Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX55006.1
JCVISYN3A_0870
Uncharacterized C4-dicarboxylate ABC transporter.
M. mycoides homolog: Q6MS63.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.
Statistics
Total GO Annotation: 59
Unique PROST Go: 37
Unique BLAST Go: 0
Unique Foldseek Go: 2
Total Homologs: 272
Unique PROST Homologs: 164
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 18
Literature
Danchin and Fang [1]: branched-chain aminoacid permease|CodY target in B. subtilis, supports balance of BCAA and purine derivatives
Yang and Tsui [2]: Membrane arginine transporter ArcD
Antczak et al. [3]: dcuC; C4-dicarboxylate anaerobic carrier dcuC
Zhang et al. [4]: GO:0015318|inorganic solute uptake transmembrane transporter activity
Bianchi et al. [5]: "Transporter, arginine/glutamate?"
Structures and Sequence Alignment
The best structural homolog that predicted by 4. PB was
P39263
(Putative basic amino acid antiporter YfcC) with a FATCAT P-Value: 2.54e-13 and RMSD of 2.28 angstrom. The sequence alignment identity is 26.7%.
Structural alignment shown in left. Query protein AVX55006.1 colored as red in alignment, homolog P39263 colored as blue.
Query protein AVX55006.1 is also shown in right top, homolog P39263 showed in right bottom. They are colored based on secondary structures.
AVX55006.1 MHIKVENTEMNNFNSNIKKKKRLKMLSSFSILLLIMLVLMLVSWILYWSKTKTDLVKTISFNDWKYDPILSPI--YNAWTSKYPNISAGNSQTW--IDFM 96 P39263 ---------MSAITES-KPTRRWAMPDT---LVIIFFVAIL-----------TSLA-T-----W----VV-PVGMFDSQEVQY-QVD-GQTKTRKVVD-- 61 AVX55006.1 NSNS-SLGWVYNSHGWIKDSYTIQ--HSGDAIFNGL--APIQPIGIIDVI-YAPIKGFVLKSNIIIFTISI-GAFLYILVSTKALE-GLSQAIIAKLKGK 188 P39263 -PHSFRI--LTNEAGE-PEYHRVQLFTTGDE-RPGLMNFPFE--GLTSGSKY----GTAV--GIIMFMLVIGGAF-GIVMRTGTIDNGI-LALIRHTRGN 146 AVX55006.1 EAFAIIP-LMLFFSIFGTVEGFAEETLGFYMIFIPIMLMAGFDVFTGVLILMVGAGTGVIGSTVNPFTIPIAVSAINSGIDASTAKLTIGDGLVWRIICW 287 P39263 E-ILFIPALFILFSLGGAVFGMGEEAVAFAIIIAPLMVRLGYDSITTVLVTYIATQIGFASSWMNPFCVVVA-----QGI-AGVPVLS-GSGL--RIVVW 236 AVX55006.1 LILTSFSTTFTLLYALKVKKNPSKSVTFSTL-EGDKEFF---LAHVSK---TIKLDWKKKVSLVAFAISFLVMIFYLVGWDSIFNNTKMADQAIWIKKNI 380 P39263 VIATLIGLIFTMVYASRVKKNP----LLSRVHESDR-FFREKQADVEQRPFTFG-DW-----LVLIVLT-AVMV-WVI-WGVIVN----A----WF---I 311 AVX55006.1 P-----YLT-ALIPGWGNGDLDNVAAFFLLASITLAIINSIGEATFIKKWFEGASDILSVAFIIATAAGVGYILVQTN--------LQSLFVKGILSSIG 466 P39263 PEIASQFFTMGLVIG-----I--IGVVFRLNGMT---VNTM-ASSFT----EGARMMIAPALLVGFAKGI--LLLVGNGEAGDASVLNTI-LNSIANAIS 393 AVX55006.1 GINNQTAK-VIVLF-IVFIPLAFLIPSSSGFATTIFPLLAKSLVDSKTNQLQAYASSGSIMAFTFAIGLVNLITPTSGVVM---GACSLSRMSYAKYLKA 561 P39263 GLDNAVAAWFMLLFQAVF---NFFVTSGSGQAALTMPLLA-PLGD-----LVGVNRQVTVLAFQFGDGFSHIIYPTSASLMATLGVC---RVDFRNWLKV 481 AVX55006.1 MLPIISYLFILCFILLLIGGALPDSIS-- 588 P39263 GATLLGLLFIMS-SVVVIGAQL---MGYH 506
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PBF | GO:0005886 | plasma membrane |
| 1. PBF | GO:0015297 | antiporter activity |
| 1. PBF | GO:0016021 | integral component of membrane |
| 2. PF | GO:0022857 | transmembrane transporter activity |
| 2. PF | GO:0015556 | C4-dicarboxylate transmembrane transporter activity |
| 2. PF | GO:0015137 | citrate transmembrane transporter activity |
| 2. PF | GO:0006101 | citrate metabolic process |
| 2. PF | GO:0005887 | integral component of plasma membrane |
| 2. PF | GO:0098656 | anion transmembrane transport |
| 2. PF | GO:0015128 | gluconate transmembrane transporter activity |
| 2. PF | GO:0015740 | C4-dicarboxylate transport |
| 2. PF | GO:0015295 | solute:proton symporter activity |
| 2. PF | GO:0046685 | response to arsenic-containing substance |
| 2. PF | GO:0006814 | sodium ion transport |
| 2. PF | GO:0015385 | sodium:proton antiporter activity |
