Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX55009.1

JCVISYN3A_0874

16S rRNA (guanine(527)-N(7))-methyltransferase.
M. mycoides homolog: Q6MS67.
TIGRfam Classification: 5=Equivalog.
Category: Nonessential.

Statistics

Total GO Annotation: 132
Unique PROST Go: 69
Unique BLAST Go: 1
Unique Foldseek Go: 29

Total Homologs: 2087
Unique PROST Homologs: 1060
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 246

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: gidB; 16S rRNA (guanine(527)-N(7))-methyltransferase
Zhang et al. [4]: GO:0070043|rRNA (guanine-N7-)-methyltrans ferase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A9NBA9 (Ribosomal RNA small subunit methyltransferase G) with a FATCAT P-Value: 0 and RMSD of 1.87 angstrom. The sequence alignment identity is 28.9%.
Structural alignment shown in left. Query protein AVX55009.1 colored as red in alignment, homolog A9NBA9 colored as blue. Query protein AVX55009.1 is also shown in right top, homolog A9NBA9 showed in right bottom. They are colored based on secondary structures.

  AVX55009.1 ----MFNNWDIFLNYKNF-TINQEIKNKLNLYYQILIQE-NQKYNLTRITQLNEVFEKHFLDSLLFVEQFQIIDQKIADIGTGAGFPGVVLKIFFPNIKL 94
      A9NBA9 MTEKLKQGID-QLGLKVAETIQQSM-----LAFLAFLQKWNQAYNLTAITEIKSMITHHLLDSLSILPYLK-GD-KILDVGSGAGFPGIPLAFACPEKKF 92

  AVX55009.1 TLIESNNKKANFLKYLVQKLELNDVEILNKRVEELNEYKE--QFDIVISRAVAYLDIILELGVQLVKVDGMFILLKGPKAHQEIKDLKNKDQKMNLKLVN 192
      A9NBA9 TLIDSKAKKTAFLLQAASRFKITNVTIIQERV---GSYQPGFYFDTITCRALGSVREIMEQTNHLLRSGGQWLIMKG--AYPE-KELRGTDASAIVHVLN 186

  AVX55009.1 IQELEDTGFGTRVNLFYKKIDHTNNLYPRKYQQILKESK 231
      A9NBA9 V-----PGLKAERHL----VEVKNN----KG-------- 204

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0070043	rRNA (guanine-N7-)-methyltransferase activity
2. PF	GO:0102094	S-adenosylmethionine:2-demethylmenaquinol methyltransferase activity
2. PF	GO:0030091	protein repair
2. PF	GO:0006744	ubiquinone biosynthetic process
2. PF	GO:0043333	2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity
2. PF	GO:0016429	tRNA (adenine-N1-)-methyltransferase activity
2. PF	GO:0030410	nicotianamine synthase activity
2. PF	GO:0043770	demethylmenaquinone methyltransferase activity
2. PF	GO:0036009	protein-glutamine N-methyltransferase activity
2. PF	GO:0043776	cobalt-precorrin-6B C5-methyltransferase activity
2. PF	GO:0009234	menaquinone biosynthetic process
2. PF	GO:0030791	arsenite methyltransferase activity
2. PF	GO:0102208	2-polyprenyl-6-hydroxyphenol methylase activity
2. PF	GO:0008425	2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity
2. PF	GO:0032259	methylation
2. PF	GO:0008689	3-demethylubiquinone-9 3-O-methyltransferase activity
2. PF	GO:0031515	tRNA (m1A) methyltransferase complex
2. PF	GO:0102027	S-adenosylmethionine:2-demethylquinol-8 methyltransferase activity
2. PF	GO:0008276	protein methyltransferase activity
2. PF	GO:0030418	nicotianamine biosynthetic process
2. PF	GO:0005634	nucleus
2. PF	GO:0004719	protein-L-isoaspartate (D-aspartate) O-methyltransferase activity
2. PF	GO:0008649	rRNA methyltransferase activity
2. PF	GO:0008168	methyltransferase activity
2. PF	GO:0102559	protein-(glutamine-N5) methyltransferase activity
2. PF	GO:0046872	metal ion binding
2. PF	GO:0018364	peptidyl-glutamine methylation
2. PF	GO:0102955	S-adenosylmethionine:2-demethylmenaquinol-7 methyltransferase activity
2. PF	GO:0008176	tRNA (guanine-N7-)-methyltransferase activity
2. PF	GO:0009060	aerobic respiration
3. BF	GO:0030782	(S)-tetrahydroprotoberberine N-methyltransferase activity
4. PB	GO:0005886	plasma membrane
5. P	GO:0018023	peptidyl-lysine trimethylation
5. P	GO:0032780	negative regulation of ATP-dependent activity
5. P	GO:1904047	S-adenosyl-L-methionine binding
5. P	GO:0003723	RNA binding
5. P	GO:0080077	trihydroxyferuloyl spermidine:S-adenosyl-L-methionine O-methyltransferase activity
5. P	GO:0042424	catecholamine catabolic process
5. P	GO:0016743	carboxyl- or carbamoyltransferase activity
5. P	GO:0008112	nicotinamide N-methyltransferase activity
5. P	GO:0099119	3-demethylubiquinol-8 3-O-methyltransferase activity
5. P	GO:0008650	rRNA (uridine-2'-O-)-methyltransferase activity
5. P	GO:0043918	cadaverine aminopropyltransferase activity
5. P	GO:0018013	N-terminal peptidyl-glycine methylation
5. P	GO:1990259	histone-glutamine methyltransferase activity
5. P	GO:1990258	histone glutamine methylation
5. P	GO:0060117	auditory receptor cell development
5. P	GO:0106217	tRNA C3-cytosine methylation
5. P	GO:0008295	spermidine biosynthetic process
5. P	GO:0000494	box C/D RNA 3'-end processing
5. P	GO:0080076	caffeoyl CoA:S-adenosyl-L-methionine O-methyltransferase activity
5. P	GO:0043431	2-octaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinone methyltransferase activity
5. P	GO:0009809	lignin biosynthetic process
5. P	GO:0080088	spermidine hydroxycinnamate conjugate biosynthetic process
5. P	GO:0000179	rRNA (adenine-N6,N6-)-dimethyltransferase activity
5. P	GO:0005739	mitochondrion
5. P	GO:0008990	rRNA (guanine-N2-)-methyltransferase activity
5. P	GO:0006769	nicotinamide metabolic process
5. P	GO:0046406	magnesium protoporphyrin IX methyltransferase activity
5. P	GO:0043919	agmatine aminopropyltransferase activity
5. P	GO:0008171	O-methyltransferase activity
5. P	GO:0006596	polyamine biosynthetic process
5. P	GO:0018022	peptidyl-lysine methylation
5. P	GO:0080078	tricaffeoyl spermidine:S-adenosyl-L-methionine O-methyltransferase activity
5. P	GO:0009820	alkaloid metabolic process
5. P	GO:0052624	2-phytyl-1,4-naphthoquinone methyltransferase activity
5. P	GO:0016021	integral component of membrane
5. P	GO:0002098	tRNA wobble uridine modification
5. P	GO:0042372	phylloquinone biosynthetic process
5. P	GO:1904591	positive regulation of protein import
5. P	GO:0009236	cobalamin biosynthetic process
5. P	GO:0080012	trihydroxyferuloyl spermidine O-methyltransferase activity
5. P	GO:0006451	translational readthrough
5. P	GO:0000183	rDNA heterochromatin assembly
5. P	GO:0008983	protein-glutamate O-methyltransferase activity
5. P	GO:0004766	spermidine synthase activity
5. P	GO:0071891	N-terminal peptidyl-proline dimethylation involved in translation
5. P	GO:0030733	fatty acid O-methyltransferase activity
5. P	GO:0000287	magnesium ion binding
5. P	GO:0008169	C-methyltransferase activity
5. P	GO:0102308	erythromycin D 3''-o-methyltransferase activity
5. P	GO:0046498	S-adenosylhomocysteine metabolic process
5. P	GO:0102084	L-dopa O-methyltransferase activity
5. P	GO:0006629	lipid metabolic process
5. P	GO:0018027	peptidyl-lysine dimethylation
5. P	GO:0006479	protein methylation
5. P	GO:0008757	S-adenosylmethionine-dependent methyltransferase activity
5. P	GO:0030580	quinone cofactor methyltransferase activity
5. P	GO:0042409	caffeoyl-CoA O-methyltransferase activity
5. P	GO:0005654	nucleoplasm
5. P	GO:0016206	catechol O-methyltransferase activity
5. P	GO:0046140	corrin biosynthetic process
5. P	GO:0042135	neurotransmitter catabolic process
5. P	GO:0042214	terpene metabolic process
5. P	GO:0110142	ubiquinone biosynthesis complex
5. P	GO:0046500	S-adenosylmethionine metabolic process
5. P	GO:0102307	erythromycin C 3''-o-methyltransferase activity
5. P	GO:0071885	N-terminal protein N-methyltransferase activity
5. P	GO:0102938	orcinol O-methyltransferase activity
5. P	GO:0016279	protein-lysine N-methyltransferase activity
5. P	GO:0031167	rRNA methylation
6. F	GO:0006306	DNA methylation
6. F	GO:0003677	DNA binding
6. F	GO:0102964	S-adenosyl-L-methionine:(S)-corytuberine-N-methyltransferase activity
6. F	GO:0030488	tRNA methylation
6. F	GO:0030794	(S)-coclaurine-N-methyltransferase activity
6. F	GO:0002940	tRNA N2-guanine methylation
6. F	GO:0052913	16S rRNA (guanine(966)-N(2))-methyltransferase activity
6. F	GO:0043777	cobalt-precorrin-7 C15-methyltransferase activity
6. F	GO:0046685	response to arsenic-containing substance
6. F	GO:0102526	8-demethylnovobiocic acid C8-methyltransferase activity
6. F	GO:0003676	nucleic acid binding
6. F	GO:0008173	RNA methyltransferase activity
6. F	GO:0010340	carboxyl-O-methyltransferase activity
6. F	GO:0052916	23S rRNA (guanine(1835)-N(2))-methyltransferase activity
6. F	GO:0004809	tRNA (guanine-N2-)-methyltransferase activity
6. F	GO:1901771	daunorubicin biosynthetic process
6. F	GO:0051539	4 iron, 4 sulfur cluster binding
6. F	GO:0070475	rRNA base methylation
6. F	GO:0017000	antibiotic biosynthetic process
6. F	GO:0005506	iron ion binding
6. F	GO:0016430	tRNA (adenine-N6-)-methyltransferase activity
6. F	GO:0046025	precorrin-6Y C5,15-methyltransferase (decarboxylating) activity
6. F	GO:0102522	tRNA 4-demethylwyosine alpha-amino-alpha-carboxypropyltransferase activity
6. F	GO:0044598	doxorubicin metabolic process
6. F	GO:1901012	(S)-reticuline biosynthetic process
6. F	GO:0009007	site-specific DNA-methyltransferase (adenine-specific) activity
6. F	GO:0043642	novobiocin biosynthetic process
6. F	GO:0102130	malonyl-CoA methyltransferase activity
6. F	GO:0070041	rRNA (uridine-C5-)-methyltransferase activity
7. B	GO:0005829	cytosol

Uniprot GO Annotations

GO	Description
GO:0016740	transferase activity
GO:0005737	cytoplasm
GO:0006364	rRNA processing
GO:0008649	rRNA methyltransferase activity
GO:0008168	methyltransferase activity
GO:0070043	rRNA (guanine-N7-)-methyltransferase activity
GO:0070476	rRNA (guanine-N7)-methylation
GO:0032259	methylation
GO:0031167	rRNA methylation

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q9CFX1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.82e-54	1.80e-35	0.9402
1. PBF	Q3BML8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.31e-35	7.17e-30	0.8873
1. PBF	A4VS72	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.99e-35	3.11e-20	0.8773
1. PBF	A0PX79	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.17e-53	7.63e-37	0.8674
1. PBF	A2RK93	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.46e-56	1.37e-33	0.9361
1. PBF	Q3SWH7	Ribosomal RNA small subunit methyltransferase G	2.78e-13	1.30e-04	3.23e-15	0.773
1. PBF	Q28VZ4	Ribosomal RNA small subunit methyltransferase G	6.66e-16	2.03e-34	6.69e-17	0.8394
1. PBF	Q13SP1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.25e-30	1.68e-18	0.8682
1. PBF	A5U9P7	Ribosomal RNA small subunit methyltransferase G	2.66e-15	5.48e-52	9.33e-20	0.7879
1. PBF	A7N0X5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.50e-42	1.66e-21	0.8667
1. PBF	Q7VG38	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.96e-30	4.42e-17	0.8458
1. PBF	B0S3V0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.10e-52	2.64e-29	0.9153
1. PBF	Q6FYC0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.00e-36	1.95e-12	0.8009
1. PBF	B0RYS0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.57e-36	3.90e-24	0.8905
1. PBF	Q72LR3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.36e-37	2.66e-07	0.7826
1. PBF	B0VMY0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.05e-34	4.05e-18	0.8674
1. PBF	A2C4M0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.35e-61	6.96e-22	0.8913
1. PBF	B9IT40	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.15e-60	4.31e-40	0.9287
1. PBF	Q8Y3N3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.58e-57	6.14e-34	0.9215
1. PBF	A8GQL8	Ribosomal RNA small subunit methyltransferase G	9.99e-16	3.24e-34	9.33e-14	0.8435
1. PBF	A7N992	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.52e-36	3.86e-21	0.8265
1. PBF	B1X9W8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8779
1. PBF	A5G167	Ribosomal RNA small subunit methyltransferase G	1.11e-16	4.42e-27	8.96e-11	0.8025
