Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX55001.1
JCVISYN3A_0840
Antitermination protein.
M. mycoides homolog: Q6MS20.
TIGRfam Classification: 4=Probable.
Category: Quasiessential.
Statistics
Total GO Annotation: 42
Unique PROST Go: 5
Unique BLAST Go: 0
Unique Foldseek Go: 30
Total Homologs: 110
Unique PROST Homologs: 6
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 30
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q5XE43
(Transcription termination/antitermination protein NusG) with a FATCAT P-Value: 8.1e-15 and RMSD of 1.55 angstrom. The sequence alignment identity is 29.8%.
Structural alignment shown in left. Query protein AVX55001.1 colored as red in alignment, homolog Q5XE43 colored as blue.
Query protein AVX55001.1 is also shown in right top, homolog Q5XE43 showed in right bottom. They are colored based on secondary structures.
AVX55001.1 MTYEEIKQLEDEILEA--KGQWFVISCQTGHEEKVLGDLQQKIKSASIEDEVFSIKISKANL-VSKSGKSS-I-KNKFPGYIFINMIMSEKAWFLIRNTP 95 Q5XE43 ------------MLDSFDKG-WFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIPTQTVNVEKNGQTKEIEENRFPGYVLVEMVMTDEAWFVVRNTP 87 AVX55001.1 GVTGFIGSSGRGAKPSPLTTEETLNMLVPNLEEIEQAHEQEQQEENLKNEAVNKKELFTANFKVGDVVRVKSGIHENEEGTVKDMDFSKGVAFVAIEMFG 195 Q5XE43 NVTGFVGSHGNRSKPTPL-LEEEIRAIL--L--------------SM-GQTI---DVFDTNIKEGDVVQIIDGAFMGQEGRVVEIENNK-VK-LMLNMFG 164 AVX55001.1 RWTTLEVSFKNVEPIKEY 213 Q5XE43 SETVAEVELYQIAEL--- 179
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0006353 | DNA-templated transcription, termination |
| 1. PBF | GO:0031564 | transcription antitermination |
| 1. PBF | GO:0005829 | cytosol |
| 1. PBF | GO:0006354 | DNA-templated transcription, elongation |
| 1. PBF | GO:0032784 | regulation of DNA-templated transcription, elongation |
| 2. PF | GO:0003746 | translation elongation factor activity |
| 2. PF | GO:0001073 | transcription antitermination factor activity, DNA binding |
| 5. P | GO:0008494 | translation activator activity |
| 5. P | GO:0005737 | cytoplasm |
| 5. P | GO:0001124 | |
| 5. P | GO:0001000 | bacterial-type RNA polymerase core enzyme binding |
| 5. P | GO:0006355 | regulation of transcription, DNA-templated |
| 6. F | GO:0033553 | rDNA heterochromatin |
| 6. F | GO:0000245 | spliceosomal complex assembly |
| 6. F | GO:0090262 | regulation of transcription-coupled nucleotide-excision repair |
| 6. F | GO:0009507 | chloroplast |
| 6. F | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter |
| 6. F | GO:0010508 | positive regulation of autophagy |
| 6. F | GO:0001042 | RNA polymerase I core binding |
| 6. F | GO:0006357 | regulation of transcription by RNA polymerase II |
| 6. F | GO:0030621 | U4 snRNA binding |
| 6. F | GO:0006397 | mRNA processing |
| 6. F | GO:0006368 | transcription elongation from RNA polymerase II promoter |
| 6. F | GO:0003735 | structural constituent of ribosome |
| 6. F | GO:0030623 | U5 snRNA binding |
| 6. F | GO:0032044 | DSIF complex |
| 6. F | GO:2001209 | positive regulation of transcription elongation from RNA polymerase I promoter |
| 6. F | GO:0003727 | single-stranded RNA binding |
| 6. F | GO:0030620 | U2 snRNA binding |
| 6. F | GO:0005840 | ribosome |
