Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX55004.1
JCVISYN3A_0853
Uncharacterized protein.
M. mycoides homolog: NA.
TIGRfam Classification: 1=Unknown.
Category: Nonessential.
Statistics
Total GO Annotation: 114
Unique PROST Go: 11
Unique BLAST Go: 0
Unique Foldseek Go: 103
Total Homologs: 242
Unique PROST Homologs: 15
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 227
Literature
Danchin and Fang [1]: energy-sensing regulator of translation|four possible paralogs in B. subtilis
Yang and Tsui [2]: Inactive ribonuclease PH
Antczak et al. [3]: Hypothetical protein
Zhang et al. [4]: GO:0090563|protein-phosphocysteine-sugar phosphotransferase activity
Bianchi et al. [5]: Unclear
Structures and Sequence Alignment
The best structural homolog that predicted by 6. F was
P39751
(Cell shape-determining protein Mbl) with a FATCAT P-Value: 2.12e-13 and RMSD of 3.05 angstrom. The sequence alignment identity is 20.9%.
Structural alignment shown in left. Query protein AVX55004.1 colored as red in alignment, homolog P39751 colored as blue.
Query protein AVX55004.1 is also shown in right top, homolog P39751 showed in right bottom. They are colored based on secondary structures.
AVX55004.1 MIYID--FDWNIVNIWDEDELI--KSEKALILRD----LLTKN---IIAIGNDTDEEM--RKPKNFLSINCTENRKITSFEDLEIRIKKLLEDNKIKEYK 87 P39751 MFARDIGIDLGTANV-----LIHVKG-KGIVLNEPSVVALDKNSGKVLAVGEEA-RRMVGRTPGNIVAIRPLKDGVIADFEVTEAMLKHFI--NKLN-VK 90 AVX55004.1 -LVNRYSEYI--P-NLNTINEIEFLKKIS-KD--YDYYVELRNDE---------IVIFN---NL-------TNEIKTIKKGRAYLQHYIQSI---F---Y 155 P39751 GLFSKPRMLICCPTNITSV-EQKAIKEAAEKSGGKHVYLE---EEPKVAAIGAGMEIFQPSGNMVVDIGGGTTDIAVISMGDIVTSSSIKMAGDKFDMEI 186 AVX55004.1 LNYQATLNTKKSWDLIKLINQK--QEIK----TV--------VC---RSFITG---T------DID--IQ-----ILN--KDFL--T------NVFQQ-V 211 P39751 LNY-----IKREYKL--LIGERTAEDIKIKVATVFPDARHEEISIRGRDMVSGLPRTITVNSKEVEEALRESVAVIVQAAKQVLERTPPELSADIIDRGV 279 AVX55004.1 NV----EVNNLLD--LTKKIKYDQKYMEN-FNCVR------------------- 239 P39751 IITGGGALLNGLDQLLAEELKVPVLVAENPMDCVAIGTGVMLDNMDKLPKRKLS 333
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 5. P | GO:0070402 | NADPH binding |
| 5. P | GO:0006231 | dTMP biosynthetic process |
| 5. P | GO:0050797 | thymidylate synthase (FAD) activity |
| 5. P | GO:0006235 | dTTP biosynthetic process |
| 5. P | GO:0050660 | flavin adenine dinucleotide binding |
| 5. P | GO:0005198 | structural molecule activity |
| 5. P | GO:0004799 | thymidylate synthase activity |
| 5. P | GO:0039679 | viral occlusion body |
| 5. P | GO:0044204 | host cell nuclear matrix |
| 5. P | GO:0032259 | methylation |
| 5. P | GO:0039540 | suppression by virus of host viral-induced cytoplasmic pattern recognition receptor signaling pathway via inhibition of host RIG-I activity |
| 6. F | GO:0051621 | regulation of norepinephrine uptake |
| 6. F | GO:0032432 | actin filament bundle |
| 6. F | GO:0006551 | leucine metabolic process |
| 6. F | GO:0001725 | stress fiber |
| 6. F | GO:0019901 | protein kinase binding |
| 6. F | GO:0006338 | chromatin remodeling |
| 6. F | GO:0005865 | striated muscle thin filament |