1. PBF	B9DXR9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.78e-61	4.64e-42	0.9418
1. PBF	Q0K5L7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.64e-38	9.57e-14	0.8626
1. PBF	Q87D24	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.47e-34	1.48e-28	0.8912
1. PBF	B8ZJU9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.55e-58	4.90e-35	0.9324
1. PBF	C6DJG4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.61e-39	9.75e-23	0.8742
1. PBF	B8H8Y9	Ribosomal RNA small subunit methyltransferase G	2.22e-16	1.49e-45	9.40e-17	0.8052
1. PBF	Q1JDG1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.11e-60	3.70e-39	0.9386
1. PBF	A8ACP6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.81e-42	2.63e-27	0.8627
1. PBF	Q0RAP0	Ribosomal RNA small subunit methyltransferase G	2.00e-14	4.45e-18	4.81e-13	0.7851
1. PBF	Q6LLF8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.02e-43	1.21e-25	0.8885
1. PBF	A6U593	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.26e-54	8.72e-37	0.9481
1. PBF	B7JIK9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.15e-60	4.31e-40	0.929
1. PBF	A5I814	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.07e-59	6.53e-31	0.8885
1. PBF	Q0TAW9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.865
1. PBF	Q2A5Y4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.52e-36	3.86e-21	0.8268
1. PBF	A8AVJ7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.97e-58	2.69e-36	0.9389
1. PBF	Q5WAG5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.55e-56	2.19e-37	0.9511
1. PBF	Q03CJ9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.77e-58	5.52e-41	0.8997
1. PBF	A5UGZ7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.38e-38	5.70e-20	0.8836
1. PBF	Q97CW4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.82e-61	5.96e-30	0.9254
1. PBF	Q5KU59	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.32e-60	4.61e-37	0.9503
1. PBF	B7I508	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.12e-34	4.70e-19	0.8665
1. PBF	Q0HPF1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.17e-36	2.45e-16	0.8828
1. PBF	B8JDK2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.30e-36	1.78e-15	0.8616
1. PBF	B0TW44	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.31e-35	6.79e-23	0.8599
1. PBF	A9NBA9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.00e-39	8.47e-23	0.8773
1. PBF	A9M9E3	Ribosomal RNA small subunit methyltransferase G	2.78e-15	9.26e-29	7.02e-12	0.8136
1. PBF	Q47K77	Ribosomal RNA small subunit methyltransferase G	2.22e-16	1.44e-34	5.16e-17	0.7518
1. PBF	B3Q8A6	Ribosomal RNA small subunit methyltransferase G	2.00e-15	1.10e-29	2.20e-13	0.8281
1. PBF	Q5X0Z7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.95e-40	1.20e-20	0.8695
1. PBF	Q1CUC1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.05e-25	1.59e-18	0.8318
1. PBF	A4YJT3	Ribosomal RNA small subunit methyltransferase G	4.33e-15	3.08e-31	8.63e-14	0.8219
1. PBF	Q88T09	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.63e-52	2.51e-35	0.9035
1. PBF	A0Q444	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.36e-36	8.31e-21	0.8271
1. PBF	A9KX16	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.35e-37	2.45e-16	0.8837
1. PBF	A1TI79	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.13e-34	1.09e-16	0.8062
1. PBF	Q5HCI5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.09e-53	2.01e-37	0.9501
1. PBF	Q9PNU3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.14e-23	1.54e-17	0.8495
1. PBF	B2J5Q6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.62e-60	2.49e-28	0.8841
1. PBF	A5WFA2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.18e-26	4.99e-20	0.8193
1. PBF	B8DD12	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.04e-58	1.85e-33	0.9292
1. PBF	Q3YVP4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8691
1. PBF	Q3B6D4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.55e-24	3.55e-18	0.844
1. PBF	B7H7A0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.43e-60	3.22e-40	0.9288
1. PBF	Q1IVV7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.94e-54	2.41e-25	0.931
1. PBF	A6VF42	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.14e-35	4.39e-25	0.8689
1. PBF	Q1QBW5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.10e-12	4.83e-19	0.8323
1. PBF	B9M9W4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.57e-24	6.43e-19	0.8227
1. PBF	Q3JXU8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.51e-23	2.09e-18	0.8691
1. PBF	B4RS91	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.62e-38	1.26e-22	0.8797
1. PBF	B0RDP8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.64e-36	2.45e-17	0.8842
1. PBF	Q4A933	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.64e-36	5.95e-15	0.7225
1. PBF	Q4UN89	Ribosomal RNA small subunit methyltransferase G	5.55e-16	4.58e-33	2.73e-10	0.842
1. PBF	A1K1Q5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.99e-36	3.36e-22	0.8816
1. PBF	A1A3X4	Ribosomal RNA small subunit methyltransferase G	8.88e-16	1.36e-39	1.32e-13	0.6909
1. PBF	Q8GHA0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.55e-22	7.76e-16	0.8458
1. PBF	A1SQV5	Ribosomal RNA small subunit methyltransferase G	3.33e-16	5.63e-36	4.46e-24	0.7935
1. PBF	B5XJV1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.64e-61	6.65e-38	0.9365
1. PBF	B9DI97	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.41e-57	2.78e-37	0.925
1. PBF	Q1QRZ2	Ribosomal RNA small subunit methyltransferase G	4.95e-13	3.67e-12	3.21e-17	0.7751
1. PBF	Q1RGT2	Ribosomal RNA small subunit methyltransferase G	8.88e-16	3.53e-31	1.36e-08	0.8394
1. PBF	Q8EKU4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.54e-57	2.62e-35	0.9278
1. PBF	A5CY44	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.42e-61	1.33e-38	0.9407
1. PBF	A0RR76	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.79e-26	2.13e-13	0.8894
1. PBF	A7X7A5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.26e-54	8.72e-37	0.9501
1. PBF	A2BYK1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.29e-61	8.84e-18	0.9065
1. PBF	P0A6U7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8665
1. PBF	Q8A8M2	Ribosomal RNA small subunit methyltransferase G	2.22e-16	4.85e-38	1.59e-14	0.8203
1. PBF	Q24MA0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.34e-59	6.03e-38	0.9233
1. PBF	Q3AG54	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.09e-62	1.30e-39	0.9549
1. PBF	Q1I2H7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.40e-34	1.16e-18	0.8898
1. PBF	Q8DPH3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.37e-58	5.82e-35	0.9322
1. PBF	Q6ANR2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.34e-35	2.70e-15	0.8732
1. PBF	A0LYD2	Ribosomal RNA small subunit methyltransferase G	1.11e-16	1.07e-39	9.92e-14	0.8293
1. PBF	Q8E3T0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.92e-53	1.24e-30	0.9344
1. PBF	P94614	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.00e-39	8.47e-23	0.8771
1. PBF	A7ZCL5	Ribosomal RNA small subunit methyltransferase G	1.11e-16	9.19e-35	3.48e-13	0.8198
1. PBF	Q2GC39	Ribosomal RNA small subunit methyltransferase G	5.55e-16	2.68e-41	4.77e-19	0.849
1. PBF	A0LLH7	Ribosomal RNA small subunit methyltransferase G 1	0.00e+00	1.23e-35	1.15e-27	0.7755
1. PBF	B2SU21	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.44e-34	2.15e-28	0.8872
1. PBF	A8G6X5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.28e-55	2.05e-20	0.9112
1. PBF	A1AHS0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8671
1. PBF	A6Q1W3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.45e-22	2.53e-18	0.8672
1. PBF	Q8P3N0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.17e-36	2.96e-25	0.8889
1. PBF	Q2FDF0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.09e-53	2.01e-37	0.9485
1. PBF	Q2L2S3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.19e-29	1.80e-19	0.8374
1. PBF	Q50203	Ribosomal RNA small subunit methyltransferase G	6.99e-15	3.01e-33	3.61e-18	0.8726
1. PBF	Q663Q0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.63e-37	6.21e-24	0.8703
1. PBF	Q7U8J1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.36e-55	6.18e-14	0.884
1. PBF	Q82S79	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.97e-42	4.17e-20	0.8699
1. PBF	Q72H89	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.90e-48	6.71e-28	0.9308
1. PBF	A5VA84	Ribosomal RNA small subunit methyltransferase G	4.33e-15	3.22e-39	1.58e-18	0.8285
1. PBF	B5XZL6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.58e-39	1.25e-24	0.8676
1. PBF	Q0SNY7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.11e-35	3.27e-10	0.8435
1. PBF	Q04X97	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.02e-38	1.91e-08	0.7539
1. PBF	B4TN41	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.19e-39	1.54e-24	0.8668
1. PBF	A1U7I4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.67e-38	1.63e-17	0.8618
1. PBF	Q1GXM0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.68e-41	1.08e-21	0.8738
1. PBF	Q3JZQ7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.04e-53	1.13e-30	0.9379
1. PBF	Q8XU66	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.26e-33	9.16e-18	0.8389
1. PBF	A9MJR0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.48e-41	6.40e-25	0.8643
1. PBF	A4Y197	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.23e-33	2.42e-21	0.854
1. PBF	O54571	Ribosomal RNA small subunit methyltransferase G	1.57e-12	3.07e-42	1.18e-19	0.7456
1. PBF	Q48BF5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.59e-35	1.26e-19	0.8622
1. PBF	A5G9V1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.68e-39	3.67e-19	0.9411
1. PBF	Q2J359	Ribosomal RNA small subunit methyltransferase G	1.07e-14	3.90e-33	1.21e-13	0.8094
1. PBF	Q13E20	Ribosomal RNA small subunit methyltransferase G	1.22e-15	2.90e-36	1.59e-13	0.816
1. PBF	A7GZM1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.86e-30	4.14e-11	0.8745
1. PBF	Q3M6A1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.48e-58	7.97e-32	0.8967
1. PBF	B0TQG4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.03e-38	2.94e-18	0.8832
1. PBF	Q318R7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.70e-57	2.02e-18	0.9043
1. PBF	Q68XT1	Ribosomal RNA small subunit methyltransferase G	5.55e-16	6.44e-31	6.01e-14	0.8476
1. PBF	Q630C0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.40e-60	5.12e-40	0.929
1. PBF	Q87K99	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.62e-42	2.33e-22	0.87
1. PBF	Q2K2S2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.83e-27	4.51e-12	0.8435
1. PBF	Q8G6J4	Ribosomal RNA small subunit methyltransferase G	1.11e-16	8.12e-31	1.16e-15	0.7964
1. PBF	Q7VPP8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.13e-37	9.83e-20	0.8854
1. PBF	A5N449	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.78e-61	4.64e-42	0.9069
1. PBF	A0LWW8	Ribosomal RNA small subunit methyltransferase G	1.11e-16	4.29e-57	1.17e-18	0.7761
1. PBF	Q0BP72	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.52e-36	3.86e-21	0.8276
1. PBF	Q0BWB0	Ribosomal RNA small subunit methyltransferase G	2.22e-16	4.96e-41	2.42e-13	0.8488
1. PBF	Q7UMW0	Ribosomal RNA small subunit methyltransferase G	1.78e-15	4.45e-51	1.26e-11	0.7327
1. PBF	Q0ATU7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.17e-44	8.92e-25	0.9308
1. PBF	Q3SF56	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.98e-40	6.55e-23	0.8582
1. PBF	A8I267	Ribosomal RNA small subunit methyltransferase G	8.10e-15	1.94e-12	1.75e-12	0.802
1. PBF	A2C6U2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.62e-60	1.94e-15	0.9086
1. PBF	A8EU69	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.73e-32	1.40e-16	0.8681
