Q49593 | DNA repair and recombination protein RadA | 5.77e-06 | 3.65e-02 | NA | NA |
5. P | P0AG31 | Transcription termination factor Rho | 2.37e-02 | 4.51e-02 | NA | NA |
5. P | Q06447 | Transcription termination factor Rho | 2.17e-02 | 1.41e-02 | NA | NA |
5. P | P0AG33 | Transcription termination factor Rho | 2.36e-02 | 4.51e-02 | NA | NA |
5. P | O42634 | Meiotic recombination protein dmc1 | 4.75e-06 | 4.77e-02 | NA | NA |
5. P | A4WN87 | DNA repair and recombination protein RadA | 8.32e-07 | 4.60e-02 | NA | NA |
6. F | Q2P7Q6 | ATP synthase subunit alpha | 2.75e-01 | NA | NA | 0.4759 |
6. F | A1XFU0 | ATP synthase subunit alpha, chloroplastic | 3.34e-01 | NA | NA | 0.4897 |
6. F | A0LLG0 | ATP synthase subunit alpha | 7.48e-02 | NA | NA | 0.4913 |
6. F | C1CMP5 | Protein RecA | 4.38e-07 | NA | NA | 0.4955 |
6. F | P62209 | Protein RecA | 3.65e-07 | NA | NA | 0.5234 |
6. F | B5RLK6 | Protein RecA | 8.42e-08 | NA | NA | 0.4873 |
6. F | Q0TPT0 | Protein RecA | 2.64e-07 | NA | NA | 0.5363 |
6. F | Q5F4Z2 | ATP synthase subunit alpha | 1.41e-01 | NA | NA | 0.4597 |
6. F | Q3YQT7 | Protein RecA | 1.37e-07 | NA | NA | 0.5232 |
6. F | Q6L8L5 | Circadian clock protein kinase KaiC | 1.08e-04 | NA | NA | 0.6225 |
6. F | Q1RJR7 | DNA repair protein RadA | 8.55e-09 | NA | NA | 0.6088 |
6. F | B2FHZ0 | ATP synthase subunit alpha | 2.50e-01 | NA | NA | 0.4865 |
6. F | P0DD78 | DNA repair protein RadA | 7.30e-09 | NA | NA | 0.6255 |
6. F | C6E6X6 | Protein RecA | 2.13e-06 | NA | NA | 0.5539 |
6. F | P12405 | ATP synthase subunit alpha | 1.29e-01 | NA | NA | 0.5209 |
6. F | P0A0W5 | Protein RecA | 2.55e-07 | NA | NA | 0.5349 |
6. F | B0YPM5 | ATP synthase subunit alpha, plastid | 1.46e-01 | NA | NA | 0.498 |
6. F | A8HAG5 | ATP synthase subunit alpha | 2.17e-01 | NA | NA | 0.4733 |
6. F | Q7UH05 | ATP synthase subunit alpha 1 | 2.24e-01 | NA | NA | 0.4936 |
6. F | Q8KAW8 | ATP synthase subunit alpha | 1.57e-01 | NA | NA | 0.4677 |
6. F | A7NN87 | Protein RecA | 3.33e-05 | NA | NA | 0.5426 |
6. F | A6W841 | Protein RecA | 2.41e-07 | NA | NA | 0.5467 |
6. F | Q8FPD3 | Protein RecA | 2.18e-07 | NA | NA | 0.5256 |
6. F | Q4QN62 | ATP synthase subunit alpha | 2.38e-01 | NA | NA | 0.4772 |
6. F | C4LDW2 | ATP synthase subunit alpha | 2.00e-01 | NA | NA | 0.48 |
6. F | Q7VIH2 | Protein RecA | 2.37e-07 | NA | NA | 0.5294 |
6. F | A9AVV2 | ATP synthase subunit alpha | 1.68e-01 | NA | NA | 0.4964 |
6. F | B5BIN8 | ATP synthase subunit alpha | 1.66e-01 | NA | NA | 0.4828 |
6. F | Q8TZ97 | UPF0273 protein MK0039 | 2.26e-10 | NA | NA | 0.6417 |
6. F | Q9PE83 | ATP synthase subunit alpha | 2.04e-01 | NA | NA | 0.479 |
6. F | A5UQN5 | ATP synthase subunit alpha | 1.48e-01 | NA | NA | 0.4943 |
6. F | Q3KH38 | Protein RecA | 3.17e-07 | NA | NA | 0.5253 |
6. F | Q9AGW0 | Protein RecA | 2.06e-06 | NA | NA | 0.4897 |
6. F | B1LBC1 | ATP synthase subunit alpha | 1.44e-01 | NA | NA | 0.5226 |
6. F | Q1GXM8 | ATP synthase subunit alpha | 2.48e-01 | NA | NA | 0.4926 |
6. F | C5CNB3 | ATP synthase subunit alpha | 2.25e-01 | NA | NA | 0.4753 |
6. F | A5CVI8 | ATP synthase subunit alpha | 2.04e-01 | NA | NA | 0.4754 |
6. F | Q09FX6 | ATP synthase subunit alpha, chloroplastic | 1.43e-01 | NA | NA | 0.4847 |
6. F | Q6KCK3 | Protein RecA | 3.73e-07 | NA | NA | 0.5503 |
6. F | A5WBV9 | ATP synthase subunit alpha | 2.66e-01 | NA | NA | 0.4809 |
6. F | Q5ZUJ7 | Protein RecA | 5.31e-07 | NA | NA | 0.5535 |
6. F | P41054 | Protein RecA | 4.13e-06 | NA | NA | 0.5258 |
6. F | P65981 | Protein RecA | 7.17e-07 | NA | NA | 0.5246 |
6. F | A4GYP3 | ATP synthase subunit alpha, chloroplastic | 3.35e-01 | NA | NA | 0.5084 |
6. F | Q2QDA3 | ATP synthase subunit alpha, chloroplastic | 3.33e-01 | NA | NA | 0.4822 |
6. F | B0U1K8 | Protein RecA | 3.17e-07 | NA | NA | 0.5267 |
6. F | Q88BX2 | ATP synthase subunit alpha | 1.73e-01 | NA | NA | 0.4797 |
6. F | P12985 | ATP synthase subunit alpha | 1.85e-01 | NA | NA | 0.4792 |
6. F | P47641 | ATP synthase subunit alpha | 1.91e-01 | NA | NA | 0.491 |
6. F | Q06FX6 | ATP synthase subunit alpha, chloroplastic | 3.36e-01 | NA | NA | 0.511 |
6. F | Q0VKX2 | ATP synthase subunit alpha | 2.28e-01 | NA | NA | 0.5059 |
6. F | C5CIV6 | ATP synthase subunit alpha | 2.99e-01 | NA | NA | 0.5112 |
6. F | Q8XU74 | ATP synthase subunit alpha | 2.18e-01 | NA | NA | 0.4774 |
6. F | A9BPU5 | ATP synthase subunit alpha | 2.22e-01 | NA | NA | 0.491 |
6. F | B8DRD0 | ATP synthase subunit alpha | 1.54e-01 | NA | NA | 0.4985 |
6. F | B2SQB2 | ATP synthase subunit alpha | 2.56e-01 | NA | NA | 0.4763 |
6. F | A6LQH4 | ATP synthase subunit alpha | 2.63e-01 | NA | NA | 0.5059 |
6. F | A2BYH6 | ATP synthase subunit alpha | 2.05e-01 | NA | NA | 0.4685 |
6. F | A4G8B3 | Protein RecA | 2.69e-07 | NA | NA | 0.5027 |
6. F | Q38YD9 | Protein RecA | 2.52e-06 | NA | NA | 0.5416 |
6. F | B8DYT2 | ATP synthase subunit alpha | 1.98e-01 | NA | NA | 0.5336 |
6. F | Q82XQ0 | ATP synthase subunit alpha | 2.30e-01 | NA | NA | 0.5014 |
6. F | P68846 | Protein RecA | 1.99e-07 | NA | NA | 0.5503 |
6. F | P30392 | ATP synthase subunit alpha, chloroplastic | 2.16e-01 | NA | NA | 0.5183 |
6. F | Q48BG3 | ATP synthase subunit alpha | 2.08e-01 | NA | NA | 0.4771 |
6. F | Q06H12 | ATP synthase subunit alpha, chloroplastic | 3.37e-01 | NA | NA | 0.4936 |
6. F | P00823 | ATP synthase subunit alpha, chloroplastic | 2.95e-01 | NA | NA | 0.5008 |
6. F | Q6B8Q8 | ATP synthase subunit alpha, chloroplastic | 4.57e-01 | NA | NA | 0.4875 |
6. F | B4UKF2 | ATP synthase subunit alpha | 1.22e-01 | NA | NA | 0.4607 |
6. F | Q03V27 | ATP synthase subunit alpha | 1.59e-01 | NA | NA | 0.5215 |
6. F | A4WGF3 | ATP synthase subunit alpha | 2.50e-01 | NA | NA | 0.4746 |
6. F | Q5ZIW1 | Twinkle mtDNA helicase | 8.96e-06 | NA | NA | 0.7497 |
6. F | Q7V5S7 | ATP synthase subunit alpha | 1.81e-01 | NA | NA | 0.4857 |
6. F | A1R548 | Protein RecA | 2.67e-06 | NA | NA | 0.5453 |
6. F | P62213 | Protein RecA | 2.32e-07 | NA | NA | 0.5384 |
6. F | Q9EVV7 | Protein RecA | 2.57e-06 | NA | NA | 0.5024 |
6. F | B9JX56 | Protein RecA | 3.89e-07 | NA | NA | 0.5305 |
6. F | Q74GY2 | ATP synthase subunit alpha | 1.91e-01 | NA | NA | 0.4886 |
6. F | A0Q2Z6 | ATP synthase subunit alpha | 1.43e-01 | NA | NA | 0.5133 |
6. F | Q83CQ4 | Protein RecA | 3.70e-07 | NA | NA | 0.5474 |
6. F | A8ACN8 | ATP synthase subunit alpha | 2.26e-01 | NA | NA | 0.4813 |
6. F | B2RZJ7 | Protein RecA | 2.17e-07 | NA | NA | 0.4914 |
6. F | Q8F2J2 | ATP synthase subunit alpha | 4.53e-01 | NA | NA | 0.4879 |
6. F | A6H5F1 | ATP synthase subunit alpha, chloroplastic | 3.29e-01 | NA | NA | 0.5003 |
6. F | Q1CSD3 | ATP synthase subunit alpha | 1.52e-01 | NA | NA | 0.5025 |
6. F | Q9F672 | Protein RecA | 9.68e-08 | NA | NA | 0.4712 |
6. F | A4QL04 | ATP synthase subunit alpha, chloroplastic | 1.40e-01 | NA | NA | 0.4914 |
6. F | Q5SCX6 | ATP synthase subunit alpha, chloroplastic | 1.43e-01 | NA | NA | 0.4811 |
6. F | Q112Z6 | ATP synthase subunit alpha | 1.92e-01 | NA | NA | 0.5285 |
6. F | Q6G9S8 | Protein RecA | 2.19e-07 | NA | NA | 0.5395 |
6. F | B2HL06 | Protein RecA | 2.04e-07 | NA | NA | 0.5444 |
6. F | Q97X93 | UPF0273 protein SSO1861 | 1.94e-10 | NA | NA | 0.5871 |
6. F | Q30QP9 | ATP synthase subunit alpha | 1.04e-01 | NA | NA | 0.5081 |
6. F | A8FDG3 | Protein RecA | 2.09e-07 | NA | NA | 0.5285 |
6. F | A9AXA6 | Protein RecA | 4.70e-07 | NA | NA | 0.5257 |
6. F | A2SC68 | ATP synthase subunit alpha | 2.50e-01 | NA | NA | 0.4748 |
6. F | A7FPE2 | ATP synthase subunit alpha | 2.11e-01 | NA | NA | 0.4832 |
6. F | A6YG64 | ATP synthase subunit alpha, chloroplastic | 2.11e-01 | NA | NA | 0.5231 |
6. F | P68843 | Protein RecA | 1.99e-07 | NA | NA | 0.5335 |
6. F | Q4L5Y8 | Protein RecA | 3.46e-05 | NA | NA | 0.5545 |
6. F | B6JMX4 | ATP synthase subunit alpha | 2.19e-01 | NA | NA | 0.4898 |