| 6. F | GO:0030240 | skeletal muscle thin filament assembly |
| 6. F | GO:0030027 | lamellipodium |
| 6. F | GO:0051492 | regulation of stress fiber assembly |
| 6. F | GO:0005200 | structural constituent of cytoskeleton |
| 6. F | GO:0007409 | axonogenesis |
| 6. F | GO:0005912 | adherens junction |
| 6. F | GO:0044305 | calyx of Held |
| 6. F | GO:0030016 | myofibril |
| 6. F | GO:0060047 | heart contraction |
| 6. F | GO:0031493 | obsolete nucleosomal histone binding |
| 6. F | GO:1903076 | regulation of protein localization to plasma membrane |
| 6. F | GO:0001411 | hyphal tip |
| 6. F | GO:0030175 | filopodium |
| 6. F | GO:0046872 | metal ion binding |
| 6. F | GO:0050998 | nitric-oxide synthase binding |
| 6. F | GO:1902396 | protein localization to bicellular tight junction |
| 6. F | GO:0048488 | synaptic vesicle endocytosis |
| 6. F | GO:0004402 | histone acetyltransferase activity |
| 6. F | GO:0055003 | cardiac myofibril assembly |
| 6. F | GO:0051382 | kinetochore assembly |
| 6. F | GO:0030479 | actin cortical patch |
| 6. F | GO:0008360 | regulation of cell shape |
| 6. F | GO:0000812 | Swr1 complex |
| 6. F | GO:0007015 | actin filament organization |
| 6. F | GO:0019894 | kinesin binding |
| 6. F | GO:0006897 | endocytosis |
| 6. F | GO:0005925 | focal adhesion |
| 6. F | GO:0036156 | inner dynein arm |
| 6. F | GO:0048870 | cell motility |
| 6. F | GO:0071896 | protein localization to adherens junction |
| 6. F | GO:0043486 | histone exchange |
| 6. F | GO:0042802 | identical protein binding |
| 6. F | GO:0030476 | ascospore wall assembly |
| 6. F | GO:0005869 | dynactin complex |
| 6. F | GO:0098978 | glutamatergic synapse |
| 6. F | GO:0097433 | dense body |
| 6. F | GO:0000142 | cellular bud neck contractile ring |
| 6. F | GO:0035267 | NuA4 histone acetyltransferase complex |
| 6. F | GO:0000011 | vacuole inheritance |
| 6. F | GO:0043296 | apical junction complex |
| 6. F | GO:0007163 | establishment or maintenance of cell polarity |
| 6. F | GO:0000902 | cell morphogenesis |
| 6. F | GO:0033275 | actin-myosin filament sliding |
| 6. F | GO:0032091 | negative regulation of protein binding |
| 6. F | GO:0098685 | Schaffer collateral - CA1 synapse |
| 6. F | GO:0097014 | ciliary plasm |
| 6. F | GO:0010631 | epithelial cell migration |
| 6. F | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 6. F | GO:0032991 | protein-containing complex |
| 6. F | GO:0090131 | mesenchyme migration |
| 6. F | GO:0044297 | cell body |
| 6. F | GO:0005884 | actin filament |
| 6. F | GO:0120081 | obsolete positive regulation of microfilament motor activity |
| 6. F | GO:0009306 | protein secretion |
| 6. F | GO:0045176 | apical protein localization |
| 6. F | GO:0005885 | Arp2/3 protein complex |
| 6. F | GO:0010628 | positive regulation of gene expression |
| 6. F | GO:0031013 | troponin I binding |
| 6. F | GO:1902404 | mitotic actomyosin contractile ring contraction |
| 6. F | GO:0120192 | tight junction assembly |
| 6. F | GO:1990904 | ribonucleoprotein complex |