| 6. F | GO:0006412 | translation |
| 6. F | GO:0060195 | negative regulation of antisense RNA transcription |
| 6. F | GO:0008298 | intracellular mRNA localization |
| 6. F | GO:0070990 | snRNP binding |
| 6. F | GO:0017070 | U6 snRNA binding |
| 6. F | GO:0001179 | RNA polymerase I general transcription initiation factor binding |
| 6. F | GO:2001208 | negative regulation of transcription elongation by RNA polymerase I |
| 6. F | GO:0000993 | RNA polymerase II complex binding |
| 6. F | GO:0030619 | U1 snRNA binding |
| 6. F | GO:2000232 | regulation of rRNA processing |
| 6. F | GO:0003729 | mRNA binding |
| 6. F | GO:0019843 | rRNA binding |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0006353 | DNA-templated transcription, termination |
| GO:0031564 | transcription antitermination |
| GO:0006354 | DNA-templated transcription, elongation |
| GO:0032784 | regulation of DNA-templated transcription, elongation |
| GO:0006355 | regulation of transcription, DNA-templated |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | Q9PI36 | Transcription termination/antitermination protein NusG | 2.06e-11 | 1.10e-27 | 3.97e-14 | 0.4951 |
| 1. PBF | Q4UKC9 | Transcription termination/antitermination protein NusG | 1.71e-08 | 3.23e-30 | 2.33e-19 | 0.4949 |
| 1. PBF | P0C1S3 | Transcription termination/antitermination protein NusG | 1.30e-12 | 1.94e-38 | 1.47e-34 | 0.5377 |
| 1. PBF | Q5HRL6 | Transcription termination/antitermination protein NusG | 1.34e-12 | 1.59e-36 | 5.62e-33 | 0.5247 |
| 1. PBF | Q8ZAP0 | Transcription termination/antitermination protein NusG | 1.20e-11 | 1.83e-29 | 4.83e-21 | 0.5255 |
| 1. PBF | Q6GJD2 | Transcription termination/antitermination protein NusG | 1.63e-11 | 1.94e-38 | 1.47e-34 | 0.5285 |
| 1. PBF | Q9KGE7 | Transcription termination/antitermination protein NusG | 4.89e-10 | 5.59e-31 | 4.93e-32 | 0.5427 |
| 1. PBF | Q8KA65 | Transcription termination/antitermination protein NusG | 5.12e-10 | 3.60e-31 | 2.05e-23 | 0.524 |
| 1. PBF | Q9CDV7 | Transcription termination/antitermination protein NusG | 1.09e-11 | 3.10e-26 | 1.66e-23 | 0.5359 |
| 1. PBF | P43916 | Transcription termination/antitermination protein NusG | 1.36e-11 | 2.26e-35 | 5.16e-23 | 0.5157 |
| 1. PBF | Q9CK84 | Transcription termination/antitermination protein NusG | 1.43e-11 | 7.89e-35 | 1.01e-22 | 0.5045 |
| 1. PBF | Q92J91 | Transcription termination/antitermination protein NusG | 1.91e-08 | 1.59e-28 | 2.30e-17 | 0.4927 |
| 1. PBF | P50056 | Transcription termination/antitermination protein NusG | 1.25e-11 | 1.76e-29 | 1.73e-18 | 0.4706 |
| 1. PBF | P68895 | Transcription termination/antitermination protein NusG | 8.24e-14 | 5.84e-32 | 3.25e-28 | 0.5482 |
| 1. PBF | O83264 | Transcription termination/antitermination protein NusG | 1.40e-11 | 2.42e-37 | 2.11e-15 | 0.5055 |
| 1. PBF | Q9CBK0 | Transcription termination/antitermination protein NusG | 4.57e-11 | 1.88e-22 | 8.29e-24 | 0.5042 |
| 1. PBF | P36264 | Transcription termination/antitermination protein NusG | 1.29e-11 | 3.99e-37 | 6.26e-32 | 0.5237 |
| 1. PBF | Q8CQ85 | Transcription termination/antitermination protein NusG | 1.20e-12 | 1.59e-36 | 5.62e-33 | 0.53 |