1. PBF	B0K8H7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.00e-62	1.31e-44	0.9249
1. PBF	Q63PG9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.36e-25	1.72e-18	0.8576
1. PBF	A9GCQ1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.96e-25	5.34e-18	0.8556
1. PBF	B7N2H9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8673
1. PBF	Q0VKW4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.48e-32	5.88e-22	0.8654
1. PBF	A4VTE0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.66e-59	3.69e-31	0.9387
1. PBF	Q82FE3	Ribosomal RNA small subunit methyltransferase G	9.66e-13	7.40e-44	2.09e-19	0.7421
1. PBF	B4SNP6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.04e-34	3.80e-31	0.8882
1. PBF	Q03DH7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.29e-50	8.96e-42	0.9118
1. PBF	P0A6U6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8779
1. PBF	Q8RI89	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.32e-65	8.58e-27	0.9368
1. PBF	B5YXE4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8649
1. PBF	Q5WSS3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.85e-40	1.15e-20	0.8579
1. PBF	A3PNS5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.68e-29	1.96e-19	0.84
1. PBF	B1JFV1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-33	1.68e-18	0.8965
1. PBF	Q1J8D8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.99e-61	9.12e-39	0.9373
1. PBF	A9WGI4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.90e-60	5.20e-31	0.9496
1. PBF	A9WVP1	Ribosomal RNA small subunit methyltransferase G	1.78e-15	5.97e-40	2.27e-18	0.8031
1. PBF	P25813	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.89e-58	1.24e-35	0.9146
1. PBF	C1ER75	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.15e-60	4.31e-40	0.9311
1. PBF	A9KBS7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.61e-39	3.33e-22	0.8748
1. PBF	B4E582	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.89e-32	1.01e-20	0.8485
1. PBF	A4SCT8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.01e-42	4.79e-18	0.852
1. PBF	A5E8G9	Ribosomal RNA small subunit methyltransferase G	3.44e-15	4.58e-30	1.41e-14	0.8221
1. PBF	A0K2M2	Ribosomal RNA small subunit methyltransferase G	3.33e-16	1.51e-44	1.71e-15	0.7645
1. PBF	A7HSL2	Ribosomal RNA small subunit methyltransferase G	6.66e-16	3.69e-29	1.09e-15	0.8324
1. PBF	Q9ZE89	Ribosomal RNA small subunit methyltransferase G	3.11e-15	6.35e-32	3.35e-14	0.8199
1. PBF	B5FN43	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	9.80e-24	0.8661
1. PBF	Q72WU5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.15e-60	4.31e-40	0.9288
1. PBF	B0VCZ6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.12e-34	4.70e-19	0.865
1. PBF	Q6F9W7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.80e-36	2.40e-17	0.8582
1. PBF	Q4FS37	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.50e-12	1.55e-19	0.8519
1. PBF	A3PEW3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.68e-55	4.84e-19	0.9012
1. PBF	Q8FY29	Ribosomal RNA small subunit methyltransferase G	2.66e-15	2.84e-28	1.90e-11	0.8141
1. PBF	A6GWQ2	Ribosomal RNA small subunit methyltransferase G	5.55e-16	1.62e-41	1.09e-11	0.7994
1. PBF	Q6A5B2	Ribosomal RNA small subunit methyltransferase G	2.55e-15	1.65e-41	4.45e-22	0.8424
1. PBF	B1XYL2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.10e-38	3.45e-20	0.8648
1. PBF	A5CVC1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.23e-35	7.61e-18	0.8789
1. PBF	A8GLL1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.75e-37	2.93e-23	0.8709
1. PBF	A3DHY6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.89e-55	9.25e-34	0.9308
1. PBF	B1YQK3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.16e-31	9.09e-20	0.8501
1. PBF	Q1BR98	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.53e-33	6.72e-21	0.8465
1. PBF	A1RQC0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.46e-38	1.13e-18	0.8857
1. PBF	Q2N6I7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.68e-32	3.10e-19	0.8508
1. PBF	A2S6K9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.36e-25	1.72e-18	0.8671
1. PBF	Q0SAH7	Ribosomal RNA small subunit methyltransferase G	4.44e-15	2.80e-43	2.01e-17	0.8385
1. PBF	B1L800	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.81e-56	1.69e-27	0.9162
1. PBF	P53363	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.88e-37	4.12e-09	0.8201
1. PBF	A7NPB9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.25e-62	6.04e-39	0.9478
1. PBF	C1D0A7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.40e-58	2.10e-25	0.9216
1. PBF	B5YFF7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.11e-61	3.93e-33	0.9083
1. PBF	Q11VU7	Ribosomal RNA small subunit methyltransferase G	1.11e-16	1.33e-40	4.12e-11	0.8258
1. PBF	Q6F0F5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.02e-70	1.19e-91	0.9785
1. PBF	A0R7J5	Ribosomal RNA small subunit methyltransferase G	1.11e-15	3.39e-49	1.38e-23	0.7869
1. PBF	A0PX66	Ribosomal RNA small subunit methyltransferase G	8.26e-13	4.11e-07	2.51e-12	0.8796
1. PBF	Q1JII3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.82e-61	1.72e-38	0.9367
1. PBF	Q47U39	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.65e-37	5.00e-22	0.8615
1. PBF	A9NEC5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.53e-65	1.51e-35	0.9323
1. PBF	Q5LWF2	Ribosomal RNA small subunit methyltransferase G	6.66e-16	8.92e-29	4.02e-13	0.8426
1. PBF	C0RFU8	Ribosomal RNA small subunit methyltransferase G	2.89e-15	9.26e-29	7.02e-12	0.8144
1. PBF	A5II63	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.91e-40	1.24e-20	0.8564
1. PBF	A5VHQ2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.17e-60	2.86e-39	0.9259
1. PBF	A0K2X1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.53e-33	6.72e-21	0.8517
1. PBF	Q17WP3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.18e-26	1.44e-18	0.8493
1. PBF	B7MGG0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8777
1. PBF	A6WUK0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.35e-37	2.45e-16	0.8836
1. PBF	Q46VX0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.58e-30	6.33e-15	0.8607
1. PBF	Q2Y5B5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.56e-48	7.71e-20	0.8608
1. PBF	B2V1U8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.03e-60	5.74e-37	0.8788
1. PBF	Q39ZT2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.27e-49	7.56e-24	0.9169
1. PBF	Q03MB7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.13e-56	1.89e-38	0.926
1. PBF	A9W327	Ribosomal RNA small subunit methyltransferase G	2.22e-16	1.13e-33	3.43e-13	0.8049
1. PBF	C5C6N4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.08e-36	3.08e-13	0.7956
1. PBF	A2RGB9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.28e-59	7.13e-39	0.9321
1. PBF	A1U8R4	Ribosomal RNA small subunit methyltransferase G	3.22e-15	1.28e-56	2.48e-19	0.7617
1. PBF	A9VTL8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.58e-59	1.07e-38	0.9418
1. PBF	C1FP29	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.97e-62	2.02e-33	0.889
1. PBF	Q8Z9R9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.63e-37	6.21e-24	0.8385
1. PBF	B0BRY0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.75e-38	2.04e-23	0.8662
1. PBF	A6UEE7	Ribosomal RNA small subunit methyltransferase G	1.83e-14	5.11e-31	1.28e-12	0.7885
1. PBF	Q0I7M9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.00e-55	2.52e-19	0.9104
1. PBF	A1KRM2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.39e-34	1.72e-21	0.8946
1. PBF	Q72CN3	Ribosomal RNA small subunit methyltransferase G	1.11e-16	5.50e-27	2.96e-12	0.7606
1. PBF	Q6HAF4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.15e-60	4.31e-40	0.9288
1. PBF	A6WGM8	Ribosomal RNA small subunit methyltransferase G	9.99e-16	3.89e-31	6.86e-15	0.8679
1. PBF	A8GUR2	Ribosomal RNA small subunit methyltransferase G	8.88e-16	3.53e-31	1.36e-08	0.8398
1. PBF	B2VCB2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.83e-39	5.79e-25	0.8876
1. PBF	A0RLR0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.15e-60	4.31e-40	0.929
1. PBF	Q8E8B0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.22e-36	4.95e-16	0.8831
1. PBF	A8F0G4	Ribosomal RNA small subunit methyltransferase G	4.44e-16	4.55e-32	9.96e-09	0.8361
1. PBF	Q6G5W6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.09e-53	2.01e-37	0.9482
1. PBF	Q4L2Z4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.25e-55	8.20e-32	0.9512
1. PBF	Q9PRA5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.00e-42	1.17e-37	0.9321
1. PBF	A3M4Y3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.12e-34	4.70e-19	0.8672
1. PBF	Q9KNG5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.91e-40	1.36e-26	0.8768
1. PBF	B1ZGG1	Ribosomal RNA small subunit methyltransferase G	2.22e-16	1.29e-36	4.19e-15	0.8055
1. PBF	B9E8Z2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.91e-54	3.03e-37	0.943
1. PBF	Q8NUF9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.09e-53	2.01e-37	0.9483
1. PBF	Q3IYH5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.42e-28	2.65e-19	0.8245
1. PBF	Q3Z8E1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.11e-60	2.80e-33	0.9293
1. PBF	Q2S6N0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.99e-36	1.96e-15	0.8843
1. PBF	Q6MGL7	Ribosomal RNA small subunit methyltransferase G 3	1.11e-16	2.15e-35	2.05e-14	0.8263
1. PBF	A5GNG2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.62e-53	1.53e-23	0.9076
1. PBF	A5VT18	Ribosomal RNA small subunit methyltransferase G	2.44e-15	5.18e-29	2.23e-12	0.8141
1. PBF	B5RQZ6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.53e-37	2.01e-11	0.826
1. PBF	Q899S0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.07e-59	1.13e-32	0.8878
1. PBF	Q1GP62	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.11e-21	5.54e-15	0.8159
1. PBF	Q8FSV1	Ribosomal RNA small subunit methyltransferase G	1.11e-16	8.74e-16	6.16e-19	0.8326
1. PBF	A3QJS0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.59e-39	3.78e-19	0.8839
1. PBF	B1HPM1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.77e-57	3.88e-37	0.9055
1. PBF	A4T4S9	Ribosomal RNA small subunit methyltransferase G	9.99e-16	2.15e-50	1.37e-19	0.7847
1. PBF	A7HIY6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.25e-34	2.41e-17	0.865
1. PBF	Q89WP6	Ribosomal RNA small subunit methyltransferase G	7.75e-14	8.80e-05	1.99e-13	0.7875
1. PBF	B2FNF9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.40e-34	3.42e-31	0.8878
1. PBF	B1VAK6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.69e-47	3.81e-42	0.9013
1. PBF	B0C384	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.21e-45	9.54e-33	0.9002
1. PBF	B2S959	Ribosomal RNA small subunit methyltransferase G	3.11e-15	9.26e-29	7.02e-12	0.8132
1. PBF	A1SBV0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.17e-36	3.10e-17	0.886
1. PBF	C5BF32	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.86e-37	1.14e-21	0.87
1. PBF	A8HAH3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.02e-37	1.62e-18	0.8854
1. PBF	Q0BJM7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.37e-32	1.71e-19	0.8598
1. PBF	Q2LY85	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.78e-30	1.59e-30	0.9221
1. PBF	A8F3S3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.57e-56	6.81e-30	0.9248
1. PBF	Q87TS4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.93e-36	1.11e-18	0.8619
1. PBF	A6L982	Ribosomal RNA small subunit methyltransferase G	2.22e-16	1.38e-17	4.51e-13	0.7652
1. PBF	A7I3X1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.69e-24	8.38e-13	0.8718