6. F | B9K7N7 | Protein RecA | 2.38e-06 | NA | NA | 0.5283 |
6. F | A5UGZ1 | ATP synthase subunit alpha | 2.43e-01 | NA | NA | 0.4752 |
6. F | Q9PR61 | Protein RecA | 3.00e-09 | NA | NA | 0.5066 |
6. F | Q8WI30 | ATP synthase subunit alpha, chloroplastic | 3.42e-01 | NA | NA | 0.4764 |
6. F | Q70XV0 | ATP synthase subunit alpha, chloroplastic | 3.31e-01 | NA | NA | 0.4816 |
6. F | Q4UQF2 | ATP synthase subunit alpha | 2.78e-01 | NA | NA | 0.4883 |
6. F | Q1CCH3 | ATP synthase subunit alpha | 2.07e-01 | NA | NA | 0.479 |
6. F | A5ILX0 | ATP synthase subunit alpha | 2.39e-01 | NA | NA | 0.5333 |
6. F | Q2A629 | Protein RecA | 5.19e-07 | NA | NA | 0.5209 |
6. F | Q5FNY6 | ATP synthase subunit alpha 2 | 1.94e-01 | NA | NA | 0.4753 |
6. F | A4VS64 | ATP synthase subunit alpha | 2.01e-01 | NA | NA | 0.4809 |
6. F | C3K1E8 | ATP synthase subunit alpha | 2.14e-01 | NA | NA | 0.4757 |
6. F | B1VDD6 | Protein RecA | 1.19e-07 | NA | NA | 0.5301 |
6. F | Q9Z7E4 | Protein RecA | 2.32e-06 | NA | NA | 0.5237 |
6. F | P58254 | Protein RecA | 4.32e-07 | NA | NA | 0.5359 |
6. F | A0LLA4 | Protein RecA | 1.99e-07 | NA | NA | 0.5484 |
6. F | B2UUP2 | ATP synthase subunit alpha | 2.94e-01 | NA | NA | 0.5024 |
6. F | B6J961 | ATP synthase subunit alpha | 2.35e-01 | NA | NA | 0.4801 |
6. F | B6J2D8 | ATP synthase subunit alpha | 2.40e-01 | NA | NA | 0.4859 |
6. F | A8G6V1 | ATP synthase subunit alpha | 2.11e-01 | NA | NA | 0.4879 |
6. F | B4RVU1 | Protein RecA | 5.14e-07 | NA | NA | 0.5114 |
6. F | P94666 | Protein RecA | 2.40e-07 | NA | NA | 0.5159 |
6. F | A6MVW4 | ATP synthase subunit alpha, chloroplastic | 1.98e-01 | NA | NA | 0.4881 |
6. F | A5IL83 | Protein RecA | 2.03e-06 | NA | NA | 0.5248 |
6. F | A0KPG3 | Protein RecA | 6.53e-07 | NA | NA | 0.508 |
6. F | Q7V037 | ATP synthase subunit alpha | 2.05e-01 | NA | NA | 0.4902 |
6. F | B2G6E3 | Protein RecA | 4.34e-07 | NA | NA | 0.5491 |
6. F | B7K5I8 | ATP synthase subunit alpha | 4.65e-01 | NA | NA | 0.5065 |
6. F | P78014 | Protein RecA | 2.90e-07 | NA | NA | 0.5368 |
6. F | P0C096 | Protein RecA | 3.58e-06 | NA | NA | 0.4854 |
6. F | Q662N0 | Protein RecA | 5.32e-06 | NA | NA | 0.4944 |
6. F | A5F457 | ATP synthase subunit alpha | 2.12e-01 | NA | NA | 0.4688 |
6. F | B0UWG7 | ATP synthase subunit alpha | 2.37e-01 | NA | NA | 0.4796 |
6. F | A9MXA8 | ATP synthase subunit alpha | 2.22e-01 | NA | NA | 0.4812 |
6. F | Q60CR6 | ATP synthase subunit alpha 1 | 2.24e-01 | NA | NA | 0.4644 |
6. F | P62216 | Protein RecA | 1.99e-07 | NA | NA | 0.5427 |
6. F | A7M8Y9 | ATP synthase subunit alpha, plastid | 3.41e-01 | NA | NA | 0.4915 |
6. F | B9DW65 | Protein RecA | 1.61e-07 | NA | NA | 0.4856 |
6. F | A4IW22 | ATP synthase subunit alpha | 2.20e-01 | NA | NA | 0.4782 |
6. F | Q9HT18 | ATP synthase subunit alpha | 1.67e-01 | NA | NA | 0.4757 |
6. F | Q87TT2 | ATP synthase subunit alpha | 1.82e-01 | NA | NA | 0.4775 |
6. F | A1K2R9 | Protein RecA | 3.35e-07 | NA | NA | 0.5092 |
6. F | P0C2Z4 | ATP synthase subunit alpha, chloroplastic | 1.42e-01 | NA | NA | 0.4935 |
6. F | A6Q4C2 | ATP synthase subunit alpha | 1.24e-01 | NA | NA | 0.5083 |
6. F | Q79V60 | Circadian clock protein kinase KaiC | 1.01e-04 | NA | NA | 0.6034 |
6. F | P0ABB3 | ATP synthase subunit alpha | 2.22e-01 | NA | NA | 0.4549 |
6. F | B2G689 | ATP synthase subunit alpha | 3.50e-01 | NA | NA | 0.4994 |
6. F | C1CLK8 | ATP synthase subunit alpha | 3.09e-01 | NA | NA | 0.5204 |
6. F | A3PS65 | ATP synthase subunit alpha 2 | 1.07e-01 | NA | NA | 0.5007 |
6. F | B7JZS9 | Protein RecA | 2.94e-07 | NA | NA | 0.5101 |
6. F | Q5HPQ6 | Protein RecA | 2.54e-07 | NA | NA | 0.5494 |
6. F | P45266 | DNA repair protein RadA | 2.46e-09 | NA | NA | 0.6167 |
6. F | A1E9S1 | ATP synthase subunit alpha, chloroplastic | 3.32e-01 | NA | NA | 0.4931 |
6. F | O51874 | ATP synthase subunit alpha | 2.45e-01 | NA | NA | 0.4738 |
6. F | Q8CXG7 | Protein RecA | 3.32e-07 | NA | NA | 0.5531 |
6. F | A7N0Y3 | ATP synthase subunit alpha 1 | 2.19e-01 | NA | NA | 0.4794 |
6. F | Q9HPF2 | DNA repair and recombination protein RadB | 1.31e-09 | NA | NA | 0.7086 |
6. F | Q1IWF2 | Protein RecA | 4.41e-07 | NA | NA | 0.5159 |
6. F | A9HY40 | ATP synthase subunit alpha | 2.57e-01 | NA | NA | 0.4795 |
6. F | Q1CV04 | Protein RecA | 2.35e-07 | NA | NA | 0.5089 |
6. F | A1RQB2 | ATP synthase subunit alpha | 2.19e-01 | NA | NA | 0.4671 |
6. F | Q0SSE7 | Protein RecA | 2.55e-07 | NA | NA | 0.514 |
6. F | C5BKJ7 | ATP synthase subunit alpha | 2.72e-01 | NA | NA | 0.4915 |
6. F | B4SRB0 | Protein RecA | 2.89e-07 | NA | NA | 0.5365 |
6. F | P21152 | Protein RecA | 3.36e-07 | NA | NA | 0.543 |
6. F | P95846 | Protein RecA | 4.48e-06 | NA | NA | 0.5411 |
6. F | Q2L8Z1 | ATP synthase subunit alpha, chloroplastic | 3.33e-01 | NA | NA | 0.4921 |
6. F | A4GAH1 | ATP synthase subunit alpha | 2.62e-01 | NA | NA | 0.4817 |
6. F | A0ZZ20 | ATP synthase subunit alpha, chloroplastic | 1.82e-01 | NA | NA | 0.5068 |
6. F | B8ZNU7 | Protein RecA | 5.88e-07 | NA | NA | 0.4938 |
6. F | A0A320 | ATP synthase subunit alpha, chloroplastic | 3.27e-01 | NA | NA | 0.5016 |
6. F | A3N2U6 | ATP synthase subunit alpha | 2.47e-01 | NA | NA | 0.4773 |
6. F | Q9MTL7 | ATP synthase subunit alpha, chloroplastic | 1.75e-01 | NA | NA | 0.4994 |
6. F | A5UKT8 | DNA repair and recombination protein RadB | 1.79e-10 | NA | NA | 0.6475 |
6. F | A4X4U1 | Protein RecA | 2.62e-07 | NA | NA | 0.5183 |
6. F | B1AI69 | Protein RecA | 3.25e-09 | NA | NA | 0.5252 |
6. F | P68845 | Protein RecA | 2.04e-07 | NA | NA | 0.5496 |
6. F | Q33C53 | ATP synthase subunit alpha, chloroplastic | 3.30e-01 | NA | NA | 0.5078 |
6. F | Q88UU1 | ATP synthase subunit alpha | 3.04e-01 | NA | NA | 0.5213 |
6. F | Q9WYK4 | UPF0273 protein TM_0370 | 1.32e-10 | NA | NA | 0.6742 |
6. F | Q40611 | ATP synthase subunit alpha, chloroplastic (Fragment) | 8.06e-02 | NA | NA | 0.4737 |
6. F | P0C095 | Protein RecA | 2.75e-07 | NA | NA | 0.4966 |
6. F | P0A452 | Protein RecA | 2.86e-07 | NA | NA | 0.4889 |
6. F | Q87F44 | Protein RecA | 2.97e-07 | NA | NA | 0.5273 |
6. F | A7N6Q6 | ATP synthase subunit alpha 2 | 2.08e-01 | NA | NA | 0.4741 |
6. F | P62215 | Protein RecA | 4.36e-07 | NA | NA | 0.5503 |
6. F | Q8PGG5 | ATP synthase subunit alpha | 2.51e-01 | NA | NA | 0.4783 |
6. F | B8HG89 | Protein RecA | 2.49e-07 | NA | NA | 0.5454 |
6. F | A9KK94 | ATP synthase subunit alpha | 2.69e-01 | NA | NA | 0.5234 |
6. F | Q39ZT9 | ATP synthase subunit alpha 1/3 | 1.92e-01 | NA | NA | 0.5307 |
6. F | Q6L8J9 | Circadian clock protein kinase KaiC | 9.95e-05 | NA | NA | 0.6105 |
6. F | Q32RS8 | ATP synthase subunit alpha, chloroplastic | 4.24e-01 | NA | NA | 0.5055 |
6. F | B8HPK1 | ATP synthase subunit alpha | 1.85e-01 | NA | NA | 0.5073 |
6. F | B8GRC0 | ATP synthase subunit alpha | 3.52e-01 | NA | NA | 0.4758 |
6. F | Q03QY6 | ATP synthase subunit alpha | 1.78e-01 | NA | NA | 0.5321 |
6. F | A3CXI2 | DNA repair and recombination protein RadB | 2.17e-10 | NA | NA | 0.721 |
6. F | Q5X0P1 | ATP synthase subunit alpha 2 | 2.37e-01 | NA | NA | 0.4762 |
6. F | Q2NQ88 | ATP synthase subunit alpha | 2.16e-01 | NA | NA | 0.4702 |
6. F | Q2MIB5 | ATP synthase subunit alpha, chloroplastic | 3.35e-01 | NA | NA | 0.4936 |
6. F | P62222 | Protein RecA | 8.37e-08 | NA | NA | 0.4904 |
6. F | B2SEE2 | Protein RecA | 4.88e-07 | NA | NA | 0.5156 |
6. F | Q06SI2 | ATP synthase subunit alpha, chloroplastic | 1.72e-01 | NA | NA | 0.5148 |
6. F | B5FCZ3 | ATP synthase subunit alpha | 2.07e-01 | NA | NA | 0.4804 |
6. F | Q14K08 | ATP synthase subunit alpha | 2.20e-01 | NA | NA | 0.4782 |
6. F | A0R563 | DNA repair protein RadA | 2.69e-08 | NA | NA | 0.5299 |
6. F | Q87E88 | ATP synthase subunit alpha | 2.45e-01 | NA | NA | 0.4849 |
6. F | Q5QZI4 | ATP synthase subunit alpha | 2.53e-01 | NA | NA | 0.4603 |