| 1. PBF | O84322 | Transcription termination/antitermination protein NusG | 1.01e-10 | 9.36e-23 | 1.16e-09 | 0.4865 |
| 1. PBF | P0A097 | Transcription termination/antitermination protein NusG | 4.38e-12 | 1.94e-38 | 1.47e-34 | 0.5287 |
| 1. PBF | Q5XE43 | Transcription termination/antitermination protein NusG | 8.10e-15 | 5.84e-32 | 3.25e-28 | 0.548 |
| 1. PBF | Q9KV35 | Transcription termination/antitermination protein NusG | 8.67e-14 | 1.54e-31 | 4.53e-24 | 0.5276 |
| 1. PBF | P57151 | Transcription termination/antitermination protein NusG | 3.56e-11 | 6.20e-30 | 1.02e-22 | 0.5038 |
| 1. PBF | Q9PK75 | Transcription termination/antitermination protein NusG | 2.68e-11 | 1.88e-22 | 1.13e-09 | 0.5012 |
| 1. PBF | P9WIU8 | Transcription termination/antitermination protein NusG | 1.63e-13 | 1.99e-17 | 2.99e-22 | 0.5187 |
| 1. PBF | Q9ZK20 | Transcription termination/antitermination protein NusG | 5.68e-13 | 1.24e-30 | 1.91e-15 | 0.5328 |
| 1. PBF | P0DC79 | Transcription termination/antitermination protein NusG | 1.11e-14 | 5.84e-32 | 3.25e-28 | 0.5485 |
| 1. PBF | O51355 | Transcription termination/antitermination protein NusG | 8.23e-11 | 1.10e-27 | 2.14e-14 | 0.4759 |
| 1. PBF | P68893 | Transcription termination/antitermination protein NusG | 3.10e-14 | 5.84e-32 | 3.25e-28 | 0.5491 |
| 1. PBF | P0AFG1 | Transcription termination/antitermination protein NusG | 5.62e-11 | 3.16e-29 | 7.49e-22 | 0.5102 |
| 1. PBF | P0A095 | Transcription termination/antitermination protein NusG | 1.84e-12 | 1.94e-38 | 1.47e-34 | 0.5284 |
| 1. PBF | P0AFG2 | Transcription termination/antitermination protein NusG | 2.40e-11 | 3.16e-29 | 7.49e-22 | 0.5133 |
| 1. PBF | Q5HID9 | Transcription termination/antitermination protein NusG | 1.33e-12 | 1.94e-38 | 1.47e-34 | 0.5294 |
| 1. PBF | Q87A27 | Transcription termination/antitermination protein NusG | 5.77e-11 | 3.35e-37 | 8.00e-14 | 0.4925 |
| 1. PBF | Q06795 | Transcription termination/antitermination protein NusG | 7.92e-14 | 2.18e-29 | 4.62e-29 | 0.563 |
| 1. PBF | Q9Z9A5 | Transcription termination/antitermination protein NusG | 1.02e-09 | 1.41e-23 | 1.90e-12 | 0.482 |
| 1. PBF | P0A096 | Transcription termination/antitermination protein NusG | 1.44e-12 | 1.94e-38 | 1.47e-34 | 0.5286 |
| 1. PBF | Q1RHC5 | Transcription termination/antitermination protein NusG | 6.34e-12 | 2.81e-30 | 1.22e-17 | 0.4872 |
| 1. PBF | P65592 | Transcription termination/antitermination protein NusG | 5.92e-12 | 7.26e-33 | 2.00e-20 | 0.5222 |
| 1. PBF | P36265 | Transcription termination/antitermination protein NusG | 2.98e-13 | 1.16e-25 | 1.17e-19 | 0.4683 |
| 1. PBF | P55976 | Transcription termination/antitermination protein NusG | 2.77e-13 | 9.38e-30 | 1.24e-14 | 0.5357 |
| 1. PBF | P0AA01 | Transcription termination/antitermination protein NusG | 8.65e-12 | 1.56e-29 | 4.49e-21 | 0.526 |
| 1. PBF | Q6GBV1 | Transcription termination/antitermination protein NusG | 4.51e-13 | 1.94e-38 | 1.47e-34 | 0.529 |
| 1. PBF | Q9RSS6 | Transcription termination/antitermination protein NusG | 1.60e-10 | 2.56e-36 | 1.34e-14 | 0.4814 |
| 1. PBF | Q9HWC4 | Transcription termination/antitermination protein NusG | 1.71e-12 | 6.45e-30 | 4.45e-21 | 0.525 |