1. PBF	A1QYX2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.72e-35	4.93e-11	0.8536
1. PBF	B7L890	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8758
1. PBF	A3P103	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.12e-24	1.98e-18	0.8589
1. PBF	Q2NQ94	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.21e-40	1.00e-19	0.8806
1. PBF	B7VN06	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.26e-37	1.74e-24	0.8713
1. PBF	C4L001	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.23e-60	3.80e-37	0.9436
1. PBF	Q1B0S6	Ribosomal RNA small subunit methyltransferase G	3.11e-15	1.28e-56	2.48e-19	0.7625
1. PBF	B7M596	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8764
1. PBF	B4SYE1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	9.80e-24	0.8665
1. PBF	Q9HT10	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.59e-35	8.28e-24	0.8694
1. PBF	Q6NE98	Ribosomal RNA small subunit methyltransferase G	2.22e-16	9.19e-35	1.34e-22	0.7763
1. PBF	Q662I7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.30e-38	7.03e-11	0.8243
1. PBF	C3PM95	Ribosomal RNA small subunit methyltransferase G	7.77e-16	3.26e-33	1.11e-08	0.8398
1. PBF	Q8YJS4	Ribosomal RNA small subunit methyltransferase G	2.89e-15	9.26e-29	7.02e-12	0.8138
1. PBF	Q9A1D7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.32e-60	1.68e-38	0.9347
1. PBF	P44728	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.38e-38	5.70e-20	0.8826
1. PBF	A2BT49	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.15e-57	4.42e-20	0.9137
1. PBF	Q2YZC0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.54e-54	2.46e-37	0.9481
1. PBF	Q07UP0	Ribosomal RNA small subunit methyltransferase G	1.14e-14	2.42e-33	7.91e-15	0.805
1. PBF	B7UMK5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8758
1. PBF	Q04WD4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.02e-38	1.91e-08	0.7542
1. PBF	A7MMW2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.41e-38	1.26e-23	0.8743
1. PBF	A5UA03	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.84e-37	4.96e-19	0.8825
1. PBF	Q12HP1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.09e-38	1.28e-15	0.8769
1. PBF	A8Z655	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.14e-43	1.34e-06	0.7793
1. PBF	Q7NMQ7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.62e-41	1.58e-28	0.9016
1. PBF	B9JV51	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.04e-28	3.07e-11	0.8255
1. PBF	Q2IHR2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.24e-40	1.42e-16	0.8613
1. PBF	Q98DZ2	Ribosomal RNA small subunit methyltransferase G	7.77e-16	1.51e-32	7.61e-15	0.8375
1. PBF	Q2NXD0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.07e-34	2.84e-27	0.8881
1. PBF	Q5PJX2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	9.80e-24	0.8663
1. PBF	B5EZ06	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.14e-39	3.59e-24	0.8662
1. PBF	B3H2Q1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.75e-38	2.04e-23	0.866
1. PBF	C3LSJ9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.91e-40	1.36e-26	0.878
1. PBF	B0S902	Ribosomal RNA small subunit methyltransferase G	1.11e-16	9.65e-49	1.46e-13	0.7568
1. PBF	Q0I5W5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.45e-51	9.13e-20	0.8687
1. PBF	Q6YQV6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.39e-44	7.41e-42	0.9172
1. PBF	Q6ABV7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.23e-37	1.89e-15	0.8827
1. PBF	B7NF56	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.14e-42	6.90e-25	0.8757
1. PBF	Q2RFJ0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.72e-61	4.01e-31	0.9366
1. PBF	Q65Q00	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.43e-34	1.04e-20	0.8675
1. PBF	Q57HX0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	9.80e-24	0.8662
1. PBF	C6DYR8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.88e-39	1.32e-22	0.9438
1. PBF	Q8XH32	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.17e-55	3.05e-37	0.9033
1. PBF	A5GVE0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.16e-59	2.95e-13	0.8892
1. PBF	Q8EUW9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.14e-59	1.12e-36	0.9065
1. PBF	A3NF53	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.19e-23	2.00e-18	0.8693
1. PBF	A1T0Z9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.20e-34	5.65e-20	0.8754
1. PBF	B2HZC3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.12e-34	4.70e-19	0.8665
1. PBF	Q2WBG8	Ribosomal RNA small subunit methyltransferase G	5.33e-15	4.94e-34	1.77e-22	0.8446
1. PBF	A5IWD5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.26e-54	8.72e-37	0.95
1. PBF	P9WGW8	Ribosomal RNA small subunit methyltransferase G	2.44e-15	5.48e-52	9.33e-20	0.7882
1. PBF	P0DF44	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.58e-61	5.22e-39	0.9344
1. PBF	A4ITW9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.03e-60	2.76e-36	0.9474
1. PBF	Q8DDH8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.25e-39	1.37e-22	0.8707
1. PBF	A1AVB2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.21e-31	2.12e-21	0.8282
1. PBF	Q4A772	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.49e-36	2.14e-14	0.727
1. PBF	B0SRZ9	Ribosomal RNA small subunit methyltransferase G	1.11e-16	9.65e-49	1.46e-13	0.7649
1. PBF	B1LL67	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.69e-41	1.27e-25	0.8629
1. PBF	Q5E1M7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.46e-41	5.12e-24	0.8706
1. PBF	Q7W0S9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.04e-27	1.36e-17	0.8237
1. PBF	Q0AKF0	Ribosomal RNA small subunit methyltransferase G	1.55e-15	1.21e-36	2.37e-14	0.8218
1. PBF	Q814F8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.43e-60	3.22e-40	0.9287
1. PBF	C0ZA63	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.90e-54	1.09e-38	0.9256
1. PBF	B7LK85	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.05e-41	3.58e-25	0.8743
1. PBF	Q21QL4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.29e-27	1.45e-18	0.8118
1. PBF	A1VEG3	Ribosomal RNA small subunit methyltransferase G	1.11e-16	5.50e-27	2.96e-12	0.7612
1. PBF	Q3AZ92	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.43e-51	9.00e-15	0.8951
1. PBF	Q93D95	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.37e-58	6.02e-33	0.9404
1. PBF	A5UVE3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.29e-57	5.09e-37	0.9469
1. PBF	B0UWH2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.71e-52	1.42e-19	0.8637
1. PBF	Q8R6L0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.62e-61	5.56e-43	0.9273
1. PBF	A7ZAV9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.76e-59	5.31e-29	0.9028
1. PBF	Q55787	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.97e-39	1.46e-24	0.8919
1. PBF	B2RZN8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.83e-35	4.20e-12	0.8515
1. PBF	Q04HG5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.39e-57	2.33e-25	0.907
1. PBF	B7KV55	Ribosomal RNA small subunit methyltransferase G	2.22e-16	8.52e-34	4.33e-13	0.8066
1. PBF	B0K5N2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.69e-63	8.71e-45	0.9482
1. PBF	Q6CYI7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.75e-38	3.31e-22	0.8724
1. PBF	A8A6K3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8755
1. PBF	Q39KY8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.55e-33	3.83e-20	0.8524
1. PBF	Q02YJ6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.68e-56	8.93e-34	0.9362
1. PBF	Q39PR1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.19e-41	1.03e-16	0.9309
1. PBF	Q02DE4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.59e-35	8.92e-24	0.8696
1. PBF	A4STQ3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.88e-39	1.72e-23	0.8642
1. PBF	B3DP27	Ribosomal RNA small subunit methyltransferase G	1.11e-16	8.12e-31	1.16e-15	0.7566
1. PBF	B9KAS1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.67e-60	5.15e-28	0.9275
1. PBF	A8FJF8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.32e-55	2.16e-32	0.8908
1. PBF	Q0ADD7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.71e-42	3.68e-20	0.8759
1. PBF	C3P3F3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.15e-60	4.31e-40	0.9288
1. PBF	Q48960	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.98e-97	6.77e-155	0.9956
1. PBF	B8IHZ7	Ribosomal RNA small subunit methyltransferase G	6.88e-15	4.45e-38	9.37e-15	0.8276
1. PBF	Q8P2K1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.28e-59	7.13e-39	0.9369
1. PBF	A6LMN3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.17e-38	6.89e-20	0.9227
1. PBF	Q38ZR1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.42e-62	1.76e-37	0.9118
1. PBF	Q5ZRJ1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.50e-40	1.79e-20	0.8542
1. PBF	Q0SPQ5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.19e-56	3.72e-38	0.903
1. PBF	B1KUB0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.34e-59	6.40e-32	0.8949
1. PBF	B9MQF1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.20e-58	1.19e-24	0.9074
1. PBF	A8GM00	Ribosomal RNA small subunit methyltransferase G	4.44e-16	4.76e-33	2.17e-09	0.8401
1. PBF	B2TUN5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8751
1. PBF	B0JYE6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.76e-38	3.71e-28	0.8869
1. PBF	A1VIB2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.90e-29	3.15e-23	0.8505
1. PBF	Q1IVQ3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.86e-28	2.12e-21	0.8089
1. PBF	A1UQU8	Ribosomal RNA small subunit methyltransferase G	3.33e-16	3.01e-33	1.32e-12	0.8309
1. PBF	Q92KW3	Ribosomal RNA small subunit methyltransferase G	5.55e-16	2.71e-26	3.94e-11	0.8183
1. PBF	Q1CCG7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.63e-37	6.21e-24	0.8387
1. PBF	A8YYR9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.09e-53	2.01e-37	0.9481
1. PBF	A4TSI5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.63e-37	6.21e-24	0.8599
1. PBF	Q8DI86	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.07e-33	3.45e-21	0.8542
1. PBF	A3CLJ1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.35e-58	8.65e-36	0.9353
1. PBF	A9BF05	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.25e-41	5.62e-23	0.894
1. PBF	Q5QZI9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.53e-39	4.44e-20	0.8636
1. PBF	A1VZY5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.25e-24	4.81e-18	0.8526
1. PBF	A6VL65	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.29e-32	6.02e-21	0.8619
1. PBF	Q60CS4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.20e-41	1.82e-18	0.8657
1. PBF	A4WGE7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.10e-38	1.41e-25	0.873
1. PBF	Q98R82	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.13e-45	1.08e-21	0.904
1. PBF	B7V7A1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.59e-35	8.28e-24	0.8678
1. PBF	Q478A1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.26e-37	1.00e-19	0.8752
1. PBF	A1WSY4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.49e-43	2.91e-26	0.8648
1. PBF	A9KLX7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.42e-62	2.06e-35	0.9434
1. PBF	P64240	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.26e-54	8.72e-37	0.9503
1. PBF	A4JA23	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.17e-34	1.08e-21	0.873
1. PBF	B6J2B9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.15e-39	4.03e-22	0.8771
1. PBF	Q8KAK0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.58e-41	3.32e-21	0.8602
1. PBF	Q3K431	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.13e-36	1.04e-19	0.8869