| 2. PF | GO:0046177 | D-gluconate catabolic process |
| 2. PF | GO:0035429 | gluconate transmembrane transport |
| 2. PF | GO:0015105 | arsenite transmembrane transporter activity |
| 2. PF | GO:0019521 | D-gluconate metabolic process |
| 2. PF | GO:0015129 | lactate transmembrane transporter activity |
| 5. P | GO:0110146 | magnetosome membrane |
| 5. P | GO:0005469 | succinate:fumarate antiporter activity |
| 5. P | GO:0015814 | p-aminobenzoyl-glutamate transport |
| 5. P | GO:0015558 | secondary active p-aminobenzoyl-glutamate transmembrane transporter activity |
| 5. P | GO:0010226 | response to lithium ion |
| 5. P | GO:0015746 | citrate transport |
| 5. P | GO:0042942 | D-serine transport |
| 5. P | GO:0006848 | pyruvate transport |
| 5. P | GO:0046183 | L-idonate catabolic process |
| 5. P | GO:1902600 | proton transmembrane transport |
| 5. P | GO:1902604 | p-aminobenzoyl-glutamate transmembrane transport |
| 5. P | GO:0015568 | L-idonate transmembrane transporter activity |
| 5. P | GO:0015867 | ATP transport |
| 5. P | GO:0015362 | high-affinity sodium:dicarboxylate symporter activity |
| 5. P | GO:0015531 | citrate:proton symporter activity |
| 5. P | GO:0042960 | antimonite secondary active transmembrane transporter activity |
| 5. P | GO:0051452 | intracellular pH reduction |
| 5. P | GO:0042945 | D-serine transmembrane transporter activity |
| 5. P | GO:0015291 | secondary active transmembrane transporter activity |
| 5. P | GO:0050833 | pyruvate transmembrane transporter activity |
| 5. P | GO:0015293 | symporter activity |
| 5. P | GO:0015699 | antimonite transport |
| 5. P | GO:0019588 | anaerobic glycerol catabolic process |
| 5. P | GO:0019664 | mixed acid fermentation |
| 5. P | GO:0008340 | determination of adult lifespan |
| 5. P | GO:0008514 | organic anion transmembrane transporter activity |
| 5. P | GO:0008490 | arsenite secondary active transmembrane transporter activity |
| 5. P | GO:0005471 | ATP:ADP antiporter activity |
| 5. P | GO:0015744 | succinate transport |
| 5. P | GO:0010889 | regulation of sequestering of triglyceride |
| 5. P | GO:0015743 | malate transport |
| 5. P | GO:0015700 | arsenite transport |
| 5. P | GO:0015141 | succinate transmembrane transporter activity |
| 5. P | GO:0015491 | cation:cation antiporter activity |
| 5. P | GO:0015931 | nucleobase-containing compound transport |
| 5. P | GO:0015726 | L-idonate transmembrane transport |
| 5. P | GO:0015140 | malate transmembrane transporter activity |
| 6. F | GO:0008643 | carbohydrate transport |
| 6. F | GO:0006865 | amino acid transport |
Uniprot GO Annotations
| GO | Description |
|---|---|
| GO:0005886 | plasma membrane |
| GO:0016020 | membrane |
| GO:0016021 | integral component of membrane |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
| Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
|---|---|---|---|---|---|---|
| 1. PBF | P55908 | Uncharacterized protein YcgA | 0.00e+00 | 1.93e-19 | 1.72e-16 | 0.7908 |
| 1. PBF | P44023 | Uncharacterized protein HI_0594 | 0.00e+00 | 3.93e-37 | 9.01e-29 | 0.825 |
| 2. PF | Q0TD43 | L-tartrate/succinate antiporter | 3.85e-06 | 2.55e-08 | NA | 0.3706 |
| 2. PF | Q9KQU7 | Na(+)/H(+) antiporter NhaB | 3.26e-06 | 4.77e-06 | NA | 0.4578 |
| 2. PF | B1JLH7 | Na(+)/H(+) antiporter NhaB | 5.39e-06 | 1.83e-08 | NA | 0.4343 |
| 2. PF | Q1CJ89 | Na(+)/H(+) antiporter NhaB | 5.03e-06 | 2.06e-08 | NA | 0.4465 |
| 2. PF | Q6D4M9 | Na(+)/H(+) antiporter NhaB | 6.40e-06 | 1.03e-07 | NA | 0.4257 |
| 2. PF | B0KMR7 | Na(+)/H(+) antiporter NhaB | 3.79e-06 | 8.62e-09 | NA | 0.428 |
| 2. PF | B7MTW4 | Na(+)/H(+) antiporter NhaB | 4.57e-06 | 2.09e-07 | NA | 0.4423 |