| 6. F | GO:0022898 | regulation of transmembrane transporter activity |
| 6. F | GO:0120220 | basal body patch |
| 6. F | GO:0150111 | regulation of transepithelial transport |
| 6. F | GO:0005524 | ATP binding |
| 6. F | GO:0034333 | adherens junction assembly |
| 6. F | GO:0034599 | cellular response to oxidative stress |
| 6. F | GO:0031011 | Ino80 complex |
| 6. F | GO:0070160 | tight junction |
| 6. F | GO:0030957 | Tat protein binding |
| 6. F | GO:0001738 | morphogenesis of a polarized epithelium |
| 6. F | GO:0031491 | nucleosome binding |
| 6. F | GO:0030017 | sarcomere |
| 6. F | GO:0015629 | actin cytoskeleton |
| 6. F | GO:0070359 | actin polymerization-dependent cell motility involved in migration of symbiont in host |
| 6. F | GO:0031941 | filamentous actin |
| 6. F | GO:0048741 | skeletal muscle fiber development |
| 6. F | GO:0005737 | cytoplasm |
| 6. F | GO:0000146 | microfilament motor activity |
| 6. F | GO:0030424 | axon |
| 6. F | GO:0034314 | Arp2/3 complex-mediated actin nucleation |
| 6. F | GO:0005522 | profilin binding |
| 6. F | GO:0030010 | establishment of cell polarity |
| 6. F | GO:0005856 | cytoskeleton |
| 6. F | GO:0110148 | biomineralization |
| 6. F | GO:0016226 | iron-sulfur cluster assembly |
| 6. F | GO:0051893 | regulation of focal adhesion assembly |
| 6. F | GO:0090303 | positive regulation of wound healing |
| 6. F | GO:0032036 | myosin heavy chain binding |
| 6. F | GO:0098871 | postsynaptic actin cytoskeleton |
| 6. F | GO:0017022 | myosin binding |
| 6. F | GO:0030863 | cortical cytoskeleton |
| 6. F | GO:0098973 | structural constituent of postsynaptic actin cytoskeleton |
| 6. F | GO:0045214 | sarcomere organization |
| 6. F | GO:0072749 | cellular response to cytochalasin B |
| 6. F | GO:0098723 | skeletal muscle myofibril |
Uniprot GO Annotations
| GO | Description |
|---|
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 5. P | Q775T6 | 27 kDa core protein | NA | 5.36e-03 | NA | NA |
| 5. P | O28187 | Uncharacterized protein AF_2093 | 1.46e-01 | 1.24e-02 | NA | NA |
| 5. P | P21699 | Non-structural protein NS-S | NA | 1.78e-02 | NA | NA |
| 5. P | P06503 | Granulin | NA | 9.47e-04 | NA | NA |
| 5. P | P04871 | Polyhedrin | NA | 4.89e-03 | NA | NA |
| 5. P | Q8ZWD6 | Flavin-dependent thymidylate synthase | 1.44e-01 | 4.33e-03 | NA | NA |
| 5. P | Q66112 | Granulin | NA | 4.65e-03 | NA | NA |
| 5. P | Q9Z994 | Uncharacterized protein CPn_0087/CP_0687/CPj0087/CpB0087 | 3.08e-01 | 2.09e-03 | NA | NA |
| 5. P | P87577 | Granulin | NA | 1.17e-02 | NA | NA |
| 5. P | O86840 | Flavin-dependent thymidylate synthase | 3.25e-01 | 2.46e-02 | NA | NA |
| 5. P | O18559 | Granulin | NA | 1.65e-02 | NA | NA |
| 5. P | B9KBK3 | Flavin-dependent thymidylate synthase | 2.51e-01 | 1.85e-02 | NA | NA |
| 5. P | O12705 | Granulin | NA | 1.25e-03 | NA | NA |
| 5. P | A8F7Q7 | Flavin-dependent thymidylate synthase | 3.18e-01 | 7.65e-03 | NA | NA |
| 5. P | Q8V2R6 | 27 kDa core protein | NA | 5.36e-03 | NA | NA |
| 6. F | A0A0H3C7V4 | Cell shape-determining protein MreB | 9.72e-13 | NA | NA | 0.6564 |