6. F | A9VS23 | Protein RecA | 2.86e-07 | NA | NA | 0.5447 |
6. F | B2V6N6 | ATP synthase subunit alpha | 1.97e-01 | NA | NA | 0.4768 |
6. F | A2C6X5 | ATP synthase subunit alpha | 1.82e-01 | NA | NA | 0.487 |
6. F | B1MD17 | Protein RecA | 3.07e-06 | NA | NA | 0.5255 |
6. F | A6MMJ2 | ATP synthase subunit alpha, chloroplastic | 3.29e-01 | NA | NA | 0.494 |
6. F | Q92HG1 | DNA repair protein RadA | 9.11e-09 | NA | NA | 0.6305 |
6. F | A8G1W7 | ATP synthase subunit alpha | 2.19e-01 | NA | NA | 0.4808 |
6. F | A7NEH6 | ATP synthase subunit alpha | 2.15e-01 | NA | NA | 0.4792 |
6. F | Q332Y4 | ATP synthase subunit alpha, chloroplastic | 3.31e-01 | NA | NA | 0.5004 |
6. F | O85502 | Protein RecA | 6.03e-07 | NA | NA | 0.494 |
6. F | Q9HJD3 | DNA repair and recombination protein RadB | 1.89e-10 | NA | NA | 0.6891 |
6. F | B7N2H3 | ATP synthase subunit alpha | 2.19e-01 | NA | NA | 0.47 |
6. F | Q7UZU3 | Protein RecA | 3.74e-08 | NA | NA | 0.5061 |
6. F | Q4UL56 | DNA repair protein RadA | 1.09e-08 | NA | NA | 0.6495 |
6. F | A4QJR8 | ATP synthase subunit alpha, chloroplastic | 1.84e-01 | NA | NA | 0.5033 |
6. F | Q3KL45 | Protein RecA | 2.52e-07 | NA | NA | 0.5187 |
6. F | A4QK90 | ATP synthase subunit alpha, chloroplastic | 1.38e-01 | NA | NA | 0.5026 |
6. F | A0K2Y1 | ATP synthase subunit alpha | 2.55e-01 | NA | NA | 0.4924 |
6. F | Q5M6H2 | Protein RecA | 6.49e-07 | NA | NA | 0.4922 |
6. F | P12112 | ATP synthase subunit alpha, chloroplastic | 4.57e-01 | NA | NA | 0.4961 |
6. F | Q8XG95 | ATP synthase subunit alpha | 3.28e-01 | NA | NA | 0.4835 |
6. F | Q4FQ35 | ATP synthase subunit alpha | 2.37e-01 | NA | NA | 0.4804 |
6. F | Q8GGL1 | Circadian clock protein kinase KaiC | 9.59e-05 | NA | NA | 0.6072 |
6. F | Q0K5M5 | ATP synthase subunit alpha | 2.41e-01 | NA | NA | 0.4812 |
6. F | Q1KVU0 | ATP synthase subunit alpha, chloroplastic | 3.31e-01 | NA | NA | 0.5178 |
6. F | Q1MRB9 | ATP synthase subunit alpha | 1.32e-01 | NA | NA | 0.5137 |
6. F | P33542 | Protein RecA | 5.62e-08 | NA | NA | 0.5355 |
6. F | B1NWD5 | ATP synthase subunit alpha, chloroplastic | 3.37e-01 | NA | NA | 0.4914 |
6. F | P48292 | Protein RecA 2 | 3.25e-07 | NA | NA | 0.5097 |
6. F | Q93R37 | Protein RecA | 2.74e-07 | NA | NA | 0.5348 |
6. F | A9KBF9 | ATP synthase subunit alpha | 2.31e-01 | NA | NA | 0.4697 |
6. F | C6DJH0 | ATP synthase subunit alpha | 2.11e-01 | NA | NA | 0.4831 |
6. F | A7Z4W5 | Protein RecA | 2.24e-07 | NA | NA | 0.5566 |
6. F | B5E673 | ATP synthase subunit alpha | 3.92e-01 | NA | NA | 0.5207 |
6. F | Q59560 | Protein RecA | 1.77e-07 | NA | NA | 0.5403 |
6. F | B9KEN1 | Protein RecA | 2.85e-07 | NA | NA | 0.536 |
6. F | Q68WI9 | DNA repair protein RadA | 9.32e-09 | NA | NA | 0.6431 |
6. F | B1LAG3 | Protein RecA | 2.52e-06 | NA | NA | 0.5092 |
6. F | A1XGM3 | ATP synthase subunit alpha, chloroplastic | 1.74e-01 | NA | NA | 0.5031 |
6. F | Q494C5 | ATP synthase subunit alpha | 1.99e-01 | NA | NA | 0.4717 |
6. F | B0SLE9 | Protein RecA | 7.13e-08 | NA | NA | 0.4968 |
6. F | Q0HPF9 | ATP synthase subunit alpha | 2.27e-01 | NA | NA | 0.4685 |
6. F | Q0I7R2 | ATP synthase subunit alpha | 3.35e-01 | NA | NA | 0.491 |
6. F | Q4JV77 | Protein RecA | 1.19e-07 | NA | NA | 0.5041 |
6. F | Q2RFX7 | ATP synthase subunit alpha | 1.19e-01 | NA | NA | 0.5325 |
6. F | Q0I5X1 | ATP synthase subunit alpha | 2.32e-01 | NA | NA | 0.4796 |
6. F | Q7V5W7 | Circadian clock protein kinase KaiC | 8.23e-05 | NA | NA | 0.6303 |
6. F | Q02848 | ATP synthase subunit alpha, chloroplastic | 1.87e-01 | NA | NA | 0.49 |
6. F | Q9RVC4 | DNA repair protein RadA | 1.04e-08 | NA | NA | 0.6034 |
6. F | Q9BBS3 | ATP synthase subunit alpha, chloroplastic | 3.37e-01 | NA | NA | 0.5017 |
6. F | Q02DF2 | ATP synthase subunit alpha | 2.02e-01 | NA | NA | 0.4817 |
6. F | P42441 | Protein RecA | 3.32e-07 | NA | NA | 0.5428 |
6. F | A5N3H9 | ATP synthase subunit alpha | 1.34e-01 | NA | NA | 0.5195 |
6. F | B3R0F8 | Protein RecA | 5.57e-07 | NA | NA | 0.5204 |
6. F | Q0P7V6 | Protein RecA | 2.79e-07 | NA | NA | 0.5077 |
6. F | A0JUY4 | Protein RecA | 2.14e-07 | NA | NA | 0.5472 |
6. F | Q1ACM8 | ATP synthase subunit alpha, chloroplastic | 1.86e-01 | NA | NA | 0.5022 |
6. F | Q5WVQ0 | Protein RecA | 3.62e-07 | NA | NA | 0.5536 |
6. F | B0SLC6 | ATP synthase subunit alpha | 3.32e-01 | NA | NA | 0.4738 |
6. F | Q4A8X3 | Protein RecA | 1.82e-06 | NA | NA | 0.5173 |
6. F | O52394 | Protein RecA | 3.61e-05 | NA | NA | 0.555 |
6. F | Q59486 | Protein RecA, plasmid | 1.87e-06 | NA | NA | 0.5099 |
6. F | Q7VJ23 | ATP synthase subunit alpha | 2.92e-01 | NA | NA | 0.4985 |
6. F | A6MMS9 | ATP synthase subunit alpha, chloroplastic | 3.32e-01 | NA | NA | 0.4849 |
6. F | Q724W6 | ATP synthase subunit alpha 1 | 1.81e-01 | NA | NA | 0.4947 |
6. F | Q8TZQ5 | UPF0273 protein PF1931 | 1.65e-10 | NA | NA | 0.6442 |
6. F | A7X4U5 | ATP synthase subunit alpha | 3.49e-01 | NA | NA | 0.5255 |
6. F | C1B381 | Protein RecA | 1.25e-07 | NA | NA | 0.5231 |
6. F | C1CTH6 | Protein RecA | 3.55e-07 | NA | NA | 0.4928 |
6. F | Q4G397 | ATP synthase subunit alpha, chloroplastic | 1.76e-01 | NA | NA | 0.4956 |
6. F | B2TUP1 | ATP synthase subunit alpha | 1.67e-01 | NA | NA | 0.4788 |
6. F | P0C2U4 | Protein RecA, chromosomal | 4.98e-07 | NA | NA | 0.5232 |
6. F | P26526 | ATP synthase subunit alpha, chloroplastic | 2.97e-01 | NA | NA | 0.5028 |
6. F | B7ITN1 | Protein RecA | 2.81e-07 | NA | NA | 0.5458 |
6. F | B4SJS1 | ATP synthase subunit alpha | 2.39e-01 | NA | NA | 0.4763 |
6. F | Q8MA05 | ATP synthase subunit alpha, chloroplastic | 4.19e-01 | NA | NA | 0.5052 |
6. F | Q81A16 | Protein RecA | 2.95e-07 | NA | NA | 0.5448 |
6. F | Q0BK82 | ATP synthase subunit alpha | 2.17e-01 | NA | NA | 0.481 |
6. F | B1JRN0 | ATP synthase subunit alpha | 1.74e-01 | NA | NA | 0.4703 |
6. F | Q5X9I0 | Protein RecA | 1.80e-06 | NA | NA | 0.486 |
6. F | A8SE59 | ATP synthase subunit alpha, chloroplastic | 3.34e-01 | NA | NA | 0.515 |
6. F | Q329S3 | ATP synthase subunit alpha | 2.22e-01 | NA | NA | 0.4654 |
6. F | A0KQY0 | ATP synthase subunit alpha | 2.21e-01 | NA | NA | 0.4784 |
6. F | B7J7A9 | Protein RecA | 3.85e-07 | NA | NA | 0.517 |
6. F | C0R4E1 | Protein RecA | 8.96e-08 | NA | NA | 0.4965 |
6. F | Q59717 | Protein RecA | 8.27e-08 | NA | NA | 0.5041 |
6. F | Q17YV1 | Protein RecA | 2.01e-07 | NA | NA | 0.5299 |
6. F | Q5F8M9 | Protein RecA | 4.47e-07 | NA | NA | 0.542 |
6. F | Q67NU3 | Protein RecA | 2.45e-05 | NA | NA | 0.5547 |
6. F | B0Z550 | ATP synthase subunit alpha, chloroplastic | 1.76e-01 | NA | NA | 0.4533 |
6. F | Q3K439 | ATP synthase subunit alpha | 2.11e-01 | NA | NA | 0.4881 |
6. F | A6MMA7 | ATP synthase subunit alpha, chloroplastic | 3.17e-01 | NA | NA | 0.502 |
6. F | B1KQ36 | ATP synthase subunit alpha | 2.17e-01 | NA | NA | 0.4958 |
6. F | A9BCD9 | ATP synthase subunit alpha | 1.87e-01 | NA | NA | 0.5069 |
6. F | A3QJR2 | ATP synthase subunit alpha | 2.17e-01 | NA | NA | 0.4764 |
6. F | Q48F94 | Protein RecA | 3.48e-07 | NA | NA | 0.5108 |
6. F | P33252 | ATP synthase subunit alpha | 3.46e-01 | NA | NA | 0.4898 |
6. F | Q31DL8 | ATP synthase subunit alpha | 2.21e-01 | NA | NA | 0.4703 |
6. F | A7X1S3 | Protein RecA | 2.03e-07 | NA | NA | 0.5495 |
6. F | Q8RFY0 | Protein RecA | 4.57e-07 | NA | NA | 0.5106 |
6. F | C0ZF14 | Protein RecA | 2.65e-07 | NA | NA | 0.559 |
6. F | B0TW17 | Protein RecA | 5.09e-07 | NA | NA | 0.5189 |
6. F | B0Z5D4 | ATP synthase subunit alpha, chloroplastic | 2.07e-01 | NA | NA | 0.4751 |
6. F | Q9KAA7 | Protein RecA | 2.73e-07 | NA | NA | 0.569 |
6. F | Q5HSC0 | Protein RecA | 2.93e-07 | NA | NA | 0.5128 |
6. F | Q5PKX0 | ATP synthase subunit alpha | 2.10e-01 | NA | NA | 0.4831 |
6. F | P0A0W4 | Protein RecA | 2.56e-07 | NA | NA | 0.5357 |
6. F | B7H296 | ATP synthase subunit alpha | 2.81e-01 | NA | NA | 0.4802 |