1. PBF	Q04K39	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.37e-58	5.82e-35	0.9326
1. PBF	Q12HF1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.20e-33	3.17e-19	0.7979
1. PBF	A5FJ42	Ribosomal RNA small subunit methyltransferase G	1.11e-16	5.14e-43	3.11e-12	0.8148
1. PBF	B8EDW0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.35e-37	2.45e-16	0.8834
1. PBF	Q5M5Y2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.82e-56	9.22e-39	0.9263
1. PBF	B1IHR7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.02e-60	9.88e-31	0.8883
1. PBF	Q31RM0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.24e-59	1.60e-24	0.8834
1. PBF	Q7NA87	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.04e-37	3.59e-21	0.8593
1. PBF	A4XDK0	Ribosomal RNA small subunit methyltransferase G	2.44e-15	1.75e-45	1.04e-17	0.839
1. PBF	A6L4P5	Ribosomal RNA small subunit methyltransferase G	2.22e-16	1.30e-40	1.42e-15	0.8027
1. PBF	A8YXD7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.13e-60	1.38e-45	0.934
1. PBF	A6TG44	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.18e-40	3.22e-25	0.8739
1. PBF	C1CL20	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.37e-58	5.82e-35	0.9327
1. PBF	A9IZX8	Ribosomal RNA small subunit methyltransferase G	1.11e-16	1.59e-33	7.11e-14	0.8139
1. PBF	Q1JND4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.57e-60	4.25e-39	0.9373
1. PBF	Q9WZG6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.87e-57	1.79e-26	0.8809
1. PBF	Q5GU13	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.44e-34	2.15e-28	0.8872
1. PBF	Q7P0A5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.82e-39	1.41e-23	0.8941
1. PBF	Q5XDS2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.95e-60	2.13e-38	0.9348
1. PBF	A1AXX8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.60e-32	4.74e-19	0.86
1. PBF	B5BIP4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	9.80e-24	0.8669
1. PBF	B6J8V2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.45e-38	1.12e-21	0.8559
1. PBF	Q7V5Q2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.87e-60	4.87e-16	0.909
1. PBF	Q30Z06	Ribosomal RNA small subunit methyltransferase G	2.22e-16	6.79e-36	1.25e-06	0.7594
1. PBF	Q1MR90	Ribosomal RNA small subunit methyltransferase G	2.44e-15	5.07e-23	3.13e-11	0.7811
1. PBF	Q1WRS8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.17e-55	1.81e-38	0.9247
1. PBF	P0DF45	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.58e-61	5.22e-39	0.9338
1. PBF	Q82YY1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.60e-59	1.90e-35	0.9203
1. PBF	Q047S1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.81e-59	1.17e-39	0.9303
1. PBF	A6W3T8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.41e-40	3.41e-24	0.891
1. PBF	B2GF22	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.36e-55	7.89e-33	0.9156
1. PBF	C1CR21	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.76e-59	5.01e-35	0.9329
1. PBF	Q9LCY2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.21e-47	2.42e-21	0.9337
1. PBF	A4XN49	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.17e-44	3.52e-29	0.9157
1. PBF	Q2S6G7	Ribosomal RNA small subunit methyltransferase G	2.10e-14	1.00e-38	1.94e-09	0.787
1. PBF	A1W208	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.76e-26	1.60e-18	0.8158
1. PBF	B0CJG0	Ribosomal RNA small subunit methyltransferase G	3.33e-15	9.26e-29	7.02e-12	0.8142
1. PBF	B9DTP3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.16e-59	2.57e-34	0.9287
1. PBF	C0M821	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.97e-59	5.48e-38	0.9405
1. PBF	Q01NF9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.95e-38	2.55e-22	0.8413
1. PBF	B4UKF8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.87e-36	2.48e-15	0.8545
1. PBF	Q6ND16	Ribosomal RNA small subunit methyltransferase G	1.89e-15	2.01e-30	1.48e-13	0.829
1. PBF	Q1LHJ9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.95e-28	1.04e-06	0.8428
1. PBF	A1RCA8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.50e-44	4.55e-18	0.8242
1. PBF	Q5YMS1	Ribosomal RNA small subunit methyltransferase G	4.06e-14	1.42e-27	9.37e-15	0.8377
1. PBF	A4SUS4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.13e-43	1.01e-24	0.8467
1. PBF	A4J9R9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.58e-63	1.26e-40	0.9326
1. PBF	Q0HD69	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.49e-37	8.38e-17	0.8825
1. PBF	C1CEP0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.55e-58	4.90e-35	0.9323
1. PBF	Q2JTZ8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.00e-47	1.34e-22	0.8978
1. PBF	A9MXB7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	9.80e-24	0.8645
1. PBF	B7J1B0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.57e-38	1.34e-09	0.8212
1. PBF	Q07VT4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.62e-37	3.71e-16	0.8763
1. PBF	Q4UP54	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.17e-36	2.96e-25	0.8905
1. PBF	Q5NEF0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.17e-36	4.16e-21	0.8266
1. PBF	Q11CN4	Ribosomal RNA small subunit methyltransferase G	6.66e-16	7.10e-31	5.75e-14	0.8443
1. PBF	Q1G8A5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.62e-59	1.10e-39	0.9293
1. PBF	P57946	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-33	3.77e-22	0.86
1. PBF	Q4QN56	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.38e-38	5.70e-20	0.8827
1. PBF	A4QIE3	Ribosomal RNA small subunit methyltransferase G	1.11e-16	1.83e-35	1.81e-17	0.8305
1. PBF	B8G6Y3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.91e-63	1.47e-35	0.9053
1. PBF	Q10Y54	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.17e-52	1.76e-28	0.8844
1. PBF	Q8NL53	Ribosomal RNA small subunit methyltransferase G	1.11e-16	2.43e-35	2.30e-17	0.83
1. PBF	B1M187	Ribosomal RNA small subunit methyltransferase G	3.11e-15	5.52e-35	3.88e-12	0.8121
1. PBF	A4WVY8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.57e-30	3.81e-14	0.823
1. PBF	Q49UI6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.19e-56	3.62e-35	0.9545
1. PBF	Q6MMJ3	Ribosomal RNA small subunit methyltransferase G 2	0.00e+00	4.93e-47	2.59e-20	0.8677
1. PBF	A1TI25	Ribosomal RNA small subunit methyltransferase G	8.88e-16	3.48e-50	3.56e-21	0.8605
1. PBF	B1MX30	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.62e-60	2.17e-36	0.9306
1. PBF	Q9JX38	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.30e-34	6.63e-22	0.885
1. PBF	B1KQ44	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.20e-37	7.92e-19	0.8744
1. PBF	Q1AR63	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.67e-44	2.60e-23	0.8626
1. PBF	Q31DK9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.65e-36	1.40e-26	0.8386
1. PBF	Q8PF23	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.61e-35	1.22e-29	0.8879
1. PBF	Q3AHY7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.09e-57	2.20e-13	0.8732
1. PBF	B1IWZ8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8765
1. PBF	Q2JMA3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.27e-45	1.95e-26	0.908
1. PBF	A7HNX8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.76e-38	1.76e-25	0.8851
1. PBF	Q83PJ7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.51e-41	4.19e-25	0.8745
1. PBF	Q9K1G3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.39e-34	4.97e-23	0.8844
1. PBF	Q31UN9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8778
1. PBF	Q30TL7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.22e-27	6.29e-19	0.8904
1. PBF	Q48V72	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.58e-61	5.22e-39	0.9343
1. PBF	B4RR25	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.49e-33	1.16e-20	0.8947
1. PBF	A3Q8S0	Ribosomal RNA small subunit methyltransferase G	2.00e-15	4.78e-54	2.33e-19	0.8279
1. PBF	Q5HUG5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.05e-24	3.48e-17	0.8509
1. PBF	Q8CMN7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.82e-56	1.09e-33	0.9494
1. PBF	Q329S9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.91e-43	3.77e-25	0.8763
1. PBF	B2TRH8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.76e-59	2.43e-37	0.8851
1. PBF	A4YCI8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.46e-38	1.13e-18	0.8859
1. PBF	Q7M9J8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.03e-26	1.13e-22	0.8743
1. PBF	A1KEG3	Ribosomal RNA small subunit methyltransferase G	2.33e-15	5.48e-52	9.33e-20	0.7868
1. PBF	A9M3R8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.30e-35	1.98e-19	0.8931
1. PBF	A0KR27	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.13e-36	1.69e-16	0.8449
1. PBF	A1V8U2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.51e-23	2.09e-18	0.8592
1. PBF	P0A124	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.53e-33	2.10e-19	0.8866
1. PBF	Q1QSC0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.06e-36	1.38e-20	0.8885
1. PBF	Q0SYT6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8772
1. PBF	Q92JI2	Ribosomal RNA small subunit methyltransferase G	7.77e-16	3.26e-33	1.11e-08	0.8398
1. PBF	Q8YSA7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.37e-58	1.76e-30	0.8764
1. PBF	Q5F5X7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.49e-33	1.16e-20	0.8947
1. PBF	Q6KH77	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.18e-19	1.52e-19	0.8216
1. PBF	Q2YR13	Ribosomal RNA small subunit methyltransferase G	2.89e-15	9.26e-29	7.02e-12	0.8139
1. PBF	A7FPL8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.07e-59	6.53e-31	0.8885
1. PBF	Q5M1E6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.82e-56	9.22e-39	0.9263
1. PBF	Q8EY69	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.36e-37	2.66e-07	0.7721
1. PBF	Q746Q5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.80e-40	2.85e-18	0.9323
1. PBF	B5RL03	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.33e-40	2.07e-11	0.8538
1. PBF	A8LXK0	Ribosomal RNA small subunit methyltransferase G	5.33e-15	2.83e-46	3.71e-15	0.7896
1. PBF	A3DAS4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.35e-37	2.45e-16	0.8822
1. PBF	B8CVV5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.38e-37	2.37e-17	0.8852
1. PBF	Q2J4A4	Ribosomal RNA small subunit methyltransferase G	1.45e-14	1.02e-19	4.54e-14	0.8427
1. PBF	A1AV41	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.02e-43	4.22e-23	0.9354
1. PBF	C3LGT9	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.15e-60	4.31e-40	0.9289
1. PBF	Q1GCL8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.57e-35	1.94e-16	0.8114
1. PBF	Q040U0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.62e-63	3.12e-40	0.9132
1. PBF	Q7VA38	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.79e-56	5.66e-19	0.8816
1. PBF	B3EGW1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.96e-36	1.19e-17	0.8458
1. PBF	Q1CVH7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.46e-36	8.72e-17	0.8631
1. PBF	Q8UBM1	Ribosomal RNA small subunit methyltransferase G	3.33e-16	1.42e-31	1.72e-14	0.8362
1. PBF	Q71VW1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-59	2.14e-33	0.9293
1. PBF	Q4A6Q0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.20e-55	9.02e-18	0.905
1. PBF	C1L0D6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.04e-58	5.64e-34	0.929
1. PBF	B7HZG8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.50e-59	2.89e-39	0.9288
1. PBF	C1C7R5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.76e-59	5.01e-35	0.9328
1. PBF	B4U4T4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.28e-59	6.04e-38	0.9393
1. PBF	B0BW04	Ribosomal RNA small subunit methyltransferase G	6.66e-16	3.96e-34	8.85e-14	0.8397