| 6. F | P04751 | Actin, alpha cardiac muscle 1 | 7.36e-06 | NA | NA | 0.5528 |
| 6. F | O15998 | Actin, muscle | 7.08e-06 | NA | NA | 0.5663 |
| 6. F | P53475 | Actin, muscle | 6.85e-06 | NA | NA | 0.5512 |
| 6. F | Q5R9Q5 | Actin, alpha skeletal muscle | 7.09e-06 | NA | NA | 0.5595 |
| 6. F | Q9URS0 | Actin, gamma | 6.75e-06 | NA | NA | 0.5205 |
| 6. F | Q0PGG4 | Actin, cytoplasmic 1 | 6.33e-06 | NA | NA | 0.559 |
| 6. F | P04752 | Actin, alpha skeletal muscle 3 | 7.06e-06 | NA | NA | 0.5568 |
| 6. F | P63256 | Actin, cytoplasmic 2 | 6.83e-06 | NA | NA | 0.5771 |
| 6. F | P48465 | Actin | 6.38e-06 | NA | NA | 0.5571 |
| 6. F | P14883 | Actin-2 | 1.12e-05 | NA | NA | 0.5125 |
| 6. F | A5CX56 | Chaperone protein DnaK | 1.48e-03 | NA | NA | 0.5493 |
| 6. F | P69004 | Actin-15B | 6.43e-06 | NA | NA | 0.5713 |
| 6. F | P53499 | Actin | 8.97e-06 | NA | NA | 0.5429 |
| 6. F | Q3IFG5 | Chaperone protein HscA homolog | 1.04e-04 | NA | NA | 0.5359 |
| 6. F | P68139 | Actin, alpha skeletal muscle | 7.16e-06 | NA | NA | 0.5545 |
| 6. F | P17128 | Actin | 6.34e-06 | NA | NA | 0.5661 |
| 6. F | P10990 | Actin-15A | 6.68e-06 | NA | NA | 0.5716 |
| 6. F | P53476 | Actin | 6.14e-06 | NA | NA | 0.5477 |
| 6. F | P20904 | Actin | 6.35e-06 | NA | NA | 0.5586 |
| 6. F | P68140 | Actin, alpha skeletal muscle A | 7.00e-06 | NA | NA | 0.5581 |
| 6. F | Q9P4D1 | Actin | 5.96e-06 | NA | NA | 0.5818 |
| 6. F | P53483 | Actin, alpha anomalous | 6.28e-06 | NA | NA | 0.5542 |
| 6. F | Q7RME1 | Actin-1 | 5.88e-06 | NA | NA | 0.5924 |
| 6. F | Q4R317 | Actin-related protein T2 | 1.18e-05 | NA | NA | 0.5457 |
| 6. F | P53504 | Actin-1 | 6.18e-06 | NA | NA | 0.5601 |
| 6. F | P41112 | Actin-1/2 | 6.71e-06 | NA | NA | 0.57 |
| 6. F | Q98972 | Actin, alpha skeletal muscle | 7.40e-06 | NA | NA | 0.5755 |
| 6. F | P0DSO6 | MamK-like protein | 9.22e-08 | NA | NA | 0.6152 |
| 6. F | Q6QAQ1 | Actin, cytoplasmic 1 | 6.36e-06 | NA | NA | 0.5578 |
| 6. F | P68555 | Actin | 6.20e-06 | NA | NA | 0.5752 |
| 6. F | P46258 | Actin-3 | 6.76e-06 | NA | NA | 0.5773 |
| 6. F | P53482 | Actin, alpha skeletal muscle B | 7.12e-06 | NA | NA | 0.5484 |
| 6. F | A2WNB0 | Actin-related protein 6 | 4.88e-06 | NA | NA | 0.4313 |
| 6. F | P86288 | Actin-2 | 5.22e-06 | NA | NA | 0.5423 |
| 6. F | P92179 | Actin, cytoplasmic | 6.52e-06 | NA | NA | 0.5755 |
| 6. F | Q9DEE9 | Actin-related protein 6 | 2.06e-06 | NA | NA | 0.4384 |
| 6. F | P18603 | Actin, clone 403 | 6.65e-06 | NA | NA | 0.5749 |
| 6. F | Q964E0 | Actin, cytoplasmic | 6.92e-06 | NA | NA | 0.5682 |
| 6. F | A9BWU9 | Chaperone protein HscA homolog | 8.77e-05 | NA | NA | 0.5584 |
| 6. F | P14235 | Actin | 6.55e-06 | NA | NA | 0.5552 |
| 6. F | P49128 | Actin-1 | 6.58e-06 | NA | NA | 0.5608 |
| 6. F | Q93132 | Actin, muscle | 5.96e-06 | NA | NA | 0.5453 |
| 6. F | P60713 | Actin, cytoplasmic 1 | 6.79e-06 | NA | NA | 0.5598 |
| 6. F | Q9Y896 | Actin-2 | 6.68e-06 | NA | NA | 0.5422 |
| 6. F | P0A9X7 | Cell shape-determining protein MreB | 5.77e-13 | NA | NA | 0.6579 |
