Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX55000.1
JCVISYN3A_0839

Preprotein translocase subunit.
M. mycoides homolog: Q6MS21.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 54
Unique PROST Go: 54
Unique BLAST Go: 0
Unique Foldseek Go: 0

Total Homologs: 84
Unique PROST Homologs: 84
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: secE; Preprotein translocase, SecE subunit
Zhang et al. [4]: GO:0009306|protein secretion
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 5. P was Q46EU5 (Protein translocase subunit SecE) with a FATCAT P-Value: 1.04e-07 and RMSD of 2.49 angstrom. The sequence alignment identity is 21.4%.
Structural alignment shown in left. Query protein AVX55000.1 colored as red in alignment, homolog Q46EU5 colored as blue. Query protein AVX55000.1 is also shown in right top, homolog Q46EU5 showed in right bottom. They are colored based on secondary structures. 

  AVX55000.1 MEKEINIDQVEQIEQVEH-IKPKNT-QKISKTTKKKLKVKKEKEPKNFRTWFKELPVRMSKEFFKI-RWTGSG--SLGKKFLIVIIFMSIFALLFFGVDV 95
      Q46EU5 --------------MVESTFEPKITAESVGQVIRAHLRVLK-------LT-RK--PSR--EEFLTIAKVAGVGILAVG-----AIGFI-IYVLL----TM 64

  AVX55000.1 VIQYLFRLIKAI 107
      Q46EU5 LPQWVAQ----- 71

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
5. P GO:0015450 protein-transporting ATPase activity
5. P GO:0035339 SPOTS complex
5. P GO:0055036 virion membrane
5. P GO:0009535 chloroplast thylakoid membrane
5. P GO:0050821 protein stabilization
5. P GO:0009306 protein secretion
5. P GO:0031204 posttranslational protein targeting to membrane, translocation
5. P GO:0042314 bacteriochlorophyll binding
5. P GO:0009523 photosystem II
5. P GO:0005747 mitochondrial respiratory chain complex I
5. P GO:0022900 electron transport chain
5. P GO:0010259 multicellular organism aging
5. P GO:0032024 positive regulation of insulin secretion
5. P GO:0030077 plasma membrane light-harvesting complex
5. P GO:0015031 protein transport
5. P GO:0043952 protein transport by the Sec complex
5. P GO:0005881 cytoplasmic microtubule
5. P GO:0044178 host cell Golgi membrane
5. P GO:0009791 post-embryonic development
5. P GO:0060124 positive regulation of growth hormone secretion
5. P GO:0030269 tetrahydromethanopterin S-methyltransferase activity
5. P GO:0031676 plasma membrane-derived thylakoid membrane
5. P GO:0006666 3-keto-sphinganine metabolic process
5. P GO:0032981 mitochondrial respiratory chain complex I assembly
5. P GO:0006486 protein glycosylation
5. P GO:0001501 skeletal system development
5. P GO:0048408 epidermal growth factor binding
5. P GO:0016021 integral component of membrane
5. P GO:0065002 intracellular protein transmembrane transport
5. P GO:0048644 muscle organ morphogenesis
5. P GO:0009539 photosystem II reaction center
5. P GO:0046622 positive regulation of organ growth
5. P GO:0030970 retrograde protein transport, ER to cytosol
5. P GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
5. P GO:0005789 endoplasmic reticulum membrane
5. P GO:0006006 glucose metabolic process
5. P GO:0005783 endoplasmic reticulum
5. P GO:0030968 endoplasmic reticulum unfolded protein response
5. P GO:0005784 Sec61 translocon complex
5. P GO:0071261 Ssh1 translocon complex
5. P GO:0044322 endoplasmic reticulum quality control compartment
5. P GO:0042301 phosphate ion binding
5. P GO:0008320 protein transmembrane transporter activity
5. P GO:0044171 host cell smooth endoplasmic reticulum membrane
5. P GO:0015979 photosynthesis
5. P GO:0090154 positive regulation of sphingolipid biosynthetic process
5. P GO:0006605 protein targeting
5. P GO:0006620 posttranslational protein targeting to endoplasmic reticulum membrane
5. P GO:0006730 one-carbon metabolic process
5. P GO:0019386 methanogenesis, from carbon dioxide
5. P GO:0008047 enzyme activator activity
5. P GO:0075733 intracellular transport of virus
5. P GO:0007009 plasma membrane organization
5. P GO:0045727 positive regulation of translation

Uniprot GO Annotations

GO Description
GO:0015031 protein transport
GO:0008320 protein transmembrane transporter activity
GO:0016021 integral component of membrane
GO:0016020 membrane
GO:0009306 protein secretion
GO:0006605 protein targeting
GO:0071806 protein transmembrane transport
GO:0006886 intracellular protein transport