6. F | Q6GHF0 | Protein RecA | 2.03e-07 | NA | NA | 0.5497 |
6. F | B5EYZ8 | ATP synthase subunit alpha | 1.86e-01 | NA | NA | 0.4788 |
6. F | P62217 | Protein RecA | 2.60e-07 | NA | NA | 0.539 |
6. F | Q2GF90 | Protein RecA | 1.27e-07 | NA | NA | 0.5275 |
6. F | Q12U80 | DNA repair and recombination protein RadB | 1.26e-09 | NA | NA | 0.6979 |
6. F | Q3ZJ00 | ATP synthase subunit alpha, chloroplastic | 4.51e-01 | NA | NA | 0.5122 |
6. F | Q11QM8 | Protein RecA | 1.27e-07 | NA | NA | 0.5283 |
6. F | B9EBH1 | Protein RecA | 3.25e-07 | NA | NA | 0.5542 |
6. F | A8F3K0 | ATP synthase subunit alpha | 1.38e-01 | NA | NA | 0.5223 |
6. F | A7Y3A4 | ATP synthase subunit alpha, chloroplastic | 1.90e-01 | NA | NA | 0.4929 |
6. F | Q7U8R3 | Circadian clock protein kinase KaiC | 9.81e-05 | NA | NA | 0.627 |
6. F | C1CF95 | ATP synthase subunit alpha | 3.84e-01 | NA | NA | 0.5229 |
6. F | B9LCN0 | Protein RecA | 3.56e-07 | NA | NA | 0.5517 |
6. F | O28184 | DNA repair and recombination protein RadB | 4.20e-10 | NA | NA | 0.7117 |
6. F | A7FQH7 | ATP synthase subunit alpha | 1.28e-01 | NA | NA | 0.4771 |
6. F | P47581 | Protein RecA | 4.32e-07 | NA | NA | 0.5472 |
6. F | B8J437 | ATP synthase subunit alpha | 1.58e-01 | NA | NA | 0.5114 |
6. F | P74391 | DNA repair protein RadA | 5.97e-05 | NA | NA | 0.6207 |
6. F | B0SCX2 | Protein RecA | 7.23e-08 | NA | NA | 0.5109 |
6. F | Q12GQ2 | ATP synthase subunit alpha | 2.46e-01 | NA | NA | 0.4751 |
6. F | C0MAR6 | Protein RecA | 1.91e-06 | NA | NA | 0.4762 |
6. F | A8Y9G7 | ATP synthase subunit alpha, chloroplastic | 3.35e-01 | NA | NA | 0.4884 |
6. F | Q031W5 | Protein RecA | 4.16e-07 | NA | NA | 0.5178 |
6. F | Q5H4Y6 | ATP synthase subunit alpha | 2.62e-01 | NA | NA | 0.4785 |
6. F | A5EW90 | Protein RecA | 2.55e-05 | NA | NA | 0.5422 |
6. F | Q7V0C4 | Circadian clock protein kinase KaiC | 1.07e-04 | NA | NA | 0.5566 |
6. F | P42442 | Protein RecA | 1.26e-07 | NA | NA | 0.5306 |
6. F | Q9KNH3 | ATP synthase subunit alpha | 1.98e-01 | NA | NA | 0.4776 |
6. F | A1UEY3 | Protein RecA | 1.71e-07 | NA | NA | 0.5406 |
6. F | P41167 | ATP synthase subunit alpha | 2.30e-01 | NA | NA | 0.4736 |
6. F | Q04G22 | ATP synthase subunit alpha | 1.50e-01 | NA | NA | 0.5317 |
6. F | Q72SY1 | ATP synthase subunit alpha | 4.48e-01 | NA | NA | 0.4884 |
6. F | Q59180 | Protein RecA | 5.61e-06 | NA | NA | 0.4714 |
6. F | B1I8Q1 | Protein RecA | 4.02e-06 | NA | NA | 0.4886 |
6. F | Q8YT40 | Circadian clock protein kinase KaiC | 9.76e-05 | NA | NA | 0.5754 |
6. F | A3NF42 | ATP synthase subunit alpha 1 | 2.55e-01 | NA | NA | 0.4819 |
6. F | Q7VAN5 | Circadian clock protein kinase KaiC | 9.24e-05 | NA | NA | 0.6157 |
6. F | A1WXK7 | Protein RecA | 5.94e-07 | NA | NA | 0.5442 |
6. F | A1SJ61 | Protein RecA | 2.70e-06 | NA | NA | 0.5428 |
6. F | Q5XDZ7 | DNA repair protein RadA | 6.22e-09 | NA | NA | 0.6426 |
6. F | Q5JDS9 | UPF0273 protein TK1590 | 2.28e-10 | NA | NA | 0.6905 |
6. F | A2RGU8 | Protein RecA | 1.79e-06 | NA | NA | 0.4795 |
6. F | P58552 | Protein RecA | 8.38e-08 | NA | NA | 0.5324 |
6. F | B8CZ12 | ATP synthase subunit alpha | 2.32e-01 | NA | NA | 0.5197 |
6. F | Q1LHK8 | ATP synthase subunit alpha | 2.16e-01 | NA | NA | 0.4779 |
6. F | Q50329 | ATP synthase subunit alpha | 2.35e-01 | NA | NA | 0.4881 |
6. F | Q68S21 | ATP synthase subunit alpha, chloroplastic | 3.29e-01 | NA | NA | 0.5083 |
6. F | Q1I2I5 | ATP synthase subunit alpha | 1.83e-01 | NA | NA | 0.4682 |
6. F | Q2RQH9 | Protein RecA | 1.94e-07 | NA | NA | 0.5284 |
6. F | P56294 | ATP synthase subunit alpha, chloroplastic | 1.20e-01 | NA | NA | 0.524 |
6. F | A4TCL7 | Protein RecA | 1.75e-07 | NA | NA | 0.5377 |
6. F | B2RJN1 | Protein RecA | 6.83e-08 | NA | NA | 0.529 |
6. F | Q92F42 | DNA repair protein RadA | 2.84e-09 | NA | NA | 0.5887 |
6. F | B2K845 | ATP synthase subunit alpha | 2.07e-01 | NA | NA | 0.4769 |
6. F | B4TN33 | ATP synthase subunit alpha | 2.23e-01 | NA | NA | 0.4745 |
6. F | B2UGV1 | ATP synthase subunit alpha | 2.41e-01 | NA | NA | 0.4778 |
6. F | P43714 | ATP synthase subunit alpha | 2.43e-01 | NA | NA | 0.4755 |
6. F | P48291 | Protein RecA 1 | 3.19e-06 | NA | NA | 0.532 |
6. F | Q3IK48 | ATP synthase subunit alpha | 2.07e-01 | NA | NA | 0.4711 |
6. F | Q07VU2 | ATP synthase subunit alpha 2 | 2.11e-01 | NA | NA | 0.4774 |
6. F | B0SDA3 | ATP synthase subunit alpha | 2.83e-01 | NA | NA | 0.492 |
6. F | Q24MN9 | ATP synthase subunit alpha | 1.56e-01 | NA | NA | 0.5153 |
6. F | A8F2Q0 | Protein RecA | 2.23e-07 | NA | NA | 0.5198 |
6. F | Q07YM0 | ATP synthase subunit alpha 1 | 8.29e-02 | NA | NA | 0.5237 |
6. F | B5E2E0 | Protein RecA | 4.48e-07 | NA | NA | 0.493 |
6. F | B1I6J9 | ATP synthase subunit alpha | 1.74e-01 | NA | NA | 0.5093 |
6. F | P62210 | Protein RecA | 2.87e-07 | NA | NA | 0.554 |
6. F | Q15SF1 | ATP synthase subunit alpha 1 | 1.38e-01 | NA | NA | 0.4729 |
6. F | O67905 | Protein RecA | 6.62e-08 | NA | NA | 0.5513 |
6. F | O66827 | DNA repair protein RadA | 4.54e-11 | NA | NA | 0.6199 |
6. F | A4TSJ1 | ATP synthase subunit alpha | 1.50e-01 | NA | NA | 0.4679 |
6. F | B8GQV3 | Protein RecA | 3.67e-07 | NA | NA | 0.5133 |
6. F | Q71ZS2 | Protein RecA | 3.29e-07 | NA | NA | 0.554 |
6. F | A4QKR6 | ATP synthase subunit alpha, chloroplastic | 1.39e-01 | NA | NA | 0.494 |
6. F | A1EA05 | ATP synthase subunit alpha, chloroplastic | 1.86e-01 | NA | NA | 0.4944 |
6. F | P06283 | ATP synthase subunit alpha, chloroplastic | 3.33e-01 | NA | NA | 0.501 |
6. F | A5IFJ9 | ATP synthase subunit alpha 1 | 1.01e-01 | NA | NA | 0.4116 |
6. F | Q8PCZ7 | ATP synthase subunit alpha | 3.01e-01 | NA | NA | 0.4783 |
6. F | B5XZM2 | ATP synthase subunit alpha | 2.22e-01 | NA | NA | 0.4789 |
6. F | Q1MFZ8 | Protein RecA | 1.48e-06 | NA | NA | 0.5139 |
6. F | B7V793 | ATP synthase subunit alpha | 2.15e-01 | NA | NA | 0.4683 |
6. F | Q19VA5 | ATP synthase subunit alpha, chloroplastic | 1.62e-01 | NA | NA | 0.5037 |
6. F | Q1AW43 | Protein RecA | 3.23e-07 | NA | NA | 0.5614 |
6. F | Q5X4B5 | Protein RecA | 3.58e-07 | NA | NA | 0.552 |
6. F | Q8E8B8 | ATP synthase subunit alpha | 2.06e-01 | NA | NA | 0.4767 |
6. F | A9KX08 | ATP synthase subunit alpha | 2.04e-01 | NA | NA | 0.481 |
6. F | Q9PN90 | DNA repair protein RadA | 5.23e-08 | NA | NA | 0.5565 |
6. F | B8D8H1 | ATP synthase subunit alpha | 2.31e-01 | NA | NA | 0.493 |
6. F | Q8YAM8 | ATP synthase subunit alpha 1 | 2.06e-01 | NA | NA | 0.4816 |
6. F | Q49L13 | ATP synthase subunit alpha, chloroplastic | 1.81e-01 | NA | NA | 0.4814 |
6. F | Q5M106 | ATP synthase subunit alpha | 3.16e-01 | NA | NA | 0.5056 |
6. F | B2I100 | ATP synthase subunit alpha | 2.42e-01 | NA | NA | 0.48 |
6. F | B8D6S5 | ATP synthase subunit alpha | 2.28e-01 | NA | NA | 0.4922 |
6. F | Q15MU2 | ATP synthase subunit alpha 2 | 2.27e-01 | NA | NA | 0.4733 |
6. F | Q1J495 | Protein RecA | 1.59e-06 | NA | NA | 0.4859 |
6. F | Q5HGE6 | Protein RecA | 2.16e-07 | NA | NA | 0.5496 |
6. F | B6IS93 | Protein RecA | 3.22e-06 | NA | NA | 0.5252 |
6. F | Q9YBU4 | UPF0273 protein APE_1505.1 | 2.83e-10 | NA | NA | 0.6462 |
6. F | A0T0P4 | ATP synthase subunit alpha, chloroplastic | 1.77e-01 | NA | NA | 0.5157 |
6. F | B8IP29 | Protein RecA | 3.12e-07 | NA | NA | 0.5413 |
6. F | Q9X1U7 | ATP synthase subunit alpha | 2.93e-01 | NA | NA | 0.515 |
6. F | A6TK63 | ATP synthase subunit alpha | 1.15e-01 | NA | NA | 0.5223 |
6. F | A9MJR7 | ATP synthase subunit alpha | 2.21e-01 | NA | NA | 0.4726 |
6. F | Q0G9N4 | ATP synthase subunit alpha, chloroplastic | 3.35e-01 | NA | NA | 0.4904 |
6. F | A7N939 | Protein RecA | 5.55e-07 | NA | NA | 0.5207 |
6. F | A7ZTU6 | ATP synthase subunit alpha | 2.26e-01 | NA | NA | 0.4571 |
6. F | Q9ZD04 | DNA repair protein RadA | 7.53e-09 | NA | NA | 0.6476 |
6. F | Q9PLS6 | Protein RecA | 2.41e-06 | NA | NA | 0.5166 |