| 6. F | P69003 | Actin CyI, cytoplasmic | 6.34e-06 | NA | NA | 0.5567 |
| 6. F | Q00215 | Actin, cytoplasmic | 6.74e-06 | NA | NA | 0.5611 |
| 6. F | O74258 | Actin | 5.79e-06 | NA | NA | 0.5503 |
| 6. F | Q9UVF3 | Actin | 5.72e-06 | NA | NA | 0.5521 |
| 6. F | P02578 | Actin-1 | 6.43e-06 | NA | NA | 0.5639 |
| 6. F | P12717 | Actin, muscle | 6.37e-06 | NA | NA | 0.5692 |
| 6. F | P0A9X8 | Cell shape-determining protein MreB | 4.96e-13 | NA | NA | 0.6341 |
| 6. F | Q711N9 | Actin, cytoplasmic 1 | 6.32e-06 | NA | NA | 0.5775 |
| 6. F | P53469 | Actin, cytoplasmic | 6.12e-06 | NA | NA | 0.5581 |
| 6. F | P91754 | Actin (Fragment) | 5.95e-06 | NA | NA | 0.5596 |
| 6. F | P53498 | Actin | 6.54e-06 | NA | NA | 0.5483 |
| 6. F | P30167 | Actin-58 | 6.27e-06 | NA | NA | 0.5745 |
| 6. F | Q9UVW9 | Actin, gamma | 7.09e-06 | NA | NA | 0.5664 |
| 6. F | P53466 | Actin, cytoskeletal 2 | 6.89e-06 | NA | NA | 0.5598 |
| 6. F | P60009 | Actin | 6.39e-06 | NA | NA | 0.5567 |
| 6. F | Q03341 | Actin-2 | 6.49e-06 | NA | NA | 0.5527 |
| 6. F | Q6CSB9 | Actin-related protein 4 | 8.42e-05 | NA | NA | 0.5166 |
| 6. F | P10992 | Actin, macronuclear | 6.94e-06 | NA | NA | 0.5569 |
| 6. F | P53465 | Actin, cytoskeletal 1 | 5.73e-06 | NA | NA | 0.5479 |
| 6. F | A2BDB0 | Actin, cytoplasmic 2 | 6.86e-06 | NA | NA | 0.5635 |
| 6. F | Q5R1X3 | Actin, cytoplasmic 1 | 6.87e-06 | NA | NA | 0.573 |
| 6. F | Q1AXX6 | Chaperone protein DnaK | 1.35e-04 | NA | NA | 0.4974 |
| 6. F | A2XNS1 | Actin-3 | 7.32e-06 | NA | NA | 0.5741 |
| 6. F | C5CXC5 | Chaperone protein HscA homolog | 6.02e-04 | NA | NA | 0.5726 |
| 6. F | P0CM05 | Actin-like protein ARP6 | 2.71e-05 | NA | NA | 0.4562 |
| 6. F | P20359 | Actin, gamma | 6.69e-06 | NA | NA | 0.5605 |
| 6. F | P69002 | Actin CyI, cytoplasmic | 6.44e-06 | NA | NA | 0.5662 |
| 6. F | P11426 | Actin | 6.12e-06 | NA | NA | 0.5599 |
| 6. F | Q76N69 | Actin, cytoplasmic 1 | 6.92e-06 | NA | NA | 0.5769 |
| 6. F | P41339 | Actin, acrosomal process isoform | 6.52e-06 | NA | NA | 0.5759 |
| 6. F | P45520 | Actin | 6.47e-06 | NA | NA | 0.5489 |
| 6. F | P62740 | Actin, aortic smooth muscle | 7.11e-06 | NA | NA | 0.5537 |
| 6. F | P20399 | Actin, alpha cardiac muscle 2 | 7.39e-06 | NA | NA | 0.553 |
| 6. F | P26198 | Actin, muscle | 6.67e-06 | NA | NA | 0.5484 |
| 6. F | P53458 | Actin-5 (Fragment) | 6.16e-06 | NA | NA | 0.5706 |
| 6. F | P10988 | Actin-1 | 5.65e-06 | NA | NA | 0.561 |
| 6. F | P30173 | Actin-101 | 6.26e-06 | NA | NA | 0.5729 |
| 6. F | P26183 | Actin | 9.53e-06 | NA | NA | 0.5609 |
| 6. F | Q964E2 | Actin, cytoplasmic | 6.64e-06 | NA | NA | 0.5564 |
| 6. F | P68135 | Actin, alpha skeletal muscle | 6.66e-06 | NA | NA | 0.5658 |
| 6. F | P53460 | Actin, muscle 1A | 7.34e-06 | NA | NA | 0.5565 |
| 6. F | Q6NE59 | Actin-like protein MamK | 7.18e-11 | NA | NA | 0.5902 |
| 6. F | Q75D00 | Actin | 6.54e-06 | NA | NA | 0.5806 |
| 6. F | P49871 | Actin, muscle | 6.64e-06 | NA | NA | 0.5682 |
| 6. F | P13363 | Actin | 6.67e-06 | NA | NA | 0.5552 |
| 6. F | Q8X119 | Actin | 6.53e-06 | NA | NA | 0.5723 |