| 2. PF | Q9K5Z9 | L-lactate permease | 2.63e-05 | 1.08e-03 | NA | 0.4207 |
| 2. PF | Q31ZM7 | Na(+)/H(+) antiporter NhaB | 4.79e-06 | 2.62e-07 | NA | 0.4296 |
| 2. PF | B7LXA0 | Na(+)/H(+) antiporter NhaB | 4.71e-06 | 2.62e-07 | NA | 0.4264 |
| 2. PF | B1IUA6 | Na(+)/H(+) antiporter NhaB | 4.71e-06 | 2.62e-07 | NA | 0.4255 |
| 2. PF | B2K3Q0 | Na(+)/H(+) antiporter NhaB | 5.31e-06 | 1.96e-08 | NA | 0.4308 |
| 2. PF | P0AB95 | Arsenical pump membrane protein | 1.66e-06 | 9.43e-06 | NA | 0.4516 |
| 2. PF | E1VBT7 | Na(+)/H(+) antiporter NhaD | 1.71e-05 | 1.21e-07 | NA | 0.3175 |
| 2. PF | Q12NQ8 | Na(+)/H(+) antiporter NhaB | 6.87e-06 | 4.59e-07 | NA | 0.4224 |
| 2. PF | B8EAH3 | Na(+)/H(+) antiporter NhaB | 5.76e-06 | 1.01e-06 | NA | 0.4396 |
| 2. PF | Q8CQF4 | Arsenical pump membrane protein | 1.70e-06 | 5.29e-05 | NA | 0.5103 |
| 2. PF | P08691 | Arsenical pump membrane protein | 1.74e-06 | 2.64e-06 | NA | 0.4476 |
| 2. PF | Q0HW68 | Na(+)/H(+) antiporter NhaB | 5.85e-06 | 2.33e-05 | NA | 0.4572 |
| 2. PF | A0KL08 | Na(+)/H(+) antiporter NhaB | 6.43e-06 | 1.01e-06 | NA | 0.4573 |
| 2. PF | P9WPD8 | Uncharacterized transporter MT2758 | 3.12e-07 | 8.84e-03 | NA | 0.4785 |
| 2. PF | P0ABP0 | Anaerobic C4-dicarboxylate transporter DcuB | 3.61e-06 | 2.76e-02 | NA | 0.4421 |
| 2. PF | Q8NW09 | Arsenical pump membrane protein | 1.69e-06 | 1.01e-04 | NA | 0.5173 |
| 2. PF | P55910 | L-lactate permease | 1.46e-05 | 1.32e-03 | NA | 0.4724 |
| 2. PF | A4TJC7 | Na(+)/H(+) antiporter NhaB | 6.70e-06 | 2.06e-08 | NA | 0.4467 |
| 2. PF | A8FW97 | Na(+)/H(+) antiporter NhaB | 6.23e-06 | 2.51e-06 | NA | 0.4406 |
| 2. PF | B4EXU4 | Na(+)/H(+) antiporter NhaB | 5.08e-06 | 4.74e-09 | NA | 0.4374 |
| 2. PF | Q01255 | Arsenical pump membrane protein | 1.98e-06 | 2.57e-04 | NA | 0.4961 |
| 2. PF | P52146 | Arsenical pump membrane protein | 1.32e-06 | 3.15e-05 | NA | 0.4447 |
| 2. PF | B6I9P7 | Na(+)/H(+) antiporter NhaB | 4.68e-06 | 2.62e-07 | NA | 0.4262 |
| 2. PF | Q15S32 | Na(+)/H(+) antiporter NhaB | 4.66e-06 | 1.22e-04 | NA | 0.4425 |
| 2. PF | P63620 | Arsenical pump membrane protein | 1.69e-06 | 6.49e-05 | NA | 0.5158 |
| 2. PF | P63619 | Arsenical pump membrane protein | 1.59e-06 | 6.49e-05 | NA | 0.513 |
| 2. PF | C3LNK5 | Na(+)/H(+) antiporter NhaB | 3.35e-06 | 4.77e-06 | NA | 0.447 |
| 2. PF | Q57493 | Uncharacterized transporter HI_0092 | 1.56e-06 | 3.01e-05 | NA | 0.4959 |
| 2. PF | A7ZKV7 | Na(+)/H(+) antiporter NhaB | 4.69e-06 | 2.62e-07 | NA | 0.4266 |
| 2. PF | Q8ED79 | Na(+)/H(+) antiporter NhaB | 5.52e-06 | 6.95e-05 | NA | 0.4565 |
| 2. PF | B5BI47 | Na(+)/H(+) antiporter NhaB | 4.57e-06 | 2.20e-07 | NA | 0.4515 |
| 2. PF | Q8FI24 | Na(+)/H(+) antiporter NhaB | 4.73e-06 | 2.56e-07 | NA | 0.4253 |
| 2. PF | Q74U12 | Na(+)/H(+) antiporter NhaB | 5.25e-06 | 2.06e-08 | NA | 0.4469 |
| 2. PF | Q4KBY6 | Na(+)/H(+) antiporter NhaB | 5.79e-06 | 6.10e-08 | NA | 0.4401 |
| 2. PF | Q083H3 | Na(+)/H(+) antiporter NhaB | 5.66e-06 | 2.59e-07 | NA | 0.4611 |
| 2. PF | B2TZB2 | Na(+)/H(+) antiporter NhaB | 4.92e-06 | 2.62e-07 | NA | 0.4448 |
| 2. PF | A7FI95 | Na(+)/H(+) antiporter NhaB | 6.74e-06 | 1.96e-08 | NA | 0.4346 |
| 2. PF | A4WBF5 | Na(+)/H(+) antiporter NhaB | 4.41e-06 | 8.74e-09 | NA | 0.4699 |
| 2. PF | A9R9D6 | Na(+)/H(+) antiporter NhaB | 6.54e-06 | 1.98e-08 | NA | 0.4319 |
| 2. PF | Q8FDG7 | L-tartrate/succinate antiporter | 4.56e-06 | 3.56e-08 | NA | 0.3755 |
| 2. PF | B5YXL0 | Na(+)/H(+) antiporter NhaB | 4.41e-06 | 2.62e-07 | NA | 0.4257 |
| 2. PF | A7ZZC0 | Na(+)/H(+) antiporter NhaB | 4.85e-06 | 2.62e-07 | NA | 0.4266 |
| 2. PF | B7LGU6 | Na(+)/H(+) antiporter NhaB | 4.59e-06 | 1.61e-06 | NA | 0.4643 |
| 2. PF | A4SN80 | Na(+)/H(+) antiporter NhaB | 5.80e-06 | 2.41e-05 | NA | 0.4614 |