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
5. P Q4JQX4 Structural protein 1 NA 3.15e-02 NA NA
5. P G2TRT3 Protein tam14 8.65e-04 2.75e-05 NA NA
5. P P89477 Envelope protein US9 NA 5.28e-03 NA NA
5. P Q46EU5 Protein translocase subunit SecE 1.04e-07 3.01e-02 NA NA
5. P P75048 Uncharacterized protein MG055 homolog 1.86e-05 2.35e-17 NA NA
5. P A2C0D3 Photosystem II reaction center protein J 2.17e-02 6.19e-04 NA NA
5. P Q6R7I8 Uncharacterized protein ORF36 NA 3.41e-06 NA NA
5. P B2B9D9 Triple QxxK/R motif-containing protein 1.53e-04 1.11e-03 NA NA
5. P Q8M9Z3 Photosystem II reaction center protein H 6.50e-03 2.64e-03 NA NA
5. P B2Y1Y8 Photosystem II reaction center protein H 1.19e-02 2.62e-02 NA NA
5. P A5GQF1 Photosystem II reaction center protein J 1.84e-03 2.09e-04 NA NA
5. P P36691 Protein translocase subunit SecE 4.34e-06 1.86e-23 NA NA
5. P P24993 Photosystem II reaction center protein H 3.48e-03 4.68e-02 NA NA
5. P O43676 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 7.53e-03 4.44e-03 NA NA
5. P Q12UQ2 Protein translocase subunit SecE 8.13e-07 1.58e-04 NA NA
5. P Q0IDK0 Photosystem II reaction center protein J 2.07e-03 4.06e-06 NA NA
5. P A8G2W1 Photosystem II reaction center protein J 6.26e-03 1.03e-04 NA NA
5. P Q96626 Late L2 mu core protein NA 4.26e-02 NA NA
5. P P02950 Light-harvesting protein B-870 beta chain 2.61e-03 4.80e-02 NA NA
5. P Q750C9 Serine palmitoyltransferase-regulating protein TSC3 1.25e-05 4.49e-02 NA NA
5. P Q7U9Q2 Photosystem II reaction center protein J 4.02e-02 7.53e-05 NA NA
5. P P52853 Protein translocase subunit SecE 4.27e-06 9.70e-25 NA NA
5. P Q3ZBR1 Stress-associated endoplasmic reticulum protein 1 8.50e-03 2.55e-02 NA NA
5. P P52870 Protein transport protein SBH1 4.64e-03 3.43e-05 NA NA
5. P P30025 Envelope protein US9 homolog NA 1.36e-02 NA NA
5. P A5WVU9 Triple QxxK/R motif-containing protein 2.87e-05 4.50e-05 NA NA
5. P Q9Y6X1 Stress-associated endoplasmic reticulum protein 1 1.08e-02 2.55e-02 NA NA
5. P Q05637 Phosphate metabolism protein 6 1.10e-02 9.28e-03 NA NA
5. P P38382 Protein translocase subunit SecE 1.03e-04 5.09e-05 NA NA
5. P P36253 Protein translocase subunit SecE 5.27e-05 1.71e-04 NA NA
5. P Q7V2Z7 Photosystem II reaction center protein J 6.61e-03 7.06e-06 NA NA
5. P O27225 Tetrahydromethanopterin S-methyltransferase subunit G 5.98e-06 3.12e-02 NA NA
5. P P09266 Structural protein 1 NA 1.29e-02 NA NA
5. P Q54PN1 Putative uncharacterized protein DDB_G0284425 1.47e-05 8.18e-03 NA NA
5. P Q96D05 Protein FAM241B 6.35e-02 2.45e-02 NA NA
5. P Q0MQD1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 6.99e-03 4.44e-03 NA NA
5. P A1E9V3 Photosystem II reaction center protein H 1.33e-02 4.68e-02 NA NA
5. P P9WGN6 Protein translocase subunit SecE 5.64e-04 2.42e-06 NA NA
5. P A2BPA0 Photosystem II reaction center protein J 1.47e-03 4.64e-05 NA NA
5. P A2BUT1 Photosystem II reaction center protein J 5.26e-03 7.06e-06 NA NA
5. P Q6CJH4 Serine palmitoyltransferase-regulating protein TSC3 3.98e-03 2.11e-03 NA NA
5. P Q54KB9 Putative uncharacterized protein DDB_G0287489 4.63e-03 3.79e-03 NA NA