6. F | P56148 | DNA repair protein RadA | 4.48e-08 | NA | NA | 0.5883 |
6. F | B0KRB0 | ATP synthase subunit alpha | 1.91e-01 | NA | NA | 0.4766 |
6. F | Q0ZJ35 | ATP synthase subunit alpha, chloroplastic | 3.30e-01 | NA | NA | 0.4999 |
6. F | Q60BS8 | Protein RecA | 3.64e-07 | NA | NA | 0.5187 |
6. F | Q79PF4 | Circadian clock protein kinase KaiC | 1.12e-04 | NA | NA | 0.6014 |
6. F | Q9ZMK9 | DNA repair protein RadA | 4.56e-08 | NA | NA | 0.5851 |
6. F | B2SEX9 | ATP synthase subunit alpha | 2.22e-01 | NA | NA | 0.481 |
6. F | Q06RE6 | ATP synthase subunit alpha, chloroplastic | 4.56e-01 | NA | NA | 0.4791 |
6. F | Q5YT00 | Protein RecA | 2.94e-07 | NA | NA | 0.5191 |
6. F | B3EGP4 | Protein RecA | 1.96e-07 | NA | NA | 0.5151 |
6. F | Q06GS5 | ATP synthase subunit alpha, chloroplastic | 3.33e-01 | NA | NA | 0.4886 |
6. F | Q9TM26 | ATP synthase subunit alpha, chloroplastic | 1.96e-01 | NA | NA | 0.4994 |
6. F | A2RI85 | Protein RecA | 6.52e-07 | NA | NA | 0.5231 |
6. F | A0Q0P4 | Protein RecA | 4.03e-07 | NA | NA | 0.5485 |
6. F | B3QQT8 | Protein RecA | 2.84e-07 | NA | NA | 0.5016 |
6. F | P0C7T0 | Protein RecA | 5.97e-08 | NA | NA | 0.4899 |
6. F | Q5NIK5 | ATP synthase subunit alpha | 2.24e-01 | NA | NA | 0.4782 |
6. F | B8GAQ9 | Protein RecA | 3.38e-07 | NA | NA | 0.5465 |
6. F | A7M951 | ATP synthase subunit alpha, plastid | 3.46e-01 | NA | NA | 0.5091 |
6. F | P51242 | ATP synthase subunit alpha, chloroplastic | 1.98e-01 | NA | NA | 0.4885 |
6. F | A1SBU2 | ATP synthase subunit alpha | 2.20e-01 | NA | NA | 0.4706 |
6. F | A7I175 | ATP synthase subunit alpha | 1.17e-01 | NA | NA | 0.5191 |
6. F | B0B8M5 | Protein RecA | 2.86e-05 | NA | NA | 0.5177 |
6. F | C1D5G4 | ATP synthase subunit alpha | 1.18e-01 | NA | NA | 0.4782 |
6. F | A4Y189 | ATP synthase subunit alpha | 1.68e-01 | NA | NA | 0.4685 |
6. F | A9R5U1 | ATP synthase subunit alpha | 2.28e-01 | NA | NA | 0.4831 |
6. F | A3DAR6 | ATP synthase subunit alpha | 1.92e-01 | NA | NA | 0.481 |
6. F | A4J9A1 | ATP synthase subunit alpha | 2.87e-01 | NA | NA | 0.4682 |
6. F | Q3Z8Z4 | ATP synthase subunit alpha | 2.82e-01 | NA | NA | 0.5237 |
6. F | A2S6K0 | ATP synthase subunit alpha | 2.62e-01 | NA | NA | 0.4782 |
6. F | Q9APZ2 | Protein RecA | 2.85e-07 | NA | NA | 0.545 |
6. F | P50000 | ATP synthase subunit alpha, sodium ion specific | 2.70e-01 | NA | NA | 0.5148 |
6. F | B5Z8D2 | ATP synthase subunit alpha | 2.90e-01 | NA | NA | 0.4936 |
6. F | A7MMX1 | ATP synthase subunit alpha | 2.09e-01 | NA | NA | 0.4832 |
6. F | Q20EV9 | ATP synthase subunit alpha, chloroplastic | 2.64e-01 | NA | NA | 0.5121 |
6. F | B0RTY3 | Protein RecA | 2.52e-07 | NA | NA | 0.5281 |
6. F | B0Z4W6 | ATP synthase subunit alpha, chloroplastic | 2.07e-01 | NA | NA | 0.4523 |
6. F | A0PT89 | Protein RecA | 2.06e-07 | NA | NA | 0.5488 |
6. F | Q313V8 | ATP synthase subunit alpha | 1.54e-01 | NA | NA | 0.5238 |
6. F | A5VIW7 | Protein RecA | 4.18e-07 | NA | NA | 0.5489 |
6. F | B7I1W2 | ATP synthase subunit alpha | 2.42e-01 | NA | NA | 0.4626 |
6. F | P06450 | ATP synthase subunit alpha, chloroplastic | 3.35e-01 | NA | NA | 0.4731 |
6. F | A1VIV0 | ATP synthase subunit alpha 1 | 2.63e-01 | NA | NA | 0.4744 |
6. F | A1KUQ0 | Protein RecA | 4.83e-07 | NA | NA | 0.5429 |
6. F | Q7CPE1 | ATP synthase subunit alpha | 2.23e-01 | NA | NA | 0.481 |
6. F | P9WHJ8 | DNA repair protein RadA | 5.62e-09 | NA | NA | 0.6428 |
6. F | Q0BPA8 | Protein RecA | 5.02e-07 | NA | NA | 0.5203 |
6. F | A4FAH9 | Protein RecA | 2.68e-07 | NA | NA | 0.5301 |
6. F | Q2IHQ9 | ATP synthase subunit alpha | 1.21e-01 | NA | NA | 0.5155 |
6. F | A8FNY4 | Protein RecA | 2.51e-07 | NA | NA | 0.5171 |
6. F | Q14FH2 | ATP synthase subunit alpha, chloroplastic | 3.33e-01 | NA | NA | 0.5084 |
6. F | Q2A1I0 | ATP synthase subunit alpha | 2.17e-01 | NA | NA | 0.478 |
6. F | Q4K3A7 | ATP synthase subunit alpha | 2.03e-01 | NA | NA | 0.4757 |
6. F | P62218 | Protein RecA | 1.37e-06 | NA | NA | 0.4845 |
6. F | P52277 | Protein RecA | 2.41e-07 | NA | NA | 0.5384 |
6. F | P9WHJ2 | Protein RecA | 1.83e-03 | NA | NA | 0.5135 |
6. F | Q477Z3 | ATP synthase subunit alpha | 2.46e-01 | NA | NA | 0.4779 |
6. F | B1YMB9 | Protein RecA | 3.57e-07 | NA | NA | 0.5537 |
6. F | A0Q8E1 | ATP synthase subunit alpha | 2.19e-01 | NA | NA | 0.4799 |
6. F | A8W3A9 | ATP synthase subunit alpha, plastid | 3.37e-01 | NA | NA | 0.5172 |
6. F | Q98QB7 | ATP synthase subunit alpha 2 | 2.50e-01 | NA | NA | 0.4748 |
6. F | Q601Z7 | ATP synthase subunit alpha | 1.57e-01 | NA | NA | 0.4768 |
6. F | P77925 | Protein RecA | 6.24e-08 | NA | NA | 0.5114 |
6. F | P0CD80 | Protein RecA | 3.03e-05 | NA | NA | 0.5174 |
6. F | Q6AIZ3 | Protein RecA | 1.85e-07 | NA | NA | 0.5429 |
6. F | B0R636 | DNA repair and recombination protein RadB | 1.56e-09 | NA | NA | 0.7095 |
6. F | P65954 | DNA repair protein RadA | 2.51e-09 | NA | NA | 0.6531 |
6. F | Q7NA92 | ATP synthase subunit alpha | 1.95e-01 | NA | NA | 0.4789 |
6. F | P37572 | DNA repair protein RadA | 4.61e-09 | NA | NA | 0.556 |
6. F | A0RHF1 | Protein RecA | 3.02e-07 | NA | NA | 0.5448 |
6. F | C1C9K8 | Protein RecA | 3.39e-06 | NA | NA | 0.4797 |
6. F | Q9TL16 | ATP synthase subunit alpha, chloroplastic | 3.62e-01 | NA | NA | 0.516 |
6. F | A0L2T0 | ATP synthase subunit alpha | 2.26e-01 | NA | NA | 0.4721 |
6. F | A1E9I8 | ATP synthase subunit alpha, chloroplastic | 4.59e-01 | NA | NA | 0.4945 |
6. F | Q9JRP9 | Protein RecA | 3.06e-07 | NA | NA | 0.5106 |
6. F | Q6AE00 | Protein RecA | 3.39e-07 | NA | NA | 0.5464 |
6. F | Q39Z80 | Protein RecA | 3.40e-07 | NA | NA | 0.5281 |
6. F | B9KHJ1 | Protein RecA | 6.35e-08 | NA | NA | 0.5119 |
6. F | A6TG38 | ATP synthase subunit alpha | 2.92e-01 | NA | NA | 0.4878 |
6. F | A6Q6D3 | Protein RecA | 3.07e-07 | NA | NA | 0.5155 |
6. F | B4U0I8 | Protein RecA | 1.71e-06 | NA | NA | 0.4818 |
6. F | Q5P4E4 | ATP synthase subunit alpha | 2.57e-01 | NA | NA | 0.4827 |
6. F | Q1BA29 | Protein RecA | 1.50e-07 | NA | NA | 0.54 |
6. F | B8CVU7 | ATP synthase subunit alpha | 2.13e-01 | NA | NA | 0.4938 |
6. F | A9NBC8 | ATP synthase subunit alpha | 2.37e-01 | NA | NA | 0.48 |
6. F | Q6KHC9 | Protein RecA | 3.70e-07 | NA | NA | 0.5041 |
6. F | C1L2V4 | Protein RecA | 3.17e-07 | NA | NA | 0.5296 |
6. F | Q89B41 | ATP synthase subunit alpha | 1.48e-01 | NA | NA | 0.4683 |
6. F | B0TWS5 | ATP synthase subunit alpha | 2.12e-01 | NA | NA | 0.4782 |
6. F | Q7YJY4 | ATP synthase subunit alpha, chloroplastic | 3.29e-01 | NA | NA | 0.4943 |
6. F | Q2KU34 | ATP synthase subunit alpha | 2.29e-01 | NA | NA | 0.4694 |
6. F | P22841 | Protein RecA | 1.22e-09 | NA | NA | 0.5425 |
6. F | Q223D4 | ATP synthase subunit alpha 1 | 2.59e-01 | NA | NA | 0.4873 |
6. F | Q821E6 | Protein RecA | 2.67e-06 | NA | NA | 0.5349 |
6. F | Q6KCJ6 | Protein RecA | 2.78e-07 | NA | NA | 0.5493 |
6. F | Q45791 | Protein RecA | 1.26e-06 | NA | NA | 0.5203 |
6. F | P0A5U5 | Protein RecA | 2.48e-03 | NA | NA | 0.4923 |
6. F | Q0HD77 | ATP synthase subunit alpha | 2.27e-01 | NA | NA | 0.4767 |
6. F | A6W3T0 | ATP synthase subunit alpha 2 | 2.53e-01 | NA | NA | 0.4856 |
6. F | Q49Z52 | ATP synthase subunit alpha | 1.75e-01 | NA | NA | 0.5171 |
6. F | Q0S1P9 | Protein RecA | 1.20e-07 | NA | NA | 0.5437 |
6. F | Q5NE98 | Protein RecA | 5.76e-07 | NA | NA | 0.5209 |
6. F | C4XQT5 | Protein RecA | 1.93e-07 | NA | NA | 0.5188 |
6. F | Q3BUQ9 | Protein RecA | 2.96e-07 | NA | NA | 0.529 |
6. F | P62219 | Protein RecA | 2.94e-06 | NA | NA | 0.5459 |
6. F | Q6YXK3 | ATP synthase subunit alpha, chloroplastic | 3.40e-01 | NA | NA | 0.4895 |
6. F | P42447 | Protein RecA | 4.85e-08 | NA | NA | 0.5143 |
6. F | A8W3H5 | ATP synthase subunit alpha, plastid | 3.41e-01 | NA | NA | 0.4912 |
6. F | Q82KB1 | Protein RecA | 4.31e-06 | NA | NA | 0.5428 |
6. F | A6VL59 | ATP synthase subunit alpha | 2.31e-01 | NA | NA | 0.4846 |