| 2. PF | P55069 | Mg(2+)/citrate complex secondary transporter | 6.66e-07 | 1.80e-04 | NA | 0.4485 |
| 2. PF | Q32H30 | Na(+)/H(+) antiporter NhaB | 4.80e-06 | 2.62e-07 | NA | 0.4478 |
| 2. PF | P44855 | Anaerobic C4-dicarboxylate transporter DcuB | 6.26e-07 | 2.40e-03 | NA | 0.462 |
| 2. PF | P0AC95 | High-affinity gluconate transporter | 6.37e-06 | 1.34e-03 | NA | 0.4723 |
| 2. PF | P0AB94 | Arsenical pump membrane protein | 1.57e-06 | 9.43e-06 | NA | 0.4483 |
| 2. PF | A6VW03 | Na(+)/H(+) antiporter NhaB | 3.35e-06 | 4.63e-08 | NA | 0.4023 |
| 2. PF | Q9CPJ1 | Na(+)/H(+) antiporter NhaB | 5.06e-06 | 2.55e-10 | NA | 0.463 |
| 2. PF | P0ABP2 | Anaerobic C4-dicarboxylate transporter DcuB | 3.25e-06 | 2.76e-02 | NA | 0.4474 |
| 2. PF | Q5E6C7 | Glutamine transporter 1 | 7.63e-10 | 4.95e-04 | NA | 0.6464 |
| 2. PF | B7VLW5 | Na(+)/H(+) antiporter NhaB | 5.19e-06 | 6.68e-06 | NA | 0.4399 |
| 2. PF | C6DG45 | Na(+)/H(+) antiporter NhaB | 7.19e-06 | 1.98e-07 | NA | 0.4378 |
| 2. PF | Q6LNY8 | Na(+)/H(+) antiporter NhaB | 6.53e-06 | 7.03e-07 | NA | 0.46 |
| 2. PF | Q56EB3 | Na(+)/H(+) antiporter NhaD | 1.65e-05 | 9.32e-04 | NA | 0.3484 |
| 2. PF | Q7VKY3 | Na(+)/H(+) antiporter NhaB | 4.40e-06 | 3.64e-10 | NA | 0.4742 |
| 2. PF | Q8Z684 | Na(+)/H(+) antiporter NhaB | 5.00e-06 | 2.87e-07 | NA | 0.4509 |
| 2. PF | A5F6Z3 | Na(+)/H(+) antiporter NhaB | 3.20e-06 | 4.77e-06 | NA | 0.4544 |
| 2. PF | B4TXX6 | Na(+)/H(+) antiporter NhaB | 5.13e-06 | 2.06e-07 | NA | 0.485 |
| 2. PF | B7N3Z0 | Na(+)/H(+) antiporter NhaB | 4.41e-06 | 2.62e-07 | NA | 0.4266 |
| 2. PF | P44640 | Uncharacterized membrane protein HI_0325 | 2.78e-07 | 1.18e-03 | NA | 0.6302 |
| 2. PF | B5FFH5 | Na(+)/H(+) antiporter NhaB | 4.26e-06 | 3.08e-05 | NA | 0.4409 |
| 2. PF | B7MK83 | Na(+)/H(+) antiporter NhaB | 4.77e-06 | 2.09e-07 | NA | 0.4401 |
| 2. PF | Q7N3Z4 | Na(+)/H(+) antiporter NhaB | 1.77e-04 | 3.94e-07 | NA | 0.4637 |
| 2. PF | A1JQP8 | Na(+)/H(+) antiporter NhaB | 6.16e-06 | 3.34e-07 | NA | 0.4403 |
| 2. PF | Q3KD25 | Na(+)/H(+) antiporter NhaB | 5.01e-06 | 8.53e-11 | NA | 0.4451 |
| 2. PF | A3D3H1 | Na(+)/H(+) antiporter NhaB | 5.68e-06 | 1.01e-06 | NA | 0.4406 |
| 2. PF | A5W1F0 | Na(+)/H(+) antiporter NhaB | 4.83e-06 | 3.56e-08 | NA | 0.4511 |
| 2. PF | Q6GFT0 | Arsenical pump membrane protein | 1.41e-06 | 8.15e-05 | NA | 0.515 |
| 2. PF | P96678 | Putative arsenical pump membrane protein YdfA | 6.66e-07 | 2.66e-07 | NA | 0.5414 |
| 2. PF | A3QEZ3 | Na(+)/H(+) antiporter NhaB | 6.77e-06 | 1.19e-04 | NA | 0.4431 |
| 2. PF | Q1RCR0 | Na(+)/H(+) antiporter NhaB | 4.81e-06 | 2.09e-07 | NA | 0.4452 |
| 2. PF | P42314 | Uncharacterized transporter YxjC | 2.69e-06 | 1.72e-02 | NA | 0.5459 |
| 2. PF | Q9KLS6 | Probable anaerobic C4-dicarboxylate transporter DcuC | 5.09e-09 | 2.12e-10 | NA | 0.6004 |
| 2. PF | P0AFA8 | Na(+)/H(+) antiporter NhaB | 4.78e-06 | 2.62e-07 | NA | 0.4313 |
| 2. PF | Q4QNB8 | Na(+)/H(+) antiporter NhaB | 3.88e-06 | 3.27e-09 | NA | 0.4637 |
| 2. PF | Q5E4B7 | Na(+)/H(+) antiporter NhaB | 3.55e-06 | 2.39e-05 | NA | 0.4532 |
| 2. PF | B1XA73 | Na(+)/H(+) antiporter NhaB | 4.99e-06 | 2.62e-07 | NA | 0.4248 |
| 4. PB | P39263 | Putative basic amino acid antiporter YfcC | 2.54e-13 | 6.33e-33 | 4.29e-21 | NA |
| 5. P | Q1IBG0 | Na(+)/H(+) antiporter NhaB | 4.62e-06 | 5.43e-09 | NA | NA |
| 5. P | A9MP57 | Na(+)/H(+) antiporter NhaB | 5.09e-06 | 3.79e-07 | NA | NA |
| 5. P | B0BT71 | Na(+)/H(+) antiporter NhaB | 4.27e-06 | 5.34e-10 | NA | NA |
| 5. P | Q58086 | Uncharacterized transporter MJ0672 | 7.17e-07 | 2.23e-04 | NA | NA |
| 5. P | P39357 | Uncharacterized permease YjhF | 7.21e-07 | 2.17e-02 | NA | NA |