5. P O43002 Protein transport protein sec61 subunit beta 6.56e-04 2.47e-02 NA NA
5. P Q0MQD2 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 5.91e-03 4.44e-03 NA NA
5. P Q3AN59 Photosystem II reaction center protein J 2.49e-03 8.51e-05 NA NA
5. P Q3T073 Stress-associated endoplasmic reticulum protein 2 9.18e-03 1.69e-02 NA NA
5. P B2RUZ4 Small integral membrane protein 1 2.71e-03 1.34e-03 NA NA
5. P Q46H79 Photosystem II reaction center protein J 1.71e-03 4.71e-04 NA NA
5. P Q9Z1W5 Stress-associated endoplasmic reticulum protein 1 1.96e-03 2.55e-02 NA NA
5. P A5GIA7 Photosystem II reaction center protein J 1.72e-03 3.58e-07 NA NA
5. P Q06SD4 Photosystem II reaction center protein L 3.44e-03 1.12e-04 NA NA
5. P Q8TVA7 Tetrahydromethanopterin S-methyltransferase subunit F 3.72e-04 5.89e-04 NA NA
5. P P07613 Protein L2 NA 3.23e-02 NA NA
5. P Q8TYT4 Preprotein translocase subunit SecG 8.30e-03 4.52e-02 NA NA
5. P P31555 Photosystem II reaction center protein H 6.71e-03 3.84e-02 NA NA
5. P P0A4G9 Protein translocase subunit SecE 3.28e-06 1.70e-24 NA NA
5. P Q6L373 Photosystem II reaction center protein H 7.87e-02 4.68e-02 NA NA
5. P P0A5Z1 Protein translocase subunit SecE 5.39e-04 2.42e-06 NA NA
5. P Q9HFC7 Protein transport protein Sec61 subunit beta 5.66e-03 3.65e-04 NA NA
5. P P9WGN7 Protein translocase subunit SecE 3.12e-04 2.42e-06 NA NA
5. P Q3B0C9 Photosystem II reaction center protein J 4.25e-02 9.33e-05 NA NA
5. P P35179 Protein transport protein SSS1 1.25e-07 5.40e-04 NA NA
5. P B2X1X7 Photosystem II reaction center protein L 2.58e-03 2.49e-02 NA NA
5. P Q9CQS8 Protein transport protein Sec61 subunit beta 2.93e-02 3.40e-02 NA NA
5. P P36690 Protein translocase subunit SecE 2.93e-06 5.61e-25 NA NA
5. P Q9R2C1 Stress-associated endoplasmic reticulum protein 1 9.59e-03 2.55e-02 NA NA
5. P Q8N6R1 Stress-associated endoplasmic reticulum protein 2 1.52e-02 1.69e-02 NA NA
5. P Q9CBJ9 Protein translocase subunit SecE 2.79e-04 9.44e-08 NA NA
5. P Q7V4P9 Photosystem II reaction center protein J 1.02e-02 3.21e-04 NA NA
5. P Q10195 Uncharacterized protein C11C11.06c 3.45e-02 2.40e-02 NA NA
5. P Q50774 Tetrahydromethanopterin S-methyltransferase subunit G 5.79e-06 8.79e-03 NA NA
5. P P47301 Uncharacterized protein MG055 1.28e-04 7.89e-18 NA NA
5. P P0A4G8 Protein translocase subunit SecE 7.79e-06 2.60e-25 NA NA
5. P A9BDU7 Photosystem II reaction center protein J 1.85e-03 3.05e-06 NA NA
5. P Q6ENT5 Photosystem II reaction center protein H 7.09e-02 4.68e-02 NA NA
5. P Q31CN2 Photosystem II reaction center protein J 1.64e-02 4.64e-05 NA NA
5. P Q6TAW2 Stress-associated endoplasmic reticulum protein 2 5.16e-03 1.69e-02 NA NA
5. P A3PB22 Photosystem II reaction center protein J 1.14e-03 4.64e-05 NA NA
5. P Q8TI84 Protein translocase subunit SecE 1.57e-07 4.97e-02 NA NA
5. P Q7VDN7 Photosystem II reaction center protein J 1.67e-03 2.48e-05 NA NA
5. P Q10032 Uncharacterized protein C27D6.3 1.78e-04 1.04e-07 NA NA
5. P Q5REZ1 Stress-associated endoplasmic reticulum protein 1 3.38e-03 4.30e-02 NA NA
5. P Q9D882 Protein FAM241B 7.41e-02 2.38e-02 NA NA
5. P A2CCQ3 Photosystem II reaction center protein J 6.97e-03 4.14e-04 NA NA