| 1. PBF | Q8DD25 | Transcription termination/antitermination protein NusG | 2.72e-11 | 3.82e-34 | 3.04e-23 | 0.53 |
| 1. PBF | P0AA03 | Transcription termination/antitermination protein NusG | 1.17e-11 | 1.56e-29 | 4.49e-21 | 0.5241 |
| 1. PBF | P35872 | Transcription termination/antitermination protein NusG | 1.03e-12 | 2.41e-34 | 2.10e-24 | 0.5031 |
| 1. PBF | P0DC78 | Transcription termination/antitermination protein NusG | 2.10e-14 | 5.84e-32 | 3.25e-28 | 0.5487 |
| 1. PBF | P0AA02 | Transcription termination/antitermination protein NusG | 9.52e-12 | 1.56e-29 | 4.49e-21 | 0.5256 |
| 1. PBF | Q68XN3 | Transcription termination/antitermination protein NusG | 1.65e-08 | 6.84e-28 | 2.40e-17 | 0.4704 |
| 1. PBF | Q87KP9 | Transcription termination/antitermination protein NusG | 1.60e-11 | 9.69e-32 | 1.91e-23 | 0.5228 |
| 1. PBF | Q89B15 | Transcription termination/antitermination protein NusG | 1.16e-10 | 2.94e-31 | 2.31e-19 | 0.4363 |
| 1. PBF | P65590 | Transcription termination/antitermination protein NusG | 5.15e-13 | 1.99e-17 | 2.99e-22 | 0.5132 |
| 1. PBF | Q9PA81 | Transcription termination/antitermination protein NusG | 9.31e-11 | 4.90e-38 | 7.22e-14 | 0.4954 |
| 1. PBF | O67757 | Transcription termination/antitermination protein NusG | 8.01e-09 | 1.30e-20 | 1.69e-08 | 0.4057 |
| 1. PBF | P65591 | Transcription termination/antitermination protein NusG | 5.12e-12 | 7.26e-33 | 2.00e-20 | 0.4897 |
| 2. PF | Q8TZK1 | Transcription elongation factor Spt5 | 1.82e-07 | 6.20e-09 | NA | 0.4725 |
| 2. PF | Q9Y9W3 | Transcription elongation factor Spt5 | 5.92e-09 | 4.88e-12 | NA | 0.492 |
| 2. PF | P96036 | Transcription elongation factor Spt5 | 1.39e-06 | 9.97e-11 | NA | 0.5026 |
| 2. PF | Q0TAL4 | Transcription antitermination protein RfaH | 2.95e-06 | 1.80e-19 | NA | 0.4067 |
| 2. PF | Q46494 | Transcription elongation factor Spt5 | 1.54e-09 | 2.74e-10 | NA | 0.5131 |
| 2. PF | P27341 | Transcription elongation factor Spt5 | 1.05e-08 | 9.88e-12 | NA | 0.5003 |
| 3. BF | P52852 | Transcription termination/antitermination protein NusG | 3.29e-10 | NA | 1.67e-21 | 0.5085 |
| 3. BF | P75049 | Transcription termination/antitermination protein NusG | 4.93e-07 | NA | 1.39e-14 | 0.4297 |
| 3. BF | P29397 | Transcription termination/antitermination protein NusG | 9.40e-04 | NA | 7.50e-14 | 0.4086 |
| 3. BF | P27309 | Transcription termination/antitermination protein NusG | 2.16e-11 | NA | 7.10e-28 | 0.5135 |
| 3. BF | P36260 | Transcription termination/antitermination protein NusG | 1.25e-10 | NA | 4.27e-27 | 0.4953 |
| 3. BF | P36262 | Transcription termination/antitermination protein NusG (Fragment) | 9.37e-07 | NA | 0.016 | 0.9349 |
| 3. BF | P47300 | Transcription termination/antitermination protein NusG | 5.29e-07 | NA | 1.43e-12 | 0.4156 |
| 3. BF | P36266 | Transcription termination/antitermination protein NusG | 3.28e-11 | NA | 5.30e-27 | 0.5109 |
| 4. PB | Q2G0P2 | Transcription termination/antitermination protein NusG | 4.59e-12 | 1.94e-38 | 1.47e-34 | NA |
| 4. PB | P9WIU9 | Transcription termination/antitermination protein NusG | 1.60e-12 | 1.99e-17 | 2.99e-22 | NA |