| 5. P | Q46892 | Inner membrane permease YgbN | 2.42e-06 | 3.82e-03 | NA | NA |
| 5. P | P0ABN9 | Anaerobic C4-dicarboxylate transporter DcuB | 3.56e-06 | 2.76e-02 | NA | NA |
| 5. P | A1U7H0 | Na(+)/H(+) antiporter NhaB | 3.04e-06 | 1.40e-07 | NA | NA |
| 5. P | P44051 | Putative short-chain fatty acid transporter | 4.09e-07 | 4.01e-08 | NA | NA |
| 5. P | P31603 | Citrate-sodium symporter | 1.54e-03 | 6.14e-04 | NA | NA |
| 5. P | Q99SX1 | Sodium-dependent dicarboxylate transporter SdcS | 1.64e-06 | 1.28e-11 | NA | NA |
| 5. P | P0A2F8 | Citrate-sodium symporter | 2.68e-03 | 9.32e-04 | NA | NA |
| 5. P | Q5HEK4 | Sodium-dependent dicarboxylate transporter SdcS | 1.57e-06 | 1.28e-11 | NA | NA |
| 5. P | Q1RIG3 | ADP,ATP carrier protein 4 | 1.93e-03 | 1.47e-02 | NA | NA |
| 5. P | B5XQ77 | Na(+)/H(+) antiporter NhaB | 4.91e-06 | 1.83e-08 | NA | NA |
| 5. P | Q2FWY4 | Sodium-dependent dicarboxylate transporter SdcS | 5.13e-07 | 1.28e-11 | NA | NA |
| 5. P | A9MVW2 | Na(+)/H(+) antiporter NhaB | 5.03e-06 | 2.59e-07 | NA | NA |
| 5. P | O05224 | Putative arsenical pump membrane protein | 2.49e-06 | 4.71e-06 | NA | NA |
| 5. P | B3H0G7 | Na(+)/H(+) antiporter NhaB | 4.44e-06 | 5.34e-10 | NA | NA |
| 5. P | Q66AQ9 | Na(+)/H(+) antiporter NhaB | 5.19e-06 | 1.96e-08 | NA | NA |
| 5. P | Q8ZL63 | L-lactate permease | 1.67e-05 | 6.84e-06 | NA | NA |
| 5. P | A8H5C2 | Na(+)/H(+) antiporter NhaB | 6.66e-06 | 1.29e-06 | NA | NA |
| 5. P | A5F120 | Na(+)/H(+) antiporter NhaD | 2.13e-05 | 1.15e-02 | NA | NA |
| 5. P | B6EIG5 | Na(+)/H(+) antiporter NhaB | 4.22e-06 | 1.20e-05 | NA | NA |
| 5. P | P0ABP4 | Anaerobic C4-dicarboxylate transporter DcuC | 1.65e-07 | 5.99e-06 | NA | NA |
| 5. P | P08555 | D-serine transporter DsdX | 5.51e-11 | 2.01e-02 | NA | NA |
| 5. P | A9KY79 | Na(+)/H(+) antiporter NhaB | 5.77e-06 | 1.01e-06 | NA | NA |
| 5. P | Q5HF02 | Arsenical pump membrane protein | 2.21e-06 | 6.49e-05 | NA | NA |
| 5. P | Q68XS7 | ADP,ATP carrier protein 1 | 1.90e-03 | 8.58e-03 | NA | NA |
| 5. P | A4Y624 | Na(+)/H(+) antiporter NhaB | 5.33e-06 | 1.15e-05 | NA | NA |
| 5. P | Q3YXI0 | L-tartrate/succinate antiporter | 3.78e-06 | 2.69e-08 | NA | NA |
| 5. P | P94363 | Citrate/malate transporter | 9.72e-03 | 4.20e-04 | NA | NA |
| 5. P | A6WM74 | Na(+)/H(+) antiporter NhaB | 6.52e-06 | 1.01e-06 | NA | NA |
| 5. P | Q2YU56 | Sodium-dependent dicarboxylate transporter SdcS | 1.82e-06 | 1.36e-11 | NA | NA |
| 5. P | C5B9W2 | Na(+)/H(+) antiporter NhaB | 5.90e-06 | 7.03e-09 | NA | NA |
| 5. P | P9WPD9 | Uncharacterized transporter Rv2684 | 2.40e-07 | 4.78e-03 | NA | NA |
| 5. P | O32105 | Putative amino acid transporter YuiF | 4.76e-10 | 1.26e-04 | NA | NA |
| 5. P | Q32BQ4 | L-tartrate/succinate antiporter | 1.21e-07 | 2.35e-09 | NA | NA |
| 5. P | Q5HRI3 | Arsenical pump membrane protein | 4.89e-06 | 1.60e-04 | NA | NA |
| 5. P | B1KIB5 | Na(+)/H(+) antiporter NhaB | 6.89e-06 | 1.06e-06 | NA | NA |
| 5. P | Q87N04 | Na(+)/H(+) antiporter NhaB | 3.41e-06 | 1.92e-06 | NA | NA |
| 5. P | Q57NK6 | Na(+)/H(+) antiporter NhaB | 5.06e-06 | 2.06e-07 | NA | NA |
| 5. P | C5BJA8 | Na(+)/H(+) antiporter NhaB | 5.08e-06 | 4.37e-09 | NA | NA |
| 5. P | Q57486 | Uncharacterized transporter HI_0608 | 1.70e-05 | 5.68e-07 | NA | NA |
| 5. P | Q8DAG9 | Na(+)/H(+) antiporter NhaB | 4.16e-06 | 1.07e-06 | NA | NA |
| 5. P | P39344 | Gnt-II system L-idonate transporter | 5.22e-07 | 1.38e-02 | NA | NA |
| 5. P | Q21J49 | Na(+)/H(+) antiporter NhaB | 5.67e-06 | 1.55e-07 | NA | NA |
| 5. P | P42308 | Citrate transporter | 8.16e-08 | 5.20e-07 | NA | NA |
| 5. P | Q57048 | Uncharacterized transporter HI_0020 | 9.97e-07 | 4.13e-09 | NA | NA |