1. PBF	O67522	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.22e-27	1.95e-29	0.857
1. PBF	B2I4Q1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.47e-34	1.48e-28	0.8902
1. PBF	Q9PC50	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.83e-34	1.66e-28	0.8902
1. PBF	A1BJ05	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.38e-35	2.20e-18	0.8648
1. PBF	B7NR42	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.69e-41	1.27e-25	0.8742
1. PBF	B5E522	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.76e-59	5.01e-35	0.9327
1. PBF	A8G1X5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	3.23e-19	0.8815
1. PBF	A1WGT3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.66e-18	1.96e-16	0.7878
1. PBF	A0LE46	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.26e-33	3.50e-15	0.8678
1. PBF	A3MQI8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.36e-25	1.72e-18	0.8577
1. PBF	Q4JSC5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.57e-30	3.94e-16	0.8816
1. PBF	Q2NJ22	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.24e-45	7.02e-42	0.899
1. PBF	C4ZZ18	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8753
1. PBF	B1YGA6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.15e-59	3.03e-32	0.9374
1. PBF	A1JTD7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.75e-36	1.76e-22	0.8825
1. PBF	B6IV59	Ribosomal RNA small subunit methyltransferase G	8.77e-15	8.44e-31	6.13e-20	0.834
1. PBF	B1AI25	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.01e-63	1.43e-37	0.9227
1. PBF	Q03NV0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.52e-57	9.89e-33	0.9265
1. PBF	Q4K3A0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.10e-34	3.78e-18	0.8633
1. PBF	P59964	Ribosomal RNA small subunit methyltransferase G	2.66e-15	5.48e-52	9.33e-20	0.788
1. PBF	Q5N2N4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.24e-59	1.60e-24	0.8915
1. PBF	Q9KX67	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.71e-57	5.42e-23	0.9034
1. PBF	B1JR33	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.13e-37	2.50e-24	0.871
1. PBF	Q3IK40	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.47e-37	7.12e-24	0.8537
1. PBF	Q1C087	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.63e-37	6.21e-24	0.8596
1. PBF	A2SMF0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.73e-31	4.53e-22	0.867
1. PBF	A7GVP5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.95e-58	7.87e-40	0.9306
1. PBF	A6QKK0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.09e-53	2.01e-37	0.9508
1. PBF	B4SC71	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.57e-42	3.39e-18	0.8433
1. PBF	B6I3X7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8672
1. PBF	Q5LDN0	Ribosomal RNA small subunit methyltransferase G	1.11e-16	8.01e-36	2.41e-15	0.8225
1. PBF	B3PIT7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.42e-33	9.35e-21	0.8418
1. PBF	Q3ZXE0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.86e-65	9.63e-37	0.9446
1. PBF	B7IST2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.43e-60	3.22e-40	0.931
1. PBF	A5F469	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.97e-41	3.22e-26	0.8772
1. PBF	Q9ZM61	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.33e-23	9.21e-19	0.8726
1. PBF	A9IJ46	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.94e-06	9.29e-21	0.8547
1. PBF	A9R5U7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.63e-37	6.21e-24	0.8704
1. PBF	B2K7J3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.63e-37	6.21e-24	0.8708
1. PBF	O25703	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.15e-25	1.17e-18	0.8208
1. PBF	Q8DY64	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.12e-53	1.66e-30	0.9378
1. PBF	Q64UQ5	Ribosomal RNA small subunit methyltransferase G	2.22e-16	5.30e-27	2.53e-15	0.7777
1. PBF	P0A125	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.53e-33	2.10e-19	0.8865
1. PBF	Q0A4L8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.71e-44	4.48e-22	0.8228
1. PBF	Q14FV3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.17e-36	4.16e-21	0.8266
1. PBF	A0AMC5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.34e-59	2.94e-34	0.9287
1. PBF	P64237	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	9.80e-24	0.8647
1. PBF	Q15MT4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.51e-36	8.39e-23	0.8487
1. PBF	C3KWJ3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.53e-61	5.22e-33	0.8889
1. PBF	B2G582	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.17e-60	2.86e-39	0.927
1. PBF	C0R0Y0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.43e-36	9.63e-18	0.8995
1. PBF	Q9RYD6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.24e-54	2.33e-25	0.9304
1. PBF	Q9L7M3	Ribosomal RNA small subunit methyltransferase G	5.55e-16	2.84e-30	3.04e-17	0.8197
1. PBF	Q7V016	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.23e-60	1.24e-17	0.9145
1. PBF	Q6G1L0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.54e-38	3.06e-14	0.811
1. PBF	A4J072	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.11e-35	3.70e-21	0.8107
1. PBF	B7H3N1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.12e-34	4.70e-19	0.8644
1. PBF	Q5FI43	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.28e-59	6.37e-45	0.9328
1. PBF	Q74HM3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.99e-61	1.55e-39	0.9127
1. PBF	Q5HS34	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.29e-55	1.27e-34	0.95
1. PBF	A8MKR7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.76e-59	4.32e-38	0.9274
1. PBF	A0QND0	Ribosomal RNA small subunit methyltransferase G	7.33e-15	4.41e-35	5.85e-16	0.7954
1. PBF	Q97QD4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.76e-59	5.01e-35	0.9327
1. PBF	A8LPC4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.95e-28	3.26e-17	0.841
1. PBF	A7FPE8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.63e-37	6.21e-24	0.86
1. PBF	A0KQY8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.24e-43	5.90e-21	0.862
1. PBF	A4VZL7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.66e-59	3.69e-31	0.938
1. PBF	A9AJF2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.35e-32	1.53e-20	0.8657
1. PBF	Q4ZL14	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.06e-34	1.25e-19	0.8623
1. PBF	Q21DG3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.82e-33	1.03e-26	0.8675
1. PBF	A5FR82	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.25e-65	2.06e-36	0.9443
1. PBF	A8FM46	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.65e-24	5.80e-18	0.8506
1. PBF	Q46J33	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.71e-61	5.71e-22	0.8905
1. PBF	B2HNT4	Ribosomal RNA small subunit methyltransferase G	4.22e-15	2.79e-53	1.31e-18	0.8455
1. PBF	Q5ZZN1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.52e-36	5.05e-15	0.7851
1. PBF	P64238	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	9.80e-24	0.8672
1. PBF	Q7MV10	Ribosomal RNA small subunit methyltransferase G	3.33e-16	3.38e-32	1.25e-13	0.783
1. PBF	Q7MGH0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.25e-39	1.37e-22	0.8705
1. PBF	B8ZTN3	Ribosomal RNA small subunit methyltransferase G	2.44e-15	1.58e-27	4.61e-18	0.8043
1. PBF	Q0TLZ7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.17e-55	3.05e-37	0.8963
1. PBF	B0KRB8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.41e-33	1.25e-19	0.8878
1. PBF	Q3J6M1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.82e-42	9.22e-20	0.8687
1. PBF	C0MG47	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.43e-59	1.28e-37	0.9391
1. PBF	B0UJI7	Ribosomal RNA small subunit methyltransferase G	1.95e-14	4.17e-37	5.02e-15	0.8165
1. PBF	Q9K5M8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.95e-60	8.06e-36	0.9086
1. PBF	B8F6X2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.57e-35	3.18e-25	0.8812
1. PBF	Q1R4J2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	0.8775
1. PBF	P64239	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.26e-54	8.72e-37	0.9503
1. PBF	A6QC07	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.29e-26	5.21e-20	0.8463
1. PBF	C5D9Y5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.68e-60	4.67e-40	0.9379
1. PBF	Q57AJ8	Ribosomal RNA small subunit methyltransferase G	2.78e-15	9.26e-29	7.02e-12	0.7836
1. PBF	Q62FS7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.51e-23	2.09e-18	0.8591
1. PBF	Q16CZ7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.22e-30	1.89e-22	0.8384
1. PBF	Q67J35	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.67e-54	1.09e-32	0.8975
1. PBF	Q926V6	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.75e-57	5.35e-34	0.9216
1. PBF	B4TAY2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.82e-40	9.80e-24	0.8665
1. PBF	C1D5H2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.40e-37	1.13e-21	0.8765
1. PBF	P75220	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.01e-31	2.75e-23	0.8998
1. PBF	Q7W2I0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.04e-27	1.36e-17	0.8278
1. PBF	Q81JH4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.15e-60	4.31e-40	0.9288
1. PBF	Q2STD8	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.99e-27	2.85e-18	0.8541
1. PBF	A7H342	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.55e-23	4.15e-18	0.8518
1. PBF	Q03ZA4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	9.15e-62	6.03e-38	0.9464
1. PBF	C3MB65	Ribosomal RNA small subunit methyltransferase G	1.11e-16	1.86e-31	3.82e-12	0.8134
1. PBF	A7GJN7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	5.02e-60	9.88e-31	0.8879
1. PBF	A3N2V2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.96e-38	2.63e-23	0.864
1. PBF	Q6MQY9	Ribosomal RNA small subunit methyltransferase G 1	1.15e-14	4.56e-34	5.11e-16	0.8006
1. PBF	A5EXK3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.14e-28	2.06e-25	0.7967
1. PBF	A6WX78	Ribosomal RNA small subunit methyltransferase G	2.33e-15	3.97e-31	7.23e-15	0.7842
1. PBF	A5WBB3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.53e-33	2.10e-19	0.8878
1. PBF	A6TXE3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.46e-62	6.82e-43	0.9263
1. PBF	Q3APK2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.31e-23	2.35e-20	0.8592
1. PBF	P47620	Ribosomal RNA small subunit methyltransferase G	0.00e+00	4.55e-31	1.65e-13	0.8996
1. PBF	Q65CN3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.01e-60	1.17e-33	0.8906
1. PBF	A6M3M3	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.35e-59	1.45e-33	0.8903
1. PBF	Q21CM2	Ribosomal RNA small subunit methyltransferase G	3.22e-15	3.05e-35	7.93e-14	0.7821
1. PBF	Q6GD94	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.61e-52	3.42e-38	0.9483
1. PBF	A5IJ79	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.83e-59	1.48e-26	0.9167
2. PF	A6UR90	Protein-L-isoaspartate O-methyltransferase	2.31e-06	2.25e-02	NA	0.5837
2. PF	Q3J8U2	Ubiquinone biosynthesis O-methyltransferase	5.26e-08	9.87e-03	NA	0.5572
2. PF	B1LLI3	Ubiquinone biosynthesis O-methyltransferase	3.86e-08	3.84e-02	NA	0.5478
2. PF	O30199	Protein-L-isoaspartate O-methyltransferase 1	2.92e-06	2.27e-03	NA	0.5194
2. PF	C4ZU73	Ubiquinone biosynthesis O-methyltransferase	4.63e-08	2.34e-02	NA	0.5697
2. PF	A7ZP50	Ubiquinone biosynthesis O-methyltransferase	4.71e-08	2.34e-02	NA	0.5483
2. PF	Q73HZ4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	5.18e-06	1.01e-03	NA	0.5375
2. PF	Q31Z65	Ubiquinone biosynthesis O-methyltransferase	4.06e-08	3.88e-02	NA	0.5481
2. PF	Q5NEL0	50S ribosomal protein L3 glutamine methyltransferase	3.17e-06	4.11e-02	NA	0.4661