6. F | C0QW65 | ATP synthase subunit alpha | 2.91e-01 | NA | NA | 0.4717 |
6. F | P48294 | Protein RecA | 4.23e-06 | NA | NA | 0.524 |
6. F | Q895I5 | Protein RecA | 4.19e-07 | NA | NA | 0.5416 |
6. F | Q3AUV9 | Protein RecA | 1.44e-07 | NA | NA | 0.5287 |
6. F | B2A3G4 | ATP synthase subunit alpha | 1.85e-01 | NA | NA | 0.4984 |
6. F | Q7WEM7 | ATP synthase subunit alpha | 2.30e-01 | NA | NA | 0.4699 |
6. F | A4QLR8 | ATP synthase subunit alpha, chloroplastic | 4.42e-01 | NA | NA | 0.5031 |
6. F | Q589B3 | ATP synthase subunit alpha, chloroplastic | 3.33e-01 | NA | NA | 0.5009 |
6. F | Q5E1N5 | ATP synthase subunit alpha | 1.68e-01 | NA | NA | 0.4773 |
6. F | B5QUS6 | ATP synthase subunit alpha | 2.23e-01 | NA | NA | 0.481 |
6. F | P74503 | KaiC-like protein 2 | 9.97e-05 | NA | NA | 0.6105 |
6. F | Q8S8Y3 | ATP synthase subunit alpha, chloroplastic | 1.76e-01 | NA | NA | 0.508 |
6. F | P42443 | Protein RecA | 4.45e-07 | NA | NA | 0.5431 |
6. F | A0AIK0 | Protein RecA | 3.21e-07 | NA | NA | 0.5535 |
6. F | Q27S65 | ATP synthase subunit alpha, chloroplastic | 3.32e-01 | NA | NA | 0.5083 |
6. F | O27728 | DNA repair and recombination protein RadB | 1.96e-10 | NA | NA | 0.6707 |
6. F | A3MQJ7 | ATP synthase subunit alpha 1 | 2.36e-01 | NA | NA | 0.4766 |
6. F | Q663Q6 | ATP synthase subunit alpha | 2.28e-01 | NA | NA | 0.4769 |
6. F | Q8D3J5 | ATP synthase subunit alpha | 2.37e-01 | NA | NA | 0.4767 |
6. F | Q6LKZ8 | ATP synthase subunit alpha 2 | 2.18e-01 | NA | NA | 0.4828 |
6. F | P27179 | ATP synthase subunit alpha | 4.61e-01 | NA | NA | 0.5135 |
6. F | P0A449 | Protein RecA | 9.18e-08 | NA | NA | 0.4946 |
6. F | Q04BJ8 | Protein RecA | 2.83e-06 | NA | NA | 0.5353 |
6. F | B8EDV2 | ATP synthase subunit alpha | 2.19e-01 | NA | NA | 0.4724 |
6. F | Q9Z689 | ATP synthase subunit alpha | 1.57e-01 | NA | NA | 0.5039 |
6. F | B4F0E5 | ATP synthase subunit alpha | 2.00e-01 | NA | NA | 0.4832 |
6. F | B8FZ36 | ATP synthase subunit alpha | 3.09e-01 | NA | NA | 0.5153 |
6. F | A3M142 | ATP synthase subunit alpha | 2.62e-01 | NA | NA | 0.48 |
6. F | Q0A8K5 | Protein RecA | 3.79e-07 | NA | NA | 0.5344 |
6. F | Q9REV6 | Protein RecA | 3.48e-07 | NA | NA | 0.54 |
6. F | Q1XDP5 | ATP synthase subunit alpha, chloroplastic | 4.57e-01 | NA | NA | 0.4699 |
6. F | Q6LLG6 | ATP synthase subunit alpha 1 | 2.05e-01 | NA | NA | 0.4766 |
6. F | A3CR02 | Protein RecA | 2.30e-06 | NA | NA | 0.4758 |
6. F | A4QL91 | ATP synthase subunit alpha, chloroplastic | 1.59e-01 | NA | NA | 0.5 |
6. F | Q0AJB2 | ATP synthase subunit alpha 1 | 2.28e-01 | NA | NA | 0.493 |
6. F | A5GV72 | ATP synthase subunit alpha | 2.06e-01 | NA | NA | 0.4494 |
6. F | Q6L8L1 | Circadian clock protein kinase KaiC | 1.12e-04 | NA | NA | 0.5639 |
6. F | A4QEW3 | Protein RecA | 1.71e-07 | NA | NA | 0.5274 |
6. F | B4RLX8 | Protein RecA | 3.78e-07 | NA | NA | 0.5548 |
6. F | B0TQF6 | ATP synthase subunit alpha | 2.16e-01 | NA | NA | 0.4839 |
6. F | Q2Y8G9 | ATP synthase subunit alpha 2 | 9.18e-02 | NA | NA | 0.4795 |
6. F | Q1Q897 | ATP synthase subunit alpha | 2.56e-01 | NA | NA | 0.4818 |
6. F | P73860 | KaiC-like protein 1 | 1.85e-04 | NA | NA | 0.6278 |
6. F | A7H019 | ATP synthase subunit alpha | 1.22e-01 | NA | NA | 0.5109 |
6. F | Q65Q05 | ATP synthase subunit alpha | 2.35e-01 | NA | NA | 0.4783 |
6. F | P62212 | Protein RecA | 1.72e-06 | NA | NA | 0.5429 |
6. F | O32377 | Protein RecA | 3.50e-07 | NA | NA | 0.537 |
6. F | B1A920 | ATP synthase subunit alpha, chloroplastic | 1.98e-01 | NA | NA | 0.4638 |
6. F | Q1C093 | ATP synthase subunit alpha | 2.08e-01 | NA | NA | 0.4811 |
6. F | A4YCI0 | ATP synthase subunit alpha | 2.16e-01 | NA | NA | 0.4777 |
6. F | P0C2Z5 | ATP synthase subunit alpha, chloroplastic | 1.56e-01 | NA | NA | 0.4931 |
6. F | B5RFW1 | ATP synthase subunit alpha | 2.11e-01 | NA | NA | 0.483 |
6. F | B5ER44 | ATP synthase subunit alpha | 1.96e-01 | NA | NA | 0.4826 |
6. F | Q5WFX1 | Protein RecA | 2.64e-07 | NA | NA | 0.5488 |
6. F | A6U1A4 | Protein RecA | 2.19e-07 | NA | NA | 0.5394 |
6. F | A7GRA9 | Protein RecA | 2.72e-07 | NA | NA | 0.5451 |
6. F | P29225 | Protein RecA | 1.68e-06 | NA | NA | 0.5368 |
6. F | B0U5A0 | ATP synthase subunit alpha | 2.10e-01 | NA | NA | 0.4876 |
6. F | P42446 | Protein RecA | 1.88e-06 | NA | NA | 0.4932 |
6. F | B0RWC4 | ATP synthase subunit alpha | 2.58e-01 | NA | NA | 0.4761 |
6. F | Q2LPL5 | Protein RecA | 2.23e-07 | NA | NA | 0.5166 |
6. F | A1V8T3 | ATP synthase subunit alpha 1 | 2.37e-01 | NA | NA | 0.486 |
6. F | P49985 | Protein RecA | 1.45e-06 | NA | NA | 0.5355 |
6. F | P42444 | Protein RecA | 3.04e-07 | NA | NA | 0.5505 |
6. F | Q1R4K0 | ATP synthase subunit alpha | 2.17e-01 | NA | NA | 0.4557 |
6. F | P48080 | ATP synthase subunit alpha, cyanelle | 1.90e-01 | NA | NA | 0.5256 |
6. F | B1Y3S9 | ATP synthase subunit alpha | 2.63e-01 | NA | NA | 0.4742 |
6. F | B5YBQ0 | ATP synthase subunit alpha | 2.16e-01 | NA | NA | 0.5211 |
6. F | Q12HP9 | ATP synthase subunit alpha | 2.20e-01 | NA | NA | 0.4675 |
6. F | Q3BP13 | ATP synthase subunit alpha | 2.56e-01 | NA | NA | 0.4763 |
6. F | Q32RL1 | ATP synthase subunit alpha, chloroplastic | 1.83e-01 | NA | NA | 0.504 |
6. F | Q6MAK5 | ATP synthase subunit alpha | 2.21e-01 | NA | NA | 0.5263 |
6. F | Q9MUT2 | ATP synthase subunit alpha, chloroplastic | 1.97e-01 | NA | NA | 0.5208 |
6. F | Q6ENW6 | ATP synthase subunit alpha, chloroplastic | 3.32e-01 | NA | NA | 0.4911 |
6. F | A0Q468 | Protein RecA | 5.08e-07 | NA | NA | 0.5211 |
6. F | Q9ZIQ0 | Protein RecA | 4.20e-07 | NA | NA | 0.523 |
6. F | B2FL31 | Protein RecA | 2.50e-07 | NA | NA | 0.5361 |
6. F | A1U7H6 | ATP synthase subunit alpha | 2.40e-01 | NA | NA | 0.4876 |
6. F | Q07405 | ATP synthase subunit alpha | 2.43e-01 | NA | NA | 0.501 |
6. F | G2JZ14 | Protein RecA | 3.25e-07 | NA | NA | 0.5539 |
6. F | P96955 | Protein RecA (Fragment) | 1.30e-09 | NA | NA | 0.5722 |
6. F | A6LJR3 | ATP synthase subunit alpha | 1.67e-01 | NA | NA | 0.5095 |
6. F | A1T7T3 | Protein RecA | 1.54e-07 | NA | NA | 0.5283 |
6. F | P34716 | Protein RecA | 1.77e-06 | NA | NA | 0.5193 |
6. F | B5FN35 | ATP synthase subunit alpha | 3.31e-01 | NA | NA | 0.4767 |
6. F | P24517 | DNA repair protein RadA | 2.96e-09 | NA | NA | 0.621 |
6. F | B6EHT9 | ATP synthase subunit alpha | 2.69e-01 | NA | NA | 0.4685 |
6. F | B4TAX4 | ATP synthase subunit alpha | 2.11e-01 | NA | NA | 0.4831 |
6. F | A2T317 | ATP synthase subunit alpha, chloroplastic | 3.44e-01 | NA | NA | 0.5006 |
6. F | A7H623 | Protein RecA | 2.88e-07 | NA | NA | 0.5186 |
6. F | B0BAA4 | Protein RecA | 3.19e-05 | NA | NA | 0.5214 |
6. F | A1VEQ5 | Protein RecA | 1.87e-07 | NA | NA | 0.5205 |
6. F | P62214 | Protein RecA | 1.96e-07 | NA | NA | 0.5139 |
6. F | Q3HKH9 | ATP synthase subunit alpha 2 | 2.25e-01 | NA | NA | 0.4974 |
6. F | Q83AF7 | ATP synthase subunit alpha | 2.38e-01 | NA | NA | 0.4684 |
6. F | Q9KGG1 | DNA repair protein RadA | 2.86e-09 | NA | NA | 0.6076 |
6. F | Q30YS6 | Protein RecA | 2.20e-07 | NA | NA | 0.5066 |
6. F | Q9PH23 | Protein RecA | 3.11e-07 | NA | NA | 0.5169 |
6. F | Q85FQ8 | ATP synthase subunit alpha, chloroplastic | 1.77e-01 | NA | NA | 0.5081 |
6. F | B0BZL2 | ATP synthase subunit alpha 1 | 2.03e-01 | NA | NA | 0.5147 |
6. F | A6WUJ2 | ATP synthase subunit alpha | 2.24e-01 | NA | NA | 0.47 |
6. F | Q31UN4 | ATP synthase subunit alpha | 2.29e-01 | NA | NA | 0.4569 |
6. F | Q17Y80 | ATP synthase subunit alpha | 1.37e-01 | NA | NA | 0.4936 |
6. F | Q5P3R8 | Protein RecA | 3.45e-07 | NA | NA | 0.4978 |
6. F | B0VBP5 | ATP synthase subunit alpha | 2.40e-01 | NA | NA | 0.4624 |
6. F | A5UA09 | ATP synthase subunit alpha | 2.52e-01 | NA | NA | 0.4753 |
6. F | Q57HX7 | ATP synthase subunit alpha | 2.34e-01 | NA | NA | 0.4811 |
6. F | Q8DDH0 | ATP synthase subunit alpha | 1.97e-01 | NA | NA | 0.4809 |