| 5. P | P0AB93 | Arsenical pump membrane protein | 1.37e-06 | 9.43e-06 | NA | NA |
| 5. P | P74635 | Uncharacterized transporter slr0753 | 1.26e-06 | 3.74e-03 | NA | NA |
| 5. P | P44706 | Na(+)/H(+) antiporter NhaB | 6.73e-06 | 2.93e-09 | NA | NA |
| 5. P | Q9I2S5 | Na(+)/H(+) antiporter NhaB | 2.75e-06 | 1.42e-07 | NA | NA |
| 5. P | P21608 | Citrate-sodium symporter | 1.58e-03 | 3.31e-04 | NA | NA |
| 5. P | Q56577 | Na(+)/H(+) antiporter NhaB | 3.77e-06 | 3.79e-07 | NA | NA |
| 5. P | Q8NVS5 | Sodium-dependent dicarboxylate transporter SdcS | 1.75e-06 | 1.08e-11 | NA | NA |
| 5. P | B5F4E1 | Na(+)/H(+) antiporter NhaB | 4.96e-06 | 2.87e-07 | NA | NA |
| 5. P | P19568 | ADP,ATP carrier protein 1 | 2.62e-03 | 2.34e-02 | NA | NA |
| 5. P | Q0VQ74 | Na(+)/H(+) antiporter NhaB | 5.23e-06 | 6.07e-04 | NA | NA |
| 5. P | P45428 | Putative cryptic C4-dicarboxylate transporter DcuD | 1.61e-06 | 5.11e-12 | NA | NA |
| 5. P | P30267 | Uncharacterized protein BpOF4_10220 | 4.97e-04 | 2.13e-02 | NA | NA |
| 5. P | Q9FMF8 | Dicarboxylate transporter 2.2, chloroplastic | 1.60e-06 | 1.67e-02 | NA | NA |
| 5. P | Q8XBK4 | L-tartrate/succinate antiporter | 3.25e-06 | 3.37e-08 | NA | NA |
| 5. P | P44263 | Uncharacterized protein HI_1586 | 5.96e-08 | 1.40e-04 | NA | NA |
| 5. P | Q88FQ6 | Na(+)/H(+) antiporter NhaB | 6.28e-06 | 9.10e-09 | NA | NA |
| 5. P | Q9VVT2 | Protein I'm not dead yet | 4.54e-06 | 3.85e-04 | NA | NA |
| 5. P | B7UQ70 | Na(+)/H(+) antiporter NhaB | 4.59e-06 | 2.73e-07 | NA | NA |
| 5. P | O05962 | ADP,ATP carrier protein 5 | 3.13e-03 | 1.59e-02 | NA | NA |
| 5. P | A6V701 | Na(+)/H(+) antiporter NhaB | 3.02e-06 | 1.00e-07 | NA | NA |
| 5. P | P9WPD7 | Uncharacterized transporter Rv2685 | 2.19e-07 | 3.51e-02 | NA | NA |
| 5. P | P39414 | L-tartrate/succinate antiporter | 3.96e-06 | 1.67e-08 | NA | NA |
| 5. P | A1AAA9 | Na(+)/H(+) antiporter NhaB | 4.79e-06 | 2.09e-07 | NA | NA |
| 5. P | Q1R6R8 | L-tartrate/succinate antiporter | 3.27e-06 | 3.56e-08 | NA | NA |
| 5. P | B7VB57 | Na(+)/H(+) antiporter NhaB | 2.87e-06 | 1.42e-07 | NA | NA |
| 5. P | Q92HP9 | ADP,ATP carrier protein 3 | 2.19e-03 | 1.04e-02 | NA | NA |
| 5. P | Q83JJ9 | L-tartrate/succinate antiporter | 3.68e-06 | 1.88e-08 | NA | NA |
| 5. P | Q5PCR8 | Na(+)/H(+) antiporter NhaB | 4.93e-06 | 2.20e-07 | NA | NA |
| 5. P | P74985 | Arsenical pump membrane protein | 1.54e-06 | 1.09e-05 | NA | NA |
| 5. P | B0TRI8 | Na(+)/H(+) antiporter NhaB | 7.00e-06 | 1.94e-06 | NA | NA |
| 5. P | Q6NE56 | Magnetosome protein MamN | 7.68e-06 | 7.84e-03 | NA | NA |
| 5. P | Q1RIL2 | ADP,ATP carrier protein 3 | 5.35e-04 | 1.87e-02 | NA | NA |
| 5. P | Q6GFE0 | Sodium-dependent dicarboxylate transporter SdcS | 1.36e-06 | 6.13e-12 | NA | NA |
| 5. P | A7MZT6 | Na(+)/H(+) antiporter NhaB | 3.55e-06 | 2.28e-06 | NA | NA |
| 5. P | Q1C7V3 | Na(+)/H(+) antiporter NhaB | 5.14e-06 | 2.06e-08 | NA | NA |
| 5. P | A8GFG0 | Na(+)/H(+) antiporter NhaB | 5.58e-06 | 1.85e-08 | NA | NA |
| 5. P | Q65VH3 | Na(+)/H(+) antiporter NhaB | 5.40e-06 | 8.23e-08 | NA | NA |
| 5. P | B5R2W4 | Na(+)/H(+) antiporter NhaB | 4.84e-06 | 2.06e-07 | NA | NA |
| 5. P | P0AE74 | Citrate/succinate antiporter | 1.15e-05 | 2.82e-10 | NA | NA |
| 5. P | Q6G816 | Sodium-dependent dicarboxylate transporter SdcS | 2.68e-06 | 1.08e-11 | NA | NA |
| 5. P | Q74AB0 | Potassium-transporting ATPase potassium-binding subunit | 4.01e-03 | 5.00e-02 | NA | NA |
| 5. P | P76460 | Putative short-chain fatty acid transporter | 6.81e-07 | 1.64e-09 | NA | NA |
| 5. P | P0ABP3 | Anaerobic C4-dicarboxylate transporter DcuC | 2.10e-07 | 5.99e-06 | NA | NA |
| 5. P | P0A2G0 | Citrate-sodium symporter | 3.72e-03 | 9.32e-04 | NA | NA |