| 4. PB | P0AFG0 | Transcription termination/antitermination protein NusG | 2.18e-11 | 3.16e-29 | 7.49e-22 | NA |
| 5. P | Q8FBI4 | Transcription antitermination protein RfaH | 2.13e-06 | 1.80e-19 | NA | NA |
| 5. P | O28366 | 30S ribosomal protein S4e | 3.23e-02 | 2.60e-02 | NA | NA |
| 5. P | P0AFW0 | Transcription antitermination protein RfaH | 3.24e-06 | 3.40e-19 | NA | NA |
| 5. P | O83863 | Ribosome maturation factor RimP | 8.88e-03 | 4.75e-03 | NA | NA |
| 5. P | Q57818 | Transcription elongation factor Spt5 | 1.33e-05 | 6.98e-06 | NA | NA |
| 5. P | P0AFW1 | Transcription antitermination protein RfaH | 3.83e-06 | 3.40e-19 | NA | NA |
| 6. F | P51303 | 50S ribosomal protein L24, chloroplastic | 1.43e-03 | NA | NA | 0.6019 |
| 6. F | P0CR71 | Transcription elongation factor SPT5 | 1.17e-01 | NA | NA | 0.3843 |
| 6. F | Q6CWW9 | Transcription elongation factor SPT5 | 3.33e-01 | NA | NA | 0.2604 |
| 6. F | B2XTV0 | 50S ribosomal protein L24, chloroplastic | 3.92e-02 | NA | NA | 0.6296 |
| 6. F | Q5R405 | Transcription elongation factor SPT5 | 1.81e-01 | NA | NA | 0.3179 |
| 6. F | B2XTE4 | 50S ribosomal protein L24, chloroplastic | 1.13e-03 | NA | NA | 0.6408 |
| 6. F | Q8U010 | 50S ribosomal protein L24 | 2.09e-02 | NA | NA | 0.7018 |
| 6. F | A6GZ88 | 50S ribosomal protein L24 | 5.33e-03 | NA | NA | 0.6307 |
| 6. F | Q7S3C4 | Transcription elongation factor spt5 | 2.48e-01 | NA | NA | 0.3864 |
| 6. F | Q9TLU3 | 50S ribosomal protein L24, chloroplastic | 1.51e-03 | NA | NA | 0.6472 |
| 6. F | A0T0J0 | 50S ribosomal protein L24, chloroplastic | 1.74e-06 | NA | NA | 0.6659 |
| 6. F | Q4I5I4 | Transcription elongation factor SPT5 | 1.97e-01 | NA | NA | 0.2887 |
| 6. F | Q12ZU0 | 50S ribosomal protein L24 | 4.34e-02 | NA | NA | 0.6976 |
| 6. F | Q5HSA1 | 50S ribosomal protein L24 | 2.00e-03 | NA | NA | 0.6353 |
| 6. F | A0T0Y4 | 50S ribosomal protein L24, chloroplastic | 2.05e-03 | NA | NA | 0.6409 |
| 6. F | Q97BW5 | 50S ribosomal protein L24 | 6.75e-03 | NA | NA | 0.7106 |
| 6. F | Q759T6 | Transcription elongation factor SPT5 | 1.05e-01 | NA | NA | 0.2965 |
| 6. F | Q5ZI08 | Transcription elongation factor SPT5 | 1.78e-01 | NA | NA | 0.3384 |
| 6. F | A7H645 | 50S ribosomal protein L24 | 1.96e-03 | NA | NA | 0.6353 |
| 6. F | Q56435 | 50S ribosomal protein L24 | 5.90e-03 | NA | NA | 0.6008 |
| 6. F | Q72I15 | 50S ribosomal protein L24 | 5.98e-03 | NA | NA | 0.6002 |
| 6. F | Q6FRZ5 | Transcription elongation factor SPT5 | 1.66e-01 | NA | NA | 0.3361 |
| 6. F | P49560 | 50S ribosomal protein L24, chloroplastic | 1.84e-03 | NA | NA | 0.6431 |
| 6. F | P60745 | 50S ribosomal protein L24 | 7.32e-05 | NA | NA | 0.6407 |
| 6. F | Q6L1B6 | 50S ribosomal protein L24 | 9.22e-03 | NA | NA | 0.7141 |
| 6. F | Q6BZG0 | Transcription elongation factor SPT5 | 1.28e-01 | NA | NA | 0.2766 |
| 6. F | Q6MPB7 | 50S ribosomal protein L24 | 4.58e-03 | NA | NA | 0.6946 |
| 6. F | Q6NU07 | G-patch domain and KOW motifs-containing protein | 1.75e-01 | NA | NA | 0.7924 |
| 6. F | Q4PIC4 | Transcription elongation factor SPT5 | 1.76e-01 | NA | NA | 0.3699 |
| 6. F | O59429 | 50S ribosomal protein L24 | 1.70e-02 | NA | NA | 0.7072 |