| 6. F | Q9Y701 | Actin-1 | 6.38e-06 | NA | NA | 0.548 |
| 6. F | P55805 | Actin, cytoplasmic | 7.05e-06 | NA | NA | 0.5454 |
| 6. F | Q6BXN0 | Actin-related protein 4 | 4.38e-08 | NA | NA | 0.4938 |
| 6. F | Q2U7A3 | Actin | 1.08e-05 | NA | NA | 0.5843 |
| 6. F | P0C542 | Actin-7 | 6.71e-06 | NA | NA | 0.5756 |
| 6. F | Q3ZC07 | Actin, alpha cardiac muscle 1 | 7.22e-06 | NA | NA | 0.5763 |
| 6. F | P53505 | Actin, cytoplasmic type 5 | 6.72e-06 | NA | NA | 0.5571 |
| 6. F | Q01465 | Cell shape-determining protein MreB | 2.24e-13 | NA | NA | 0.6537 |
| 6. F | P78711 | Actin | 6.58e-06 | NA | NA | 0.5613 |
| 6. F | P43239 | Actin-1 | 6.91e-06 | NA | NA | 0.5701 |
| 6. F | P53479 | Actin, alpha skeletal muscle | 7.48e-06 | NA | NA | 0.573 |
| 6. F | P84184 | Actin-A3b, cytoplasmic | 6.68e-06 | NA | NA | 0.5791 |
| 6. F | P0CM04 | Actin-like protein ARP6 | 3.20e-05 | NA | NA | 0.4432 |
| 6. F | O93400 | Actin, cytoplasmic 1 | 6.16e-06 | NA | NA | 0.5679 |
| 6. F | Q5ZMQ2 | Actin, cytoplasmic 2 | 6.66e-06 | NA | NA | 0.5771 |
| 6. F | P53472 | Actin, cytoskeletal 1A | 6.79e-06 | NA | NA | 0.5646 |
| 6. F | A1W7T4 | Chaperone protein HscA homolog | 6.06e-05 | NA | NA | 0.5583 |
| 6. F | P10993 | Actin, cytoplasmic | 6.67e-06 | NA | NA | 0.5572 |
| 6. F | P08023 | Actin, aortic smooth muscle | 6.93e-06 | NA | NA | 0.562 |
| 6. F | Q90X97 | Actin, alpha skeletal muscle | 8.34e-06 | NA | NA | 0.5675 |
| 6. F | P17304 | Actin, muscle | 6.74e-06 | NA | NA | 0.5686 |
| 6. F | Q71FK5 | Actin, cytoplasmic 1 | 7.03e-06 | NA | NA | 0.558 |
| 6. F | Q32L91 | Actin-like protein 7B | 2.02e-05 | NA | NA | 0.5783 |
| 6. F | P51775 | Actin | 2.53e-05 | NA | NA | 0.5311 |
| 6. F | Q5JAK2 | Actin, cytoplasmic 2 | 6.69e-06 | NA | NA | 0.5632 |
| 6. F | P26197 | Actin-2 | 7.46e-06 | NA | NA | 0.5648 |
| 6. F | P63257 | Actin, cytoplasmic 2 | 6.69e-06 | NA | NA | 0.5708 |
| 6. F | P53463 | Actin, cytoskeletal | 7.06e-06 | NA | NA | 0.5748 |
| 6. F | P0C539 | Actin-2 | 6.38e-06 | NA | NA | 0.5167 |
| 6. F | P23343 | Actin-1 | 1.10e-05 | NA | NA | 0.5456 |
| 6. F | Q6P640 | Actin, alpha cardiac muscle 1 | 7.14e-06 | NA | NA | 0.5593 |
| 6. F | Q93129 | Actin, cytoplasmic | 6.56e-06 | NA | NA | 0.5624 |
| 6. F | P60706 | Actin, cytoplasmic 1 | 6.47e-06 | NA | NA | 0.5771 |
| 6. F | P30171 | Actin-97 | 6.07e-06 | NA | NA | 0.518 |
| 6. F | A3MWN5 | Crenactin | 1.16e-05 | NA | NA | 0.528 |
| 6. F | Q39758 | Actin | 7.31e-06 | NA | NA | 0.5386 |
| 6. F | P17126 | Actin, non-muscle 6.2 | 6.41e-06 | NA | NA | 0.5771 |
| 6. F | P68034 | Actin, alpha cardiac muscle 1 | 7.06e-06 | NA | NA | 0.5702 |
| 6. F | P44474 | Cell shape-determining protein MreB | 7.13e-13 | NA | NA | 0.636 |
| 6. F | Q99023 | Actin | 6.48e-06 | NA | NA | 0.5506 |
| 6. F | P12432 | Actin A | 6.84e-06 | NA | NA | 0.5275 |
| 6. F | Q07903 | Actin, cytoskeletal 2A | 6.30e-06 | NA | NA | 0.5708 |
| 6. F | P18499 | Actin, cytoskeletal 3B | 6.53e-06 | NA | NA | 0.5561 |
| 6. F | Q9UVZ8 | Actin | 6.20e-06 | NA | NA | 0.5626 |
| 6. F | P68137 | Actin, alpha skeletal muscle | 7.20e-06 | NA | NA | 0.5561 |