2. PF	B1IXV6	Ubiquinone biosynthesis O-methyltransferase	4.40e-08	3.91e-02	NA	0.5481
2. PF	Q66CZ4	Ubiquinone biosynthesis O-methyltransferase	6.10e-08	1.24e-02	NA	0.5553
2. PF	B8EA88	Ubiquinone biosynthesis O-methyltransferase	8.58e-08	1.63e-02	NA	0.5718
2. PF	Q482G8	Ubiquinone biosynthesis O-methyltransferase	1.28e-06	1.03e-03	NA	0.5484
2. PF	Q7WGT9	Ubiquinone biosynthesis O-methyltransferase	5.94e-08	1.21e-02	NA	0.5397
2. PF	B1X8C6	Ubiquinone biosynthesis O-methyltransferase	6.41e-08	2.34e-02	NA	0.5506
2. PF	A0B9U1	Protein-L-isoaspartate O-methyltransferase	1.17e-08	1.04e-04	NA	0.595
2. PF	B7LAP9	Ubiquinone biosynthesis O-methyltransferase	4.04e-08	3.88e-02	NA	0.5483
2. PF	B5FDT8	Ubiquinone biosynthesis O-methyltransferase	5.02e-08	2.34e-02	NA	0.5593
2. PF	O27962	Protein-L-isoaspartate O-methyltransferase 2	5.71e-06	3.06e-05	NA	0.4101
2. PF	C6DBN5	Ubiquinone biosynthesis O-methyltransferase	8.45e-08	2.89e-02	NA	0.5284
2. PF	A4Y759	Ubiquinone biosynthesis O-methyltransferase	7.94e-08	1.43e-02	NA	0.5669
2. PF	B5EYW1	Ubiquinone biosynthesis O-methyltransferase	7.41e-08	2.25e-02	NA	0.5548
2. PF	O26915	Protein-L-isoaspartate O-methyltransferase	4.18e-06	9.58e-04	NA	0.5145
2. PF	Q8TZR3	Protein-L-isoaspartate O-methyltransferase	3.34e-06	1.91e-03	NA	0.43
2. PF	B4TBE3	Ubiquinone biosynthesis O-methyltransferase	7.68e-08	2.25e-02	NA	0.5547
2. PF	Q8D8E0	Ubiquinone biosynthesis O-methyltransferase	5.19e-08	2.14e-02	NA	0.5618
2. PF	Q8FFP0	Ubiquinone biosynthesis O-methyltransferase	5.82e-08	2.97e-02	NA	0.5509
2. PF	Q1R9I4	Ubiquinone biosynthesis O-methyltransferase	6.20e-08	2.25e-02	NA	0.5481
2. PF	Q8TJK1	Arsenite methyltransferase	3.30e-07	5.93e-06	NA	0.497
2. PF	B4SYU8	Ubiquinone biosynthesis O-methyltransferase	4.88e-08	2.25e-02	NA	0.5572
2. PF	Q8DPZ3	Release factor glutamine methyltransferase	1.63e-06	1.51e-02	NA	0.6255
2. PF	A6UWM1	Protein-L-isoaspartate O-methyltransferase	5.49e-06	2.62e-03	NA	0.5892
2. PF	B6I7I7	Ubiquinone biosynthesis O-methyltransferase	4.05e-08	3.88e-02	NA	0.567
2. PF	O59534	Protein-L-isoaspartate O-methyltransferase	1.52e-05	8.18e-04	NA	0.42
2. PF	P37872	Uncharacterized protein YbxB	2.32e-09	1.16e-02	NA	0.6734
2. PF	A9L2Y4	Ubiquinone biosynthesis O-methyltransferase	8.66e-08	1.63e-02	NA	0.5796
2. PF	A6VI91	Protein-L-isoaspartate O-methyltransferase	2.19e-06	1.56e-02	NA	0.581
2. PF	A0KWN3	Ubiquinone biosynthesis O-methyltransferase	8.64e-08	5.40e-03	NA	0.5718
2. PF	A6TBT7	Ubiquinone biosynthesis O-methyltransferase	9.21e-08	4.97e-02	NA	0.5542
2. PF	B7N5J4	Ubiquinone biosynthesis O-methyltransferase	4.79e-08	2.34e-02	NA	0.5482
2. PF	B7NN47	Ubiquinone biosynthesis O-methyltransferase	3.98e-08	3.25e-02	NA	0.5477
2. PF	B2VIL6	Ubiquinone biosynthesis O-methyltransferase	4.66e-08	1.65e-02	NA	0.5715
2. PF	Q5E5J8	Ubiquinone biosynthesis O-methyltransferase	9.19e-08	1.60e-02	NA	0.5566
2. PF	A7GXS7	Carboxy-S-adenosyl-L-methionine synthase	2.52e-04	1.62e-03	NA	0.477
2. PF	Q2L2T5	Ubiquinone biosynthesis O-methyltransferase	5.36e-08	3.62e-03	NA	0.5398
2. PF	Q5F5B4	Release factor glutamine methyltransferase	1.46e-05	2.53e-02	NA	0.6181
2. PF	Q8Z560	Ubiquinone biosynthesis O-methyltransferase	4.90e-08	1.64e-02	NA	0.574
2. PF	Q8EEG9	Ubiquinone biosynthesis O-methyltransferase	1.24e-07	4.98e-03	NA	0.5608
2. PF	Q7MM27	Ubiquinone biosynthesis O-methyltransferase	5.20e-08	2.14e-02	NA	0.5651
2. PF	Q9X3X2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.93e-05	6.17e-05	NA	0.5534
2. PF	A3D499	Ubiquinone biosynthesis O-methyltransferase	8.27e-08	1.63e-02	NA	0.5796
2. PF	Q12UV0	Protein-L-isoaspartate O-methyltransferase	3.97e-06	1.85e-05	NA	0.5503
2. PF	Q32DV8	Ubiquinone biosynthesis O-methyltransferase	4.59e-08	2.34e-02	NA	0.5696
2. PF	Q2NSL7	Ubiquinone biosynthesis O-methyltransferase	9.71e-08	1.59e-03	NA	0.5467
2. PF	A1RJD1	Ubiquinone biosynthesis O-methyltransferase	7.82e-08	1.00e-02	NA	0.5729
2. PF	A5TZU0	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	1.54e-07	9.21e-03	NA	0.5251
2. PF	A4TNI8	Ubiquinone biosynthesis O-methyltransferase	4.54e-08	1.24e-02	NA	0.5553
2. PF	Q5GZB5	Ubiquinone biosynthesis O-methyltransferase	9.18e-08	1.68e-02	NA	0.5703
2. PF	B0TT38	Ubiquinone biosynthesis O-methyltransferase	6.73e-08	4.77e-03	NA	0.5664
2. PF	A6LNM3	Protein-L-isoaspartate O-methyltransferase	2.98e-06	3.67e-05	NA	0.6101
2. PF	A8H499	Ubiquinone biosynthesis O-methyltransferase	6.52e-08	1.23e-02	NA	0.5548
2. PF	B5BCS0	Ubiquinone biosynthesis O-methyltransferase	4.86e-08	2.21e-02	NA	0.5568
2. PF	P37431	Ubiquinone biosynthesis O-methyltransferase	5.00e-08	2.25e-02	NA	0.5571
2. PF	Q0HV07	Ubiquinone biosynthesis O-methyltransferase	1.02e-07	5.35e-03	NA	0.575
2. PF	C0Q093	Ubiquinone biosynthesis O-methyltransferase	5.17e-08	2.05e-02	NA	0.5545
2. PF	A8AAV7	Protein-L-isoaspartate O-methyltransferase	2.90e-06	1.50e-03	NA	0.5917
2. PF	P31113	Demethylmenaquinone methyltransferase	1.91e-06	2.25e-02	NA	0.5447
2. PF	B7MFZ8	Ubiquinone biosynthesis O-methyltransferase	6.14e-08	2.25e-02	NA	0.5722
2. PF	Q6LPD7	Ubiquinone biosynthesis O-methyltransferase	6.29e-08	5.12e-03	NA	0.575
2. PF	Q1CFZ1	Ubiquinone biosynthesis O-methyltransferase	6.34e-08	1.24e-02	NA	0.5722
2. PF	A7HL14	Protein-L-isoaspartate O-methyltransferase	4.05e-06	7.03e-03	NA	0.5255
2. PF	A8A296	Ubiquinone biosynthesis O-methyltransferase	4.70e-08	1.37e-02	NA	0.5481
2. PF	A9A8I9	Protein-L-isoaspartate O-methyltransferase	2.32e-06	2.31e-03	NA	0.6279
2. PF	B2SHS9	Ubiquinone biosynthesis O-methyltransferase	9.44e-08	1.68e-02	NA	0.5703
2. PF	Q9UXX0	Protein-L-isoaspartate O-methyltransferase	1.64e-05	1.09e-04	NA	0.497
2. PF	A1S6C9	Ubiquinone biosynthesis O-methyltransferase	4.04e-08	2.06e-02	NA	0.5669
2. PF	Q8ZGR6	Ubiquinone biosynthesis O-methyltransferase	6.14e-08	1.24e-02	NA	0.5553
2. PF	B5R249	Ubiquinone biosynthesis O-methyltransferase	7.79e-08	2.05e-02	NA	0.5539
2. PF	B7M5R7	Ubiquinone biosynthesis O-methyltransferase	4.42e-08	3.88e-02	NA	0.548
2. PF	A1KG37	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	6.49e-07	9.21e-03	NA	0.5217
2. PF	Q8XE29	Ubiquinone biosynthesis O-methyltransferase	6.46e-08	2.49e-02	NA	0.5509
2. PF	Q6M116	Protein-L-isoaspartate O-methyltransferase	2.54e-06	3.72e-03	NA	0.5764
2. PF	B5FNR7	Ubiquinone biosynthesis O-methyltransferase	4.68e-08	2.25e-02	NA	0.5573
2. PF	B1JS96	Ubiquinone biosynthesis O-methyltransferase	6.37e-08	1.24e-02	NA	0.5552
2. PF	B5RCA1	Ubiquinone biosynthesis O-methyltransferase	4.82e-08	2.05e-02	NA	0.5571
2. PF	A7Z627	Demethylmenaquinone methyltransferase	2.40e-06	1.10e-02	NA	0.5407
2. PF	Q609G2	Ubiquinone biosynthesis O-methyltransferase	6.85e-08	4.49e-04	NA	0.5534
2. PF	B2TW20	Ubiquinone biosynthesis O-methyltransferase	3.72e-08	3.88e-02	NA	0.5481
2. PF	C0R2Q3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	9.27e-06	9.40e-04	NA	0.5245
2. PF	Q7NJS7	Release factor glutamine methyltransferase	3.48e-05	3.17e-02	NA	0.5196
2. PF	Q6N3Y0	Arsenite methyltransferase	9.28e-07	1.26e-03	NA	0.532
2. PF	Q57M77	Ubiquinone biosynthesis O-methyltransferase	5.13e-08	2.05e-02	NA	0.5767
2. PF	A9R284	Ubiquinone biosynthesis O-methyltransferase	5.97e-08	1.24e-02	NA	0.5529
2. PF	P9WKL4	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	1.51e-07	9.21e-03	NA	0.5257
2. PF	A4G087	Protein-L-isoaspartate O-methyltransferase	2.69e-06	6.27e-03	NA	0.6046
2. PF	A6WNN7	Ubiquinone biosynthesis O-methyltransferase	8.67e-08	1.63e-02	NA	0.5694
2. PF	Q87ND5	Ubiquinone biosynthesis O-methyltransferase	5.27e-08	1.63e-02	NA	0.5676
2. PF	Q6D7X5	Ubiquinone biosynthesis O-methyltransferase	1.07e-07	6.90e-03	NA	0.5664
2. PF	A9MJY3	Ubiquinone biosynthesis O-methyltransferase	5.68e-08	9.79e-03	NA	0.5573
2. PF	Q5P7U3	Ubiquinone biosynthesis O-methyltransferase	1.03e-07	3.96e-03	NA	0.5611
2. PF	Q9V1J7	tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase TrmI	1.99e-06	2.59e-02	NA	0.5958
2. PF	A7MU79	Ubiquinone biosynthesis O-methyltransferase	5.39e-08	2.17e-02	NA	0.5634
2. PF	Q0W2W0	Protein-L-isoaspartate O-methyltransferase	4.35e-05	4.38e-06	NA	0.7625
3. BF	Q6MS67	Ribosomal RNA small subunit methyltransferase G	0.00e+00	NA	3.55e-86	0.9678
3. BF	A0LHE3	Ribosomal RNA small subunit methyltransferase G 2	4.45e-14	NA	6.76e-22	0.9054
3. BF	C3SBS8	(S)-tetrahydroprotoberberine N-methyltransferase	1.60e-06	NA	0.012	0.5391
4. PB	P0A6U5	Ribosomal RNA small subunit methyltransferase G	0.00e+00	7.53e-41	1.44e-25	NA
4. PB	B8GW32	Ribosomal RNA small subunit methyltransferase G	6.33e-15	1.41e-29	6.50e-12	NA
4. PB	Q5P4J7	Ribosomal RNA small subunit methyltransferase G	0.00e+00	3.67e-35	8.38e-22	NA
4. PB	Q4FNR5	Ribosomal RNA small subunit methyltransferase G	5.11e-15	1.84e-36	3.11e-12	NA
4. PB	A6T481	Ribosomal RNA small subunit methyltransferase G	0.00e+00	6.72e-27	1.53e-20	NA
4. PB	Q7WRF0	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.16e-27	2.37e-14	NA
4. PB	Q5FS13	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.43e-37	3.40e-24	NA
4. PB	B3PS51	Ribosomal RNA small subunit methyltransferase G	0.00e+00	8.11e-30	2.29e-12	NA
4. PB	O66106	Ribosomal RNA small subunit methyltransferase G	1.22e-15	5.59e-40	3.83e-14	NA
4. PB	Q1MA20	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.10e-25	2.81e-11	NA
4. PB	A4GAI1	Ribosomal RNA small subunit methyltransferase G	0.00e+00	2.36e-28	2.18e-21	NA
4. PB	P0CAW6	Ribosomal RNA small subunit methyltransferase G	2.44e-15	1.41e-29	6.50e-12	NA
4. PB	B0T6E2	Ribosomal RNA small subunit methyltransferase G	1.09e-14	5.81e-33	4.96e-14	NA
4. PB	Q2FUQ4	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.09e-53	2.01e-37	NA
4. PB	Q2RN75	Ribosomal RNA small subunit methyltransferase G	4.44e-16	1.42e-30	2.32e-15	NA
4. PB	B5ZV45	Ribosomal RNA small subunit methyltransferase G	2.22e-16	2.29e-27	1.64e-13	NA
4. PB	B9JEW2	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.72e-31	3.33e-14	NA
4. PB	A9HE10	Ribosomal RNA small subunit methyltransferase G	1.11e-16	5.14e-43	3.57e-18	NA
4. PB	Q73JU8	Ribosomal RNA small subunit methyltransferase G	1.44e-15	1.85e-10	8.31e-15	NA
4. PB	B2S4I3	Ribosomal RNA small subunit methyltransferase G	2.11e-15	5.59e-40	3.83e-14	NA
4. PB	Q0BW94	Ribosomal RNA small subunit methyltransferase G	0.00e+00	1.36e-25	1.34e-13	NA
4. PB	Q5NL06	Ribosomal RNA small subunit methyltransferase G	6.66e-16	1.82e-38	1.03e-15	NA
4. PB	B3CQX7	Ribosomal RNA small subunit methyltransferase G	1.11e-16	1.12e-25	5.96e-22	NA
4. PB	P9WGW9	Ribosomal RNA small subunit methyltransferase G	2.66e-15	5.48e-52	9.33e-20	NA
4. PB	A5CDU7	Ribosomal RNA small subunit methyltransferase G	1.11e-16	3.54e-25	6.21e-22	NA
5. P	Q2FRP5	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	1.16e-08	2.13e-03	NA	NA
5. P	B5XYI1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.77e-05	4.75e-04	NA	NA
5. P	C3MTW8	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.23e-06	3.35e-04	NA	NA
5. P	B5BH50	Carboxy-S-adenosyl-L-methionine synthase	7.91e-04	6.10e-03	NA	NA
5. P	A5HY34	Release factor glutamine methyltransferase	1.41e-06	3.85e-03	NA	NA
5. P	A9MPN3	Polyamine aminopropyltransferase	5.15e-03	3.63e-02	NA	NA
5. P	Q5F9R9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.38e-05	6.48e-04	NA	NA
5. P	B7NV33	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.20e-05	3.89e-04	NA	NA
5. P	P34412	Uncharacterized protein F22B7.9	5.76e-04	1.24e-03	NA	NA
5. P	A5W7G3	Ubiquinone biosynthesis O-methyltransferase	6.03e-08	7.03e-03	NA	NA
5. P	B1YC47	Protein-L-isoaspartate O-methyltransferase	7.17e-06	2.87e-04	NA	NA
5. P	Q12N04	Carboxy-S-adenosyl-L-methionine synthase	4.01e-04	2.14e-02	NA	NA
5. P	C3PLF4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.27e-05	1.55e-02	NA	NA