6. F | Q5ZR99 | ATP synthase subunit alpha 2 | 2.29e-01 | NA | NA | 0.4742 |
6. F | Q18BJ4 | Protein RecA | 2.71e-07 | NA | NA | 0.5333 |
6. F | Q1KXW5 | ATP synthase subunit alpha, chloroplastic | 3.32e-01 | NA | NA | 0.5087 |
6. F | A6VF34 | ATP synthase subunit alpha | 1.95e-01 | NA | NA | 0.4681 |
6. F | A9LYH0 | ATP synthase subunit alpha, chloroplastic | 1.59e-01 | NA | NA | 0.5021 |
6. F | Q8RC17 | ATP synthase subunit alpha | 1.26e-01 | NA | NA | 0.5142 |
6. F | B1AIC1 | ATP synthase subunit alpha | 2.97e-01 | NA | NA | 0.4986 |
6. F | Q2SNG7 | ATP synthase subunit alpha 1 | 9.32e-02 | NA | NA | 0.523 |
6. F | A6MM21 | ATP synthase subunit alpha, chloroplastic | 3.36e-01 | NA | NA | 0.4802 |
6. F | A6T472 | ATP synthase subunit alpha | 2.38e-01 | NA | NA | 0.4754 |
6. F | Q7M8Q1 | Protein RecA | 2.99e-07 | NA | NA | 0.5091 |
6. F | B7KKR4 | ATP synthase subunit alpha | 4.66e-01 | NA | NA | 0.5134 |
6. F | A3P0Z2 | ATP synthase subunit alpha 1 | 2.33e-01 | NA | NA | 0.4826 |
6. F | B1MW87 | ATP synthase subunit alpha | 1.70e-01 | NA | NA | 0.5188 |
6. F | A4QJI4 | ATP synthase subunit alpha, chloroplastic | 1.56e-01 | NA | NA | 0.508 |
6. F | B3PIS9 | ATP synthase subunit alpha | 3.07e-01 | NA | NA | 0.4901 |
6. F | B2TJ69 | Protein RecA | 2.78e-07 | NA | NA | 0.5238 |
6. F | B9MBA1 | ATP synthase subunit alpha | 2.61e-01 | NA | NA | 0.4921 |
6. F | C0MGB6 | Protein RecA | 4.59e-06 | NA | NA | 0.4952 |
6. F | A7HIX9 | ATP synthase subunit alpha | 1.29e-01 | NA | NA | 0.5315 |
6. F | B0JWV1 | ATP synthase subunit alpha | 2.97e-01 | NA | NA | 0.5032 |
6. F | Q03MX5 | Protein RecA | 2.13e-06 | NA | NA | 0.5028 |
6. F | Q3AU08 | Protein RecA | 2.79e-07 | NA | NA | 0.5509 |
6. F | Q6KCK0 | Protein RecA | 1.91e-07 | NA | NA | 0.5472 |
6. F | Q38WK3 | ATP synthase subunit alpha | 2.69e-01 | NA | NA | 0.5163 |
6. F | Q98NQ6 | Protein RecA | 2.07e-06 | NA | NA | 0.5266 |
6. F | A1QYT1 | Protein RecA | 7.43e-06 | NA | NA | 0.4749 |
6. F | Q63PH8 | ATP synthase subunit alpha 1 | 2.46e-01 | NA | NA | 0.4845 |
6. F | P0CZ03 | Protein RecA | 2.27e-07 | NA | NA | 0.544 |
6. F | B9DPC5 | Protein RecA | 4.42e-07 | NA | NA | 0.5494 |
6. F | P55987 | ATP synthase subunit alpha | 2.93e-01 | NA | NA | 0.4934 |
6. F | Q05358 | Protein RecA | 3.64e-07 | NA | NA | 0.5468 |
6. F | Q09G61 | ATP synthase subunit alpha, chloroplastic | 3.34e-01 | NA | NA | 0.483 |
6. F | Q8DLP3 | ATP synthase subunit alpha | 1.95e-01 | NA | NA | 0.4893 |
6. F | Q2YXN2 | Protein RecA | 1.95e-07 | NA | NA | 0.5391 |
6. F | Q4ZL22 | ATP synthase subunit alpha | 2.03e-01 | NA | NA | 0.4893 |
6. F | Q9PJ21 | ATP synthase subunit alpha | 2.79e-01 | NA | NA | 0.4786 |
6. F | Q2ST36 | ATP synthase subunit alpha | 2.02e-01 | NA | NA | 0.5028 |
6. F | B7UMJ9 | ATP synthase subunit alpha | 2.19e-01 | NA | NA | 0.4676 |
6. F | B3PPU4 | Protein RecA | 5.56e-07 | NA | NA | 0.5329 |
6. F | Q5PBT6 | Protein RecA | 7.17e-08 | NA | NA | 0.5115 |
6. F | Q7MGH8 | ATP synthase subunit alpha | 2.06e-01 | NA | NA | 0.4814 |
6. F | Q9PK96 | DNA repair protein RadA | 2.13e-09 | NA | NA | 0.6278 |
6. F | P48288 | Protein RecA | 1.54e-07 | NA | NA | 0.5354 |
6. F | Q5X2Q3 | ATP synthase subunit alpha 1 | 1.01e-01 | NA | NA | 0.446 |
6. F | Q6CYJ3 | ATP synthase subunit alpha | 2.20e-01 | NA | NA | 0.481 |
6. F | A0QIR6 | Protein RecA | 3.01e-06 | NA | NA | 0.5212 |
6. F | Q256J8 | Protein RecA | 2.29e-06 | NA | NA | 0.5307 |
6. F | A0LV04 | Protein RecA | 2.04e-07 | NA | NA | 0.5582 |
6. F | A3PYE3 | Protein RecA | 1.73e-07 | NA | NA | 0.5323 |
6. F | B0TII6 | Protein RecA | 1.95e-05 | NA | NA | 0.5436 |
6. F | A9L981 | ATP synthase subunit alpha, chloroplastic | 3.33e-01 | NA | NA | 0.494 |
6. F | A8YY72 | ATP synthase subunit alpha | 3.48e-01 | NA | NA | 0.5179 |
6. F | Q2JSW1 | ATP synthase subunit alpha | 1.42e-01 | NA | NA | 0.5357 |
6. F | Q6EW63 | ATP synthase subunit alpha, chloroplastic | 3.37e-01 | NA | NA | 0.5007 |
6. F | C4L2V3 | Protein RecA | 2.22e-07 | NA | NA | 0.5516 |
6. F | A6LM62 | Protein RecA | 2.71e-06 | NA | NA | 0.5526 |
6. F | A8EWY1 | Protein RecA | 2.71e-07 | NA | NA | 0.5052 |
6. F | Q3M9W0 | ATP synthase subunit alpha | 1.34e-01 | NA | NA | 0.5019 |
6. F | A8Z1V6 | Protein RecA | 2.25e-07 | NA | NA | 0.5492 |
6. F | Q7W3A8 | ATP synthase subunit alpha | 2.30e-01 | NA | NA | 0.4697 |
6. F | B2J058 | ATP synthase subunit alpha | 1.51e-01 | NA | NA | 0.4999 |
6. F | B7HDQ4 | Protein RecA | 2.86e-07 | NA | NA | 0.5447 |
6. F | P62211 | Protein RecA | 2.63e-07 | NA | NA | 0.553 |
6. F | Q7U8W5 | ATP synthase subunit alpha | 4.32e-01 | NA | NA | 0.4867 |
6. F | Q8XID2 | ATP synthase subunit alpha | 1.26e-01 | NA | NA | 0.5168 |
6. F | Q6L3A1 | ATP synthase subunit alpha, chloroplastic | 3.28e-01 | NA | NA | 0.4956 |
6. F | Q21Z99 | ATP synthase subunit alpha 2 | 8.77e-02 | NA | NA | 0.5348 |
6. F | C1CGM4 | Protein RecA | 3.82e-07 | NA | NA | 0.4796 |
6. F | P0DD83 | Protein RecA | 5.25e-07 | NA | NA | 0.494 |
6. F | Q09MJ3 | ATP synthase subunit alpha, chloroplastic | 2.41e-01 | NA | NA | 0.4846 |
6. F | A1W1S5 | Protein RecA | 2.71e-07 | NA | NA | 0.517 |
6. F | P48295 | Protein RecA | 3.50e-06 | NA | NA | 0.5439 |
6. F | Q8D2W7 | Protein RecA | 2.70e-06 | NA | NA | 0.5093 |
6. F | A1K1S0 | ATP synthase subunit alpha | 2.24e-01 | NA | NA | 0.4759 |
6. F | Q8ZTQ5 | UPF0273 protein PAE3143 | 5.59e-10 | NA | NA | 0.6059 |
6. F | Q8Z9S4 | ATP synthase subunit alpha | 2.10e-01 | NA | NA | 0.477 |
6. F | P35009 | ATP synthase subunit alpha, chloroplastic | 1.77e-01 | NA | NA | 0.5017 |
6. F | Q00820 | ATP synthase subunit alpha, chloroplastic | 1.68e-01 | NA | NA | 0.5092 |
6. F | O58022 | UPF0273 protein PH0284 | 1.87e-10 | NA | NA | 0.6466 |
6. F | Q2YCA5 | ATP synthase subunit alpha 1 | 1.76e-01 | NA | NA | 0.4962 |
6. F | Q2J764 | Protein RecA | 2.51e-06 | NA | NA | 0.5351 |
6. F | Q01953 | Protein RecA | 3.24e-07 | NA | NA | 0.51 |
6. F | Q13SQ0 | ATP synthase subunit alpha 2 | 2.52e-01 | NA | NA | 0.48 |
6. F | Q14FQ1 | Protein RecA | 4.75e-07 | NA | NA | 0.5208 |
6. F | P97195 | Protein RecA (Fragment) | 1.45e-09 | NA | NA | 0.5716 |
6. F | Q3C1H4 | ATP synthase subunit alpha, chloroplastic | 3.31e-01 | NA | NA | 0.494 |
6. F | A1T0Z1 | ATP synthase subunit alpha 2 | 2.19e-01 | NA | NA | 0.4511 |
6. F | Q8VL13 | Circadian clock protein kinase KaiC | 1.10e-04 | NA | NA | 0.6219 |
6. F | Q6KCJ3 | Protein RecA | 2.97e-07 | NA | NA | 0.5483 |
6. F | A8M7V5 | Protein RecA | 2.93e-07 | NA | NA | 0.5177 |
6. F | B1X9W2 | ATP synthase subunit alpha | 2.28e-01 | NA | NA | 0.4568 |
6. F | A8FJR0 | ATP synthase subunit alpha | 1.42e-01 | NA | NA | 0.536 |
6. F | B8DFS9 | Protein RecA | 3.21e-07 | NA | NA | 0.554 |
6. F | A5WBA5 | ATP synthase subunit alpha | 2.05e-01 | NA | NA | 0.4775 |
6. F | B3QSD5 | Protein RecA | 3.67e-08 | NA | NA | 0.5139 |
6. F | P65982 | Protein RecA | 7.07e-07 | NA | NA | 0.5289 |
6. F | Q5LRU0 | Protein RecA | 1.25e-07 | NA | NA | 0.5563 |
6. F | Q92BV7 | Protein RecA | 3.14e-07 | NA | NA | 0.5539 |
6. F | O84300 | DNA repair protein RadA | 2.20e-09 | NA | NA | 0.6177 |
6. F | Q0SQZ3 | ATP synthase subunit alpha | 2.56e-01 | NA | NA | 0.523 |
6. F | A5ISG9 | Protein RecA | 2.20e-07 | NA | NA | 0.5495 |
6. F | P63676 | ATP synthase subunit alpha | 1.94e-01 | NA | NA | 0.4863 |
6. F | Q6F1R0 | Protein RecA | 4.51e-07 | NA | NA | 0.5016 |
6. F | Q1JEH7 | Protein RecA | 2.11e-06 | NA | NA | 0.4797 |
6. F | Q9ZK79 | ATP synthase subunit alpha | 2.93e-01 | NA | NA | 0.4879 |
6. F | B9L1H1 | ATP synthase subunit alpha | 1.96e-01 | NA | NA | 0.5385 |
6. F | P62221 | Protein RecA | 2.26e-06 | NA | NA | 0.5379 |
6. F | Q2YMH5 | DNA repair protein RadA | 1.18e-06 | NA | NA | 0.6747 |
6. F | Q65JF2 | Protein RecA | 3.35e-07 | NA | NA | 0.553 |