| 6. F | P39751 | Cell shape-determining protein Mbl | 2.12e-13 | NA | NA | 0.6412 |
| 6. F | P78712 | Actin-related protein 3 | 6.60e-07 | NA | NA | 0.498 |
| 6. F | P32444 | Cell shape-determining protein Mbl | 2.32e-13 | NA | NA | 0.6235 |
| 6. F | P53464 | Actin, cytoskeletal | 6.24e-06 | NA | NA | 0.5386 |
| 6. F | P53486 | Actin, cytoplasmic 3 | 6.51e-06 | NA | NA | 0.5611 |
| 6. F | O17320 | Actin | 6.51e-06 | NA | NA | 0.5604 |
| 6. F | Q4YU79 | Actin-2 | 6.53e-06 | NA | NA | 0.5339 |
| 6. F | P83750 | Actin, cytoplasmic 1 | 6.70e-06 | NA | NA | 0.5773 |
| 6. F | Q8JJB8 | Actin, cytoplasmic 2 | 6.52e-06 | NA | NA | 0.5708 |
| 6. F | P53455 | Actin | 6.33e-06 | NA | NA | 0.54 |
| 6. F | P63258 | Actin, cytoplasmic 2 | 6.76e-06 | NA | NA | 0.563 |
| 6. F | P69005 | Actin, cytoskeletal 2B | 6.60e-06 | NA | NA | 0.5635 |
| 6. F | O00937 | Actin | 6.09e-06 | NA | NA | 0.5926 |
| 6. F | P53456 | Actin-2 | 6.71e-06 | NA | NA | 0.5707 |
| 6. F | P27130 | Actin, muscle 2/4/4A | 7.09e-06 | NA | NA | 0.5547 |
| 6. F | Q00214 | Actin, muscle | 9.14e-06 | NA | NA | 0.5565 |
| 6. F | Q6P8G3 | Actin, alpha sarcomeric/skeletal | 6.96e-06 | NA | NA | 0.5684 |
| 6. F | Q4R821 | Actin-related protein T1 | 1.01e-09 | NA | NA | 0.5436 |
| 6. F | P68143 | Actin, cytoplasmic 1 | 7.04e-06 | NA | NA | 0.5696 |
| 6. F | P53502 | Actin | 6.36e-06 | NA | NA | 0.5804 |
| 6. F | P53459 | Actin-6 (Fragment) | 5.75e-06 | NA | NA | 0.5633 |
| 6. F | Q4Z1L3 | Actin-1 | 6.11e-06 | NA | NA | 0.5245 |
| 6. F | P22132 | Actin-2 | 6.60e-06 | NA | NA | 0.5591 |
| 6. F | P60011 | Actin | 6.21e-06 | NA | NA | 0.5895 |
| 6. F | P79818 | Actin, cytoplasmic 1 | 6.41e-06 | NA | NA | 0.563 |
| 6. F | A4IFE3 | Beta-centractin | 9.63e-05 | NA | NA | 0.5236 |
| 6. F | P53480 | Actin, alpha cardiac muscle | 7.18e-06 | NA | NA | 0.5506 |
| 6. F | P0A9X6 | Cell shape-determining protein MreB | 5.56e-13 | NA | NA | 0.6436 |
| 6. F | Q8ILW9 | Actin-2 | 6.28e-06 | NA | NA | 0.5495 |
| 6. F | B9MIT4 | Chaperone protein HscA homolog | 6.72e-05 | NA | NA | 0.5253 |
| 6. F | Q9UVX4 | Actin | 6.91e-06 | NA | NA | 0.5626 |
| 6. F | P86287 | Actin-1 | 7.01e-06 | NA | NA | 0.5583 |
| 6. F | Q4L0Y2 | Actin, cytoplasmic 1 | 6.56e-06 | NA | NA | 0.5705 |
| 6. F | P0A9X5 | Cell shape-determining protein MreB | 5.21e-13 | NA | NA | 0.6314 |
| 6. F | Q61WW9 | Actin-related protein 3 | 1.82e-05 | NA | NA | 0.4905 |
| 6. F | P53485 | Actin, cytoplasmic 2 | 6.91e-06 | NA | NA | 0.575 |
| 6. F | P50138 | Actin | 7.31e-06 | NA | NA | 0.5313 |
| 6. F | P53474 | Actin, cytoskeletal 3A | 6.63e-06 | NA | NA | 0.5704 |
| 6. F | P30162 | Actin-1 | 6.64e-06 | NA | NA | 0.5755 |
| 6. F | P68264 | Actin, alpha skeletal muscle | 7.06e-06 | NA | NA | 0.55 |
| 6. F | Q5R6G0 | Actin, cytoplasmic 1 | 6.76e-06 | NA | NA | 0.5689 |
| 6. F | O18840 | Actin, cytoplasmic 1 | 6.88e-06 | NA | NA | 0.5633 |
| 6. F | P53457 | Actin-3 | 6.79e-06 | NA | NA | 0.5711 |
| 6. F | Q6TCF2 | Actin | 6.56e-06 | NA | NA | 0.5284 |
| 6. F | O73723 | Actin-related protein 3 | 1.62e-05 | NA | NA | 0.5151 |