| 5. P | A3MZ40 | Na(+)/H(+) antiporter NhaB | 4.42e-06 | 2.78e-10 | NA | NA |
| 5. P | A0KVP8 | Na(+)/H(+) antiporter NhaB | 5.87e-06 | 7.80e-06 | NA | NA |
| 5. P | C0Q328 | Na(+)/H(+) antiporter NhaB | 5.13e-06 | 2.06e-07 | NA | NA |
| 5. P | P65253 | L-lactate permease | 6.85e-05 | 2.67e-06 | NA | NA |
| 5. P | P0ABP1 | Anaerobic C4-dicarboxylate transporter DcuB | 3.24e-06 | 2.76e-02 | NA | NA |
| 5. P | A1S6X4 | Na(+)/H(+) antiporter NhaB | 7.13e-06 | 6.68e-06 | NA | NA |
| 5. P | B4RU97 | Na(+)/H(+) antiporter NhaB | 5.43e-06 | 2.68e-05 | NA | NA |
| 5. P | P0A607 | Uncharacterized transporter Mb2703 | 5.75e-06 | 4.78e-03 | NA | NA |
| 5. P | Q2FFH9 | Sodium-dependent dicarboxylate transporter SdcS | 2.22e-06 | 9.76e-12 | NA | NA |
| 5. P | Q49YW0 | Sodium-dependent dicarboxylate transporter SdcS | 2.79e-07 | 1.61e-10 | NA | NA |
| 5. P | B7LSJ8 | Na(+)/H(+) antiporter NhaB | 4.41e-06 | 1.24e-08 | NA | NA |
| 5. P | Q02KW3 | Na(+)/H(+) antiporter NhaB | 2.81e-06 | 1.18e-07 | NA | NA |
| 5. P | O05407 | Uncharacterized transporter YraO | 2.61e-07 | 2.81e-05 | NA | NA |
| 5. P | P0AFA7 | Na(+)/H(+) antiporter NhaB | 4.63e-06 | 2.62e-07 | NA | NA |
| 5. P | B5FTM8 | Na(+)/H(+) antiporter NhaB | 4.66e-06 | 2.06e-07 | NA | NA |
| 5. P | Q4ULJ8 | ADP,ATP carrier protein 4 | 3.99e-03 | 1.24e-02 | NA | NA |
| 5. P | B4SUJ8 | Na(+)/H(+) antiporter NhaB | 4.90e-06 | 2.66e-07 | NA | NA |
| 5. P | Q9ZD67 | ADP,ATP carrier protein 3 | 4.08e-04 | 2.66e-02 | NA | NA |
| 5. P | Q2SJ43 | Na(+)/H(+) antiporter NhaB | 6.47e-06 | 5.01e-08 | NA | NA |
| 5. P | P71067 | L-lactate permease | 2.74e-05 | 4.06e-05 | NA | NA |
| 5. P | C4ZTM7 | Na(+)/H(+) antiporter NhaB | 4.81e-06 | 2.62e-07 | NA | NA |
| 5. P | A1RKH2 | Na(+)/H(+) antiporter NhaB | 5.49e-06 | 6.29e-06 | NA | NA |
| 5. P | Q83RQ5 | Na(+)/H(+) antiporter NhaB | 4.46e-06 | 2.14e-07 | NA | NA |
| 5. P | P0AE75 | Citrate/succinate antiporter | 7.59e-07 | 2.82e-10 | NA | NA |
| 5. P | Q7MJN8 | Na(+)/H(+) antiporter NhaB | 5.18e-06 | 1.23e-06 | NA | NA |
| 5. P | B8CPD7 | Na(+)/H(+) antiporter NhaB | 6.96e-06 | 3.44e-06 | NA | NA |
| 5. P | B4TKD6 | Na(+)/H(+) antiporter NhaB | 4.60e-06 | 2.22e-07 | NA | NA |
| 5. P | Q9ZLC0 | Anaerobic C4-dicarboxylate transporter DcuA | 2.54e-09 | 3.94e-03 | NA | NA |
| 5. P | Q83W27 | ADP,ATP carrier protein 4 | 9.54e-04 | 2.17e-02 | NA | NA |
| 5. P | O25425 | Anaerobic C4-dicarboxylate transporter DcuA | 2.44e-09 | 1.22e-02 | NA | NA |
| 5. P | Q8LG88 | Tonoplast dicarboxylate transporter | 7.51e-06 | 3.53e-06 | NA | NA |
| 5. P | O07599 | Uncharacterized membrane protein YhfA | 1.76e-07 | 3.34e-07 | NA | NA |
| 5. P | Q0T5L5 | Na(+)/H(+) antiporter NhaB | 4.73e-06 | 2.14e-07 | NA | NA |
| 5. P | P46133 | p-aminobenzoyl-glutamate transport protein | 1.93e-06 | 4.81e-14 | NA | NA |
| 5. P | P0ABP5 | Anaerobic C4-dicarboxylate transporter DcuC | 1.68e-07 | 5.99e-06 | NA | NA |
| 5. P | Q46839 | Glycolate permease GlcA | 3.74e-05 | 2.10e-05 | NA | NA |
| 5. P | C4L804 | Na(+)/H(+) antiporter NhaB | 5.41e-06 | 6.05e-07 | NA | NA |
| 5. P | A0A0H2VAP9 | D-serine transporter DsdX | 8.76e-12 | 3.61e-02 | NA | NA |
| 5. P | Q8Z2E3 | L-lactate permease | 5.13e-05 | 8.48e-06 | NA | NA |
| 5. P | B1LHY1 | Na(+)/H(+) antiporter NhaB | 4.79e-06 | 6.77e-07 | NA | NA |
| 5. P | B7NJF4 | Na(+)/H(+) antiporter NhaB | 4.64e-06 | 8.06e-07 | NA | NA |
| 5. P | P46231 | Uncharacterized membrane protein VP2115 | 7.53e-10 | 7.36e-05 | NA | NA |
| 5. P | Q92GI5 | ADP,ATP carrier protein 5 | 4.25e-04 | 4.13e-02 | NA | NA |
| 5. P | P75763 | Inner membrane protein YbhI | 5.11e-07 | 4.88e-05 | NA | NA |
| 5. P | Q8ZP14 | Na(+)/H(+) antiporter NhaB | 4.84e-06 | 2.22e-07 | NA | NA |