6. F | Q46VX8 | ATP synthase subunit alpha | 2.43e-01 | NA | NA | 0.4692 |
6. F | Q9CKW2 | ATP synthase subunit alpha | 2.44e-01 | NA | NA | 0.4736 |
6. F | B3H2P5 | ATP synthase subunit alpha | 2.48e-01 | NA | NA | 0.4667 |
6. F | Q04E78 | Protein RecA | 6.71e-07 | NA | NA | 0.4874 |
6. F | A4QK03 | ATP synthase subunit alpha, chloroplastic | 1.44e-01 | NA | NA | 0.4956 |
6. F | B2VCA6 | ATP synthase subunit alpha | 2.51e-01 | NA | NA | 0.4724 |
6. F | B2IM28 | Protein RecA | 4.39e-07 | NA | NA | 0.491 |
6. F | B5ZAR3 | Protein RecA | 2.59e-09 | NA | NA | 0.524 |
6. F | B2I680 | Protein RecA | 2.55e-07 | NA | NA | 0.5271 |
6. F | Q30P05 | Protein RecA | 2.65e-07 | NA | NA | 0.5128 |
6. F | P16034 | Protein RecA | 3.78e-07 | NA | NA | 0.5189 |
6. F | B8DP00 | Protein RecA | 1.73e-07 | NA | NA | 0.5206 |
6. F | Q3V549 | ATP synthase subunit alpha, chloroplastic | 3.30e-01 | NA | NA | 0.4673 |
6. F | Q5M1Y2 | Protein RecA | 3.34e-07 | NA | NA | 0.5072 |
6. F | Q5L4P3 | Protein RecA | 2.65e-05 | NA | NA | 0.5185 |
6. F | P0DD82 | Protein RecA | 2.85e-07 | NA | NA | 0.4938 |
6. F | Q5FL82 | Protein RecA | 2.42e-06 | NA | NA | 0.5398 |
6. F | Q04S16 | ATP synthase subunit alpha | 4.47e-01 | NA | NA | 0.4812 |
6. F | P68844 | Protein RecA | 2.00e-07 | NA | NA | 0.5496 |
6. F | A4J0C1 | Protein RecA | 5.38e-07 | NA | NA | 0.5166 |
6. F | A8G7M6 | ATP synthase subunit alpha | 2.33e-01 | NA | NA | 0.481 |
6. F | A7ZC35 | ATP synthase subunit alpha | 9.61e-02 | NA | NA | 0.5168 |
6. F | Q2STE7 | ATP synthase subunit alpha 1 | 2.37e-01 | NA | NA | 0.4772 |
6. F | Q04ZU3 | ATP synthase subunit alpha | 4.51e-01 | NA | NA | 0.4871 |
6. F | Q6KCJ5 | Protein RecA | 2.66e-07 | NA | NA | 0.5491 |
6. F | Q5ZWN7 | ATP synthase subunit alpha 1 | 1.01e-01 | NA | NA | 0.439 |
6. F | A4QLH9 | ATP synthase subunit alpha, chloroplastic | 1.39e-01 | NA | NA | 0.4878 |
6. F | B2I862 | ATP synthase subunit alpha | 2.17e-01 | NA | NA | 0.4763 |
6. F | Q3BAQ7 | ATP synthase subunit alpha, chloroplastic | 3.32e-01 | NA | NA | 0.4848 |
6. F | B2V4I3 | Protein RecA | 2.41e-07 | NA | NA | 0.5237 |
6. F | Q4UTR4 | Protein RecA | 2.42e-07 | NA | NA | 0.5283 |
6. F | P0DJP0 | Protein RecA | 3.18e-07 | NA | NA | 0.554 |
6. F | Q85FN4 | ATP synthase subunit alpha, chloroplastic | 1.42e-01 | NA | NA | 0.5022 |
6. F | Q9JW72 | ATP synthase subunit alpha | 1.47e-01 | NA | NA | 0.4732 |
6. F | P49986 | Protein RecA | 2.28e-07 | NA | NA | 0.4889 |
6. F | B1JFU3 | ATP synthase subunit alpha | 2.05e-01 | NA | NA | 0.4892 |
6. F | P16971 | Protein RecA | 2.30e-07 | NA | NA | 0.5595 |
6. F | O52393 | Protein RecA | 2.56e-07 | NA | NA | 0.5107 |
6. F | P74646 | Circadian clock protein kinase KaiC | 1.16e-04 | NA | NA | 0.5779 |
6. F | O78475 | ATP synthase subunit alpha, chloroplastic | 1.97e-01 | NA | NA | 0.5165 |
6. F | C3PGY9 | Protein RecA | 1.65e-07 | NA | NA | 0.541 |
6. F | Q83TH4 | Protein RecA | 2.97e-07 | NA | NA | 0.5292 |
6. F | Q48QW7 | Protein RecA | 1.82e-06 | NA | NA | 0.486 |
6. F | Q85AU2 | ATP synthase subunit alpha, chloroplastic | 3.33e-01 | NA | NA | 0.4981 |
6. F | A4STP5 | ATP synthase subunit alpha | 2.07e-01 | NA | NA | 0.4784 |
6. F | Q72E02 | ATP synthase subunit alpha | 1.51e-01 | NA | NA | 0.5234 |
6. F | Q87KA6 | ATP synthase subunit alpha | 2.24e-01 | NA | NA | 0.4777 |
6. F | A9AJG2 | ATP synthase subunit alpha | 2.34e-01 | NA | NA | 0.4867 |
6. F | Q97B99 | DNA repair and recombination protein RadB | 3.64e-10 | NA | NA | 0.679 |
6. F | Q62FR7 | ATP synthase subunit alpha 1 | 2.41e-01 | NA | NA | 0.4731 |
6. F | Q60101 | Protein RecA | 2.88e-07 | NA | NA | 0.5283 |
6. F | Q9X5D8 | Protein RecA | 1.22e-07 | NA | NA | 0.5323 |
6. F | A6QGI4 | Protein RecA | 1.98e-07 | NA | NA | 0.5394 |
6. F | B2Y1W2 | ATP synthase subunit alpha, chloroplastic | 2.11e-01 | NA | NA | 0.4994 |
6. F | Q83TH2 | Protein RecA | 3.20e-07 | NA | NA | 0.5536 |
6. F | P36203 | Protein RecA | 2.18e-07 | NA | NA | 0.4945 |
6. F | Q2NHD1 | DNA repair and recombination protein RadB | 1.14e-10 | NA | NA | 0.6872 |
6. F | Q0G9X7 | ATP synthase subunit alpha, chloroplastic | 3.59e-01 | NA | NA | 0.4798 |
6. F | Q8VS69 | Protein RecA | 2.09e-06 | NA | NA | 0.4913 |
6. F | Q05372 | ATP synthase subunit alpha | 1.91e-01 | NA | NA | 0.5068 |
6. F | Q2MIK2 | ATP synthase subunit alpha, chloroplastic | 3.33e-01 | NA | NA | 0.5085 |
6. F | B4SYD3 | ATP synthase subunit alpha | 1.66e-01 | NA | NA | 0.4829 |
6. F | Q8NZ30 | Protein RecA | 4.27e-07 | NA | NA | 0.4952 |
6. F | Q6ENH7 | ATP synthase subunit alpha, chloroplastic | 1.61e-01 | NA | NA | 0.4849 |
6. F | Q7MA20 | ATP synthase subunit alpha | 1.56e-01 | NA | NA | 0.5158 |
6. F | A5GNC8 | ATP synthase subunit alpha | 1.48e-01 | NA | NA | 0.5052 |
6. F | P65980 | Protein RecA | 2.41e-06 | NA | NA | 0.5011 |
6. F | C1EP03 | Protein RecA | 2.97e-07 | NA | NA | 0.5456 |
6. F | Q2FF22 | ATP synthase subunit alpha | 1.88e-01 | NA | NA | 0.4859 |
6. F | A4QJA0 | ATP synthase subunit alpha, chloroplastic | 2.07e-01 | NA | NA | 0.5079 |
6. F | Q03R29 | Protein RecA | 5.51e-07 | NA | NA | 0.5393 |
6. F | B0Z4N2 | ATP synthase subunit alpha, chloroplastic | 1.88e-01 | NA | NA | 0.4965 |
6. F | P42445 | Protein RecA | 1.92e-07 | NA | NA | 0.513 |
6. F | Q48AW2 | ATP synthase subunit alpha | 2.16e-01 | NA | NA | 0.4801 |
6. F | B0THN4 | ATP synthase subunit alpha | 2.86e-01 | NA | NA | 0.4951 |
6. F | B8JCV2 | ATP synthase subunit alpha | 2.27e-01 | NA | NA | 0.5161 |
6. F | Q0SP32 | Protein RecA | 5.45e-06 | NA | NA | 0.4898 |
6. F | A4QKH7 | ATP synthase subunit alpha, chloroplastic | 1.52e-01 | NA | NA | 0.4929 |
6. F | C0ZYM6 | Protein RecA | 2.32e-07 | NA | NA | 0.5408 |
6. F | Q8RGE0 | ATP synthase subunit alpha | 1.65e-01 | NA | NA | 0.5067 |
6. F | B8J369 | Protein RecA | 1.89e-07 | NA | NA | 0.5233 |
6. F | B7JB86 | ATP synthase subunit alpha | 2.35e-01 | NA | NA | 0.48 |
6. F | C5BF38 | ATP synthase subunit alpha | 2.18e-01 | NA | NA | 0.4732 |
6. F | P65979 | Protein RecA | 1.95e-06 | NA | NA | 0.4756 |
6. F | Q21DK6 | ATP synthase subunit alpha | 2.41e-01 | NA | NA | 0.4917 |
6. F | Q48761 | DNA repair protein RadA | 9.70e-09 | NA | NA | 0.5982 |
6. F | Q09X32 | ATP synthase subunit alpha, chloroplastic | 3.34e-01 | NA | NA | 0.5076 |
6. F | Q1JJH6 | Protein RecA | 3.83e-07 | NA | NA | 0.4924 |
6. F | A3PET9 | ATP synthase subunit alpha | 2.14e-01 | NA | NA | 0.4878 |
6. F | B7IG42 | ATP synthase subunit alpha | 1.59e-01 | NA | NA | 0.5217 |
6. F | A4SUT2 | ATP synthase subunit alpha | 2.15e-01 | NA | NA | 0.4717 |
6. F | Q7NXL9 | Protein RecA | 3.24e-05 | NA | NA | 0.5172 |
6. F | Q3AHK5 | ATP synthase subunit alpha | 3.41e-01 | NA | NA | 0.4917 |
6. F | Q06J68 | ATP synthase subunit alpha, chloroplastic | 2.02e-01 | NA | NA | 0.5011 |
6. F | Q6FFK2 | ATP synthase subunit alpha | 2.65e-01 | NA | NA | 0.4699 |
6. F | A1VXI8 | ATP synthase subunit alpha | 1.15e-01 | NA | NA | 0.5134 |
6. F | A1TJ39 | ATP synthase subunit alpha | 2.41e-01 | NA | NA | 0.4921 |
6. F | Q1GB51 | Protein RecA | 1.36e-06 | NA | NA | 0.5518 |
6. F | Q0RDW5 | Protein RecA | 1.59e-07 | NA | NA | 0.5361 |
6. F | C0Q2N4 | ATP synthase subunit alpha | 2.11e-01 | NA | NA | 0.4812 |
6. F | Q67TB9 | ATP synthase subunit alpha | 1.59e-01 | NA | NA | 0.5111 |
6. F | Q9Z9C8 | DNA repair protein RadA | 5.04e-09 | NA | NA | 0.6474 |
6. F | B3CMC0 | Protein RecA | 8.10e-08 | NA | NA | 0.4961 |
6. F | A7HJV9 | ATP synthase subunit alpha | 1.47e-01 | NA | NA | 0.523 |
6. F | A4GGB2 | ATP synthase subunit alpha, chloroplastic | 3.36e-01 | NA | NA | 0.4916 |
6. F | Q9V216 | UPF0273 protein PYRAB02580 | 1.69e-10 | NA | NA | 0.6609 |
7. B | P9WMR3 | Replicative DNA helicase | 1.74e-11 | NA | 3.04e-54 | NA |
7. B | Q05279 | Gene 65 protein | NA | NA | 0.033 | NA |
7. B | P03692 | DNA helicase/primase | NA | NA | 1.60e-04 | NA |