| 6. F | Q97B19 | Archaeal actin homolog | 1.33e-08 | NA | NA | 0.481 |
| 6. F | A1TPY4 | Chaperone protein HscA homolog | 3.90e-06 | NA | NA | 0.5697 |
| 6. F | P90689 | Actin | 6.99e-06 | NA | NA | 0.5603 |
| 6. F | Q25472 | Actin, muscle-type | 7.13e-06 | NA | NA | 0.5532 |
| 6. F | Q5U925 | 2-hydroxyisocaproyl-CoA dehydratase activator | 3.58e-03 | NA | NA | 0.4044 |
| 6. F | Q754G5 | Actin-related protein 4 | 3.02e-05 | NA | NA | 0.5219 |
| 6. F | P22131 | Actin-1 | 9.59e-06 | NA | NA | 0.5397 |
| 6. F | P83751 | Actin, cytoplasmic 1 | 6.59e-06 | NA | NA | 0.5699 |
| 6. F | P53471 | Actin-2 | 6.31e-06 | NA | NA | 0.577 |
| 6. F | O17502 | Actin, muscle | 6.71e-06 | NA | NA | 0.5459 |
| 6. F | Q9L6A3 | Cell shape-determining protein MreB | 1.13e-12 | NA | NA | 0.6667 |
| 6. F | P53500 | Actin | 7.09e-06 | NA | NA | 0.5294 |
| 6. F | P68556 | Actin-1/4 | 6.52e-06 | NA | NA | 0.5628 |
| 6. F | O65314 | Actin | 6.88e-06 | NA | NA | 0.543 |
| 6. F | P29751 | Actin, cytoplasmic 1 | 6.63e-06 | NA | NA | 0.5679 |
| 6. F | Q05214 | Actin | 6.66e-06 | NA | NA | 0.5661 |
| 6. F | A2XLF2 | Actin-1 | 6.40e-06 | NA | NA | 0.5758 |
| 6. F | Q26065 | Actin, adductor muscle | 6.19e-06 | NA | NA | 0.5703 |
| 6. F | P68138 | Actin, alpha skeletal muscle | 7.16e-06 | NA | NA | 0.5674 |
| 6. F | P49055 | Actin, alpha skeletal muscle | 7.08e-06 | NA | NA | 0.5666 |
| 6. F | P53689 | Actin | 6.38e-06 | NA | NA | 0.5604 |
| 6. F | Q4R6Q3 | Actin-like protein 7A | 2.62e-05 | NA | NA | 0.5456 |
| 6. F | Q9Y707 | Actin-2 | 6.95e-06 | NA | NA | 0.5538 |
| 6. F | P61162 | Alpha-centractin | 6.58e-05 | NA | NA | 0.5174 |
| 6. F | P02576 | Actin, plasmodial isoform | 6.72e-06 | NA | NA | 0.5677 |
| 6. F | P41113 | Actin-3 | 6.69e-06 | NA | NA | 0.576 |
| 6. F | P45885 | Actin-2, muscle-specific | 6.90e-06 | NA | NA | 0.574 |
| 6. F | O13419 | Actin | 6.70e-06 | NA | NA | 0.5318 |
| 6. F | P53473 | Actin, cytoskeletal 1B | 1.01e-05 | NA | NA | 0.5631 |
| 6. F | P10995 | Actin, alpha skeletal muscle 2 | 7.22e-06 | NA | NA | 0.5572 |
| 6. F | P41341 | Actin-11 | 6.57e-06 | NA | NA | 0.5771 |
| 6. F | P15475 | Actin, cytoplasmic 1 | 6.94e-06 | NA | NA | 0.5603 |
| 6. F | Q7RPB4 | Actin-2 | 5.96e-06 | NA | NA | 0.5337 |
| 6. F | P53470 | Actin-1 | 6.80e-06 | NA | NA | 0.5667 |
| 6. F | Q4R561 | Actin, cytoplasmic 1 | 6.45e-06 | NA | NA | 0.5777 |
| 6. F | P93375 | Actin-104 (Fragment) | 2.26e-05 | NA | NA | 0.5368 |
| 6. F | Q2W8Q6 | Actin-like protein MamK | 3.90e-11 | NA | NA | 0.6143 |
| 6. F | P10365 | Actin | 6.35e-06 | NA | NA | 0.5538 |
| 6. F | P53478 | Actin, cytoplasmic type 5 | 6.67e-06 | NA | NA | 0.5661 |
| 6. F | O18500 | Actin-2 | 6.86e-06 | NA | NA | 0.5619 |
| 6. F | P53468 | Actin, cytoplasmic | 6.00e-06 | NA | NA | 0.561 |
| 6. F | P84336 | Actin, cytoplasmic 1 | 6.00e-06 | NA | NA | 0.5632 |
| 6. F | Q8I4X0 | Actin-1 | 5.82e-06 | NA | NA | 0.5588 |
| 6. F | Q8SWN8 | Actin | 6.65e-06 | NA | NA | 0.5523 |
| 6. F | P39763 | Cell shape-determining protein MreBH | 3.48e-13 | NA | NA | 0.6413 |