| 5. P | A6TAW7 | Na(+)/H(+) antiporter NhaB | 5.15e-06 | 2.96e-08 | NA | NA |
| 5. P | Q0TII9 | Na(+)/H(+) antiporter NhaB | 4.73e-06 | 2.80e-07 | NA | NA |
| 5. P | P65254 | L-lactate permease | 1.98e-05 | 2.67e-06 | NA | NA |
| 5. P | O05256 | Na(+)-malate symporter | 5.19e-03 | 7.61e-05 | NA | NA |
| 5. P | Q6G8F6 | Arsenical pump membrane protein | 1.71e-06 | 8.05e-05 | NA | NA |
| 5. P | O34726 | Putative malate transporter YflS | 1.92e-06 | 5.79e-08 | NA | NA |
| 5. P | B5R8Z5 | Na(+)/H(+) antiporter NhaB | 4.63e-06 | 3.06e-07 | NA | NA |
| 5. P | Q4UL85 | ADP,ATP carrier protein 3 | 9.05e-04 | 3.13e-02 | NA | NA |
| 5. P | P31602 | Citrate-sodium symporter | 2.42e-03 | 1.15e-04 | NA | NA |
| 5. P | A6VQI8 | Na(+)/H(+) antiporter NhaB | 6.28e-06 | 1.86e-07 | NA | NA |
| 5. P | P30329 | Arsenical pump membrane protein | 1.89e-06 | 2.46e-04 | NA | NA |
| 5. P | A7MNK6 | Na(+)/H(+) antiporter NhaB | 5.16e-06 | 2.03e-07 | NA | NA |
| 5. P | Q3Z2W2 | Na(+)/H(+) antiporter NhaB | 4.67e-06 | 2.34e-07 | NA | NA |
| 5. P | Q31WX1 | L-tartrate/succinate antiporter | 3.76e-06 | 1.54e-08 | NA | NA |
| 5. P | P33231 | L-lactate permease | 3.55e-05 | 2.73e-06 | NA | NA |
| 5. P | Q21339 | Sodium-dependent high-affinity dicarboxylate transporter 3 | 1.15e-05 | 1.46e-06 | NA | NA |
| 5. P | P0A2F9 | Citrate-sodium symporter | 3.20e-03 | 9.32e-04 | NA | NA |
| 5. P | Q8FJZ8 | Anaerobic C4-dicarboxylate transporter DcuC | 1.63e-07 | 3.93e-06 | NA | NA |
| 5. P | Q07252 | Membrane protein | 5.27e-06 | 2.66e-12 | NA | NA |
| 5. P | A8AFR5 | Na(+)/H(+) antiporter NhaB | 4.84e-06 | 1.20e-07 | NA | NA |
| 5. P | P0AC94 | High-affinity gluconate transporter | 1.15e-06 | 1.34e-03 | NA | NA |
| 5. P | P9WPD6 | Uncharacterized transporter MT2759 | 2.20e-06 | 3.51e-02 | NA | NA |
| 5. P | Q0HJX2 | Na(+)/H(+) antiporter NhaB | 5.65e-06 | 2.33e-05 | NA | NA |
| 5. P | P46838 | 46 kDa membrane protein | 2.86e-07 | 2.10e-03 | NA | NA |
| 5. P | Q68W11 | ADP,ATP carrier protein 5 | 2.01e-03 | 4.33e-02 | NA | NA |
| 5. P | Q7A4P8 | Sodium-dependent dicarboxylate transporter SdcS | 5.04e-07 | 1.28e-11 | NA | NA |
| 6. F | P0ABN7 | Anaerobic C4-dicarboxylate transporter DcuA | 7.30e-07 | NA | NA | 0.5333 |
| 6. F | P0AFU3 | Uncharacterized transporter YfbS | 2.71e-04 | NA | NA | 0.352 |
| 6. F | P54571 | Malate-2H(+)/Na(+)-lactate antiporter | 6.50e-09 | NA | NA | 0.5256 |
| 6. F | P0ABN6 | Anaerobic C4-dicarboxylate transporter DcuA | 1.63e-06 | NA | NA | 0.5545 |
| 6. F | Q9HU16 | C4-dicarboxylate TRAP transporter large permease protein DctM | 1.96e-07 | NA | NA | 0.4784 |
| 6. F | O34245 | Anaerobic C4-dicarboxylate transporter DcuA | 3.16e-08 | NA | NA | 0.5592 |
| 6. F | Q9Z670 | Gluconate permease | 1.27e-08 | NA | NA | 0.6344 |
| 6. F | P0ABN8 | Anaerobic C4-dicarboxylate transporter DcuA | 2.30e-07 | NA | NA | 0.5238 |
| 6. F | O66163 | Na(+)/H(+) antiporter NhaD | 6.11e-05 | NA | NA | 0.4152 |
| 6. F | Q57007 | Uncharacterized Na(+)/H(+) antiporter HI_1107 | 3.18e-09 | NA | NA | 0.5858 |
| 6. F | P0AC97 | Low-affinity gluconate transporter | 3.49e-10 | NA | NA | 0.5525 |
| 6. F | P44993 | Putative TRAP transporter large permease protein HI_1029 | 2.19e-08 | NA | NA | 0.488 |
| 6. F | O07553 | Na(+)/H(+) antiporter NhaC | 7.00e-09 | NA | NA | 0.5333 |
| 6. F | B0R9X2 | Arginine/ornithine antiporter ArcD | 2.84e-07 | NA | NA | 0.5851 |
| 6. F | Q9HHN1 | Arginine/ornithine antiporter ArcD | 2.23e-07 | NA | NA | 0.5861 |
| 6. F | O33654 | L-lactate permease | 1.93e-04 | NA | NA | 0.3853 |
| 6. F | Q9KQS1 | C4-dicarboxylate TRAP transporter large permease protein DctM | 1.64e-07 | NA | NA | 0.4294 |
| 6. F | P27611 | Na(+)/H(+) antiporter NhaC | 7.87e-08 | NA | NA | 0.6041 |