5. P	A7N9Y1	Ribosomal RNA small subunit methyltransferase J	3.04e-04	9.62e-03	NA	NA
5. P	Q87AE9	tRNA (guanine-N(7)-)-methyltransferase	4.92e-05	1.24e-02	NA	NA
5. P	A1SRS4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.11e-05	2.23e-03	NA	NA
5. P	Q322I9	Carboxy-S-adenosyl-L-methionine synthase	7.16e-04	8.74e-03	NA	NA
5. P	B0KSC8	Protein-L-isoaspartate O-methyltransferase	3.97e-05	2.80e-05	NA	NA
5. P	Q6FJ22	Protein N-terminal and lysine N-methyltransferase EFM7	5.98e-09	4.32e-04	NA	NA
5. P	Q8NLS3	tRNA (guanine-N(7)-)-methyltransferase	1.80e-05	4.50e-02	NA	NA
5. P	B5BIX9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.83e-05	1.02e-03	NA	NA
5. P	B0RXN7	Polyamine aminopropyltransferase	1.56e-03	2.66e-02	NA	NA
5. P	B2A578	Protein-L-isoaspartate O-methyltransferase	9.71e-06	4.53e-04	NA	NA
5. P	B6I4H5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.07e-05	3.89e-04	NA	NA
5. P	Q7MQD7	Ribosomal RNA small subunit methyltransferase J	2.95e-05	9.62e-03	NA	NA
5. P	Q4UME7	Ubiquinone biosynthesis O-methyltransferase	6.89e-07	2.09e-03	NA	NA
5. P	B6J5Y2	Ubiquinone biosynthesis O-methyltransferase	1.08e-07	2.05e-03	NA	NA
5. P	A6TD35	Protein-L-isoaspartate O-methyltransferase	1.89e-05	9.24e-05	NA	NA
5. P	B4SFU3	Protein-L-isoaspartate O-methyltransferase	3.87e-06	4.86e-05	NA	NA
5. P	A0A077ES70	Norbelladine 4'-O-methyltransferase 4	6.45e-04	1.05e-03	NA	NA
5. P	C1DRQ3	Ubiquinone biosynthesis O-methyltransferase	4.97e-08	6.55e-03	NA	NA
5. P	Q9JV83	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.73e-05	8.49e-04	NA	NA
5. P	O32036	tRNA 5-hydroxyuridine methyltransferase	6.77e-07	2.42e-06	NA	NA
5. P	B6EKL2	Protein-L-isoaspartate O-methyltransferase	5.42e-08	6.48e-04	NA	NA
5. P	Q5ZRH9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.46e-05	3.86e-04	NA	NA
5. P	Q8F9Q1	tRNA (guanine-N(7)-)-methyltransferase	4.92e-06	1.48e-02	NA	NA
5. P	Q2J419	Ubiquinone biosynthesis O-methyltransferase	1.55e-07	2.74e-03	NA	NA
5. P	A1U4B8	Carboxy-S-adenosyl-L-methionine synthase	3.79e-04	4.04e-02	NA	NA
5. P	Q5NQH8	Ribosomal RNA large subunit methyltransferase E	1.81e-05	4.69e-02	NA	NA
5. P	Q136H9	Protein-L-isoaspartate O-methyltransferase	3.42e-05	5.52e-04	NA	NA
5. P	Q3IY65	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.74e-05	2.73e-02	NA	NA
5. P	Q0PAS7	Carboxy-S-adenosyl-L-methionine synthase	2.72e-04	8.65e-04	NA	NA
5. P	Q2A524	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.82e-05	1.53e-03	NA	NA
5. P	O14028	Probable MRF1 mitochondrial N(5)-glutamine methyltransferase mtq1	3.83e-04	2.84e-03	NA	NA
5. P	A0K5L4	Ubiquinone biosynthesis O-methyltransferase	6.71e-08	6.98e-04	NA	NA
5. P	Q8FBJ0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.08e-05	3.38e-04	NA	NA
5. P	A1UKA3	Putative O-methyltransferase Mkms_4069	5.21e-05	1.22e-04	NA	NA
5. P	A6TB39	Carboxy-S-adenosyl-L-methionine synthase	8.04e-04	1.42e-02	NA	NA
5. P	B4T803	Carboxy-S-adenosyl-L-methionine synthase	1.52e-03	6.32e-03	NA	NA
5. P	B4SVF5	Carboxy-S-adenosyl-L-methionine synthase	7.71e-04	6.32e-03	NA	NA
5. P	B9KQZ1	Protein-L-isoaspartate O-methyltransferase	3.00e-05	2.66e-02	NA	NA
5. P	A4WNC5	Protein-L-isoaspartate O-methyltransferase	3.05e-08	6.72e-03	NA	NA
5. P	Q39IU7	tRNA (guanine-N(7)-)-methyltransferase	1.10e-04	2.05e-02	NA	NA
5. P	Q9ZKC2	Protein-L-isoaspartate O-methyltransferase	2.49e-04	8.92e-07	NA	NA
5. P	A7MTT6	Protein-L-isoaspartate O-methyltransferase	2.13e-04	8.44e-03	NA	NA
5. P	Q9ZL11	Polyamine aminopropyltransferase	2.37e-02	2.50e-03	NA	NA
5. P	A3QC83	Protein-L-isoaspartate O-methyltransferase	1.10e-05	1.90e-04	NA	NA
5. P	B5YR15	Carboxy-S-adenosyl-L-methionine synthase	7.79e-04	8.59e-03	NA	NA
5. P	A1V753	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.52e-05	4.21e-03	NA	NA
5. P	Q1D6W9	Protein-L-isoaspartate O-methyltransferase	1.11e-04	1.65e-05	NA	NA
5. P	A6VLR7	tRNA (guanine-N(7)-)-methyltransferase	3.64e-06	2.55e-02	NA	NA
5. P	C5A009	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.64e-05	3.89e-04	NA	NA
5. P	A4SPN7	Carboxy-S-adenosyl-L-methionine synthase	9.15e-04	2.36e-02	NA	NA
5. P	Q3IIQ4	Carboxy-S-adenosyl-L-methionine synthase	9.44e-04	9.23e-04	NA	NA
5. P	C6DI77	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.94e-05	1.57e-03	NA	NA
5. P	Q606J9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.46e-05	1.17e-04	NA	NA
5. P	B5EFL1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.16e-05	3.45e-02	NA	NA
5. P	Q1H095	Protein-L-isoaspartate O-methyltransferase	2.68e-05	1.23e-03	NA	NA
5. P	A8FST4	Protein-L-isoaspartate O-methyltransferase 1	1.10e-05	7.44e-05	NA	NA
5. P	B7MKL7	Protein-L-isoaspartate O-methyltransferase	1.98e-04	2.26e-04	NA	NA
5. P	B4TBR3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.71e-05	1.02e-03	NA	NA
5. P	A4XWR1	Protein-L-isoaspartate O-methyltransferase	5.54e-06	1.69e-04	NA	NA
5. P	Q3KJC5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.04e-05	2.92e-02	NA	NA
5. P	A3QIE1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.85e-05	3.51e-04	NA	NA
5. P	B4EB49	Ubiquinone biosynthesis O-methyltransferase	3.06e-08	5.07e-04	NA	NA
5. P	P76290	Carboxy-S-adenosyl-L-methionine synthase	7.18e-04	8.15e-03	NA	NA
5. P	A0A482NB13	S-adenosyl-L-methionine-dependent Diels-Alderase iccD	8.55e-05	8.51e-03	NA	NA
5. P	Q8PFQ4	Polyamine aminopropyltransferase	1.59e-03	1.37e-02	NA	NA
5. P	A1U3K1	Ubiquinone biosynthesis O-methyltransferase	1.00e-07	3.66e-02	NA	NA
5. P	B8E6B6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.22e-05	5.63e-04	NA	NA
5. P	Q57636	Protein-L-isoaspartate O-methyltransferase	1.37e-06	1.57e-03	NA	NA
5. P	A4Y6S3	Carboxy-S-adenosyl-L-methionine synthase	6.95e-04	4.94e-03	NA	NA
5. P	Q8XFX8	Carboxy-S-adenosyl-L-methionine synthase	7.36e-04	6.10e-03	NA	NA
5. P	Q8H9B6	Caffeoyl-CoA O-methyltransferase	7.51e-04	5.30e-03	NA	NA
5. P	Q87DI1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.41e-05	6.16e-03	NA	NA
5. P	Q5HMV4	Carboxy-S-adenosyl-L-methionine synthase	4.78e-04	2.03e-02	NA	NA
5. P	Q68W57	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.76e-05	3.93e-04	NA	NA
5. P	Q4WYS7	Protein N-terminal and lysine N-methyltransferase efm7	2.85e-05	8.63e-05	NA	NA
5. P	Q2SKW3	Protein-L-isoaspartate O-methyltransferase	6.30e-06	4.31e-05	NA	NA
5. P	Q9Z439	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.39e-05	1.49e-03	NA	NA
5. P	Q21IR9	Ubiquinone biosynthesis O-methyltransferase	1.11e-07	2.53e-02	NA	NA
5. P	B1LM21	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.41e-05	3.89e-04	NA	NA
5. P	A4VLX7	Ubiquinone biosynthesis O-methyltransferase	5.52e-08	3.04e-02	NA	NA
5. P	Q13EN8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.10e-05	1.41e-02	NA	NA
5. P	Q7VF27	Carboxy-S-adenosyl-L-methionine synthase	6.93e-04	2.23e-02	NA	NA
5. P	Q87BG5	Ubiquinone biosynthesis O-methyltransferase	1.66e-07	4.32e-02	NA	NA
5. P	A8GX11	Ubiquinone biosynthesis O-methyltransferase	1.69e-07	6.07e-04	NA	NA
5. P	A1RHF9	Protein-L-isoaspartate O-methyltransferase	1.08e-04	6.17e-05	NA	NA
5. P	C3K706	Protein-L-isoaspartate O-methyltransferase	5.35e-06	4.22e-05	NA	NA
5. P	A8EZP4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.36e-05	6.73e-04	NA	NA
5. P	Q9JWE6	Ubiquinone biosynthesis O-methyltransferase	4.72e-08	1.84e-03	NA	NA
5. P	A3MNT8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.73e-05	4.21e-03	NA	NA
5. P	Q886L4	Protein-L-isoaspartate O-methyltransferase	5.99e-06	1.37e-04	NA	NA
5. P	Q7MVR7	Demethylmenaquinone methyltransferase	3.22e-05	4.35e-02	NA	NA
5. P	Q48F88	Protein-L-isoaspartate O-methyltransferase	6.18e-06	6.81e-05	NA	NA
5. P	B1L6T9	Protein-L-isoaspartate O-methyltransferase	8.53e-06	8.89e-05	NA	NA
5. P	A4WBM7	Carboxy-S-adenosyl-L-methionine synthase	7.55e-04	2.32e-02	NA	NA
5. P	B2VG25	Protein-L-isoaspartate O-methyltransferase	8.57e-06	7.90e-05	NA	NA
5. P	B2VJC2	Carboxy-S-adenosyl-L-methionine synthase	7.74e-04	1.64e-02	NA	NA
5. P	Q6DJF8	Probable methyltransferase-like protein 23	4.94e-08	1.43e-02	NA	NA
5. P	A1DZZ3	Uncharacterized methyltransferase YrrT	2.70e-05	4.69e-02	NA	NA
5. P	Q87TH4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.96e-05	6.30e-04	NA	NA
5. P	B7GIU6	Uncharacterized methyltransferase Aflv_0758	4.32e-04	1.24e-02	NA	NA
5. P	B6YX51	Protein-L-isoaspartate O-methyltransferase	3.12e-05	1.83e-04	NA	NA
5. P	Q9XAP8	Demethylmenaquinone methyltransferase	2.31e-04	9.87e-03	NA	NA
5. P	B8CI06	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.54e-05	1.53e-03	NA	NA
5. P	Q8Z5M9	Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	9.67e-07	3.57e-02	NA	NA
5. P	P0A639	Demethylmenaquinone methyltransferase	1.73e-04	1.59e-02	NA	NA
5. P	B5XV38	Protein-L-isoaspartate O-methyltransferase	1.87e-05	7.01e-05	NA	NA
5. P	Q7NJY2	Protein-L-isoaspartate O-methyltransferase	6.51e-06	2.11e-06	NA	NA
5. P	Q86IC9	Probable caffeoyl-CoA O-methyltransferase 1	4.84e-05	3.84e-02	NA	NA
5. P	Q8UA66	Ubiquinone biosynthesis O-methyltransferase	2.52e-07	1.78e-04	NA	NA
5. P	Q8P8H2	Ubiquinone biosynthesis O-methyltransferase	1.08e-07	1.89e-03	NA	NA
5. P	A7NF26	Demethylmenaquinone methyltransferase	9.87e-05	6.78e-03	NA	NA
5. P	A9MY97	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.91e-05	1.02e-03	NA	NA
5. P	B1KPT0	Protein-L-isoaspartate O-methyltransferase	1.22e-05	1.04e-04	NA	NA
5. P	A4XKM9	Polyamine aminopropyltransferase	9.12e-06	3.11e-03	NA	NA
5. P	Q97A64	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	3.49e-06	2.26e-04	NA	NA
5. P	Q87UZ2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.16e-05	2.15e-02	NA	NA
5. P	A9KGL7	Ubiquinone biosynthesis O-methyltransferase	1.08e-07	1.08e-03	NA	NA
5. P	B2IUM7	2-phytyl-1,4-naphtoquinone methyltransferase	4.02e-05	7.28e-03	NA	NA
5. P	A0LGZ0	Ribosomal RNA large subunit methyltransferase E	1.77e-05	2.89e-02	NA	NA
5. P	Q0AA73	Ubiquinone biosynthesis O-methyltransferase	1.79e-07	5.54e-03	NA	NA
5. P	Q3YVD2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.80e-05	3.89e-04	NA	NA
5. P	B2SUB3	Protein-L-isoaspartate O-methyltransferase	1.21e-05	1.26e-02	NA	NA
5. P	A0A077EW86	Norbelladine 4'-O-methyltransferase 2	7.51e-04	1.76e-03	NA	NA
5. P	Q9CCA7	Putative O-methyltransferase ML1075	6.01e-05	2.34e-02	NA	NA
5. P	A9R115	Protein-L-isoaspartate O-methyltransferase	2.55e-05	3.90e-05	NA	NA
5. P	Q7MQ33	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.82e-05	1.52e-03	NA	NA
5. P	Q5E332	Protein-L-isoaspartate O-methyltransferase	2.09e-04	2.63e-04	NA	NA
5. P	P22061	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	9.31e-05	7.54e-03	NA	NA
5. P	Q6L1F4	Polyamine aminopropyltransferase	8.06e-04	1.92e-03	NA	NA
5. P	A1TDM2	Putative O-methyltransferase Mvan_4497	1.27e-04	6.10e-03	NA	NA
5. P	B8EI29	Ubiquinone biosynthesis O-methyltransferase	2.18e-07	2.01e-04	NA	NA
5. P	A2S8L1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.73e-05	4.21e-03	NA	NA
5. P	A5FZ96	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.44e-05	1.13e-03	NA	NA
5. P	A5WC54	Carboxy-S-adenosyl-L-methionine synthase	9.82e-04	6.61e-03	NA	NA
5. P	B0U509	tRNA (guanine-N(7)-)-methyltransferase	4.68e-05	1.28e-02	NA	NA
5. P	A0KWL3	Carboxy-S-adenosyl-L-methionine synthase	7.12e-04	6.27e-03	NA	NA
5. P	B4ETP1	Carboxy-S-adenosyl-L-methionine synthase	1.63e-03	3.88e-02	NA	NA
5. P	O24150	Caffeoyl-CoA O-methyltransferase 3	7.12e-04	2.55e-03	NA	NA
5. P	B9L9I3	Carboxy-S-adenosyl-L-methionine synthase	1.60e-04	7.45e-04	NA	NA
5. P	Q214W4	Protein-L-isoaspartate O-methyltransferase	4.91e-05	2.93e-04	NA	NA
5. P	B5ENR5	Ribosomal RNA large subunit methyltransferase E	1.37e-04	3.19e-03	NA	NA
5. P	Q3JCZ3	Protein-L-isoaspartate O-methyltransferase 1	3.70e-05	3.28e-04	NA	NA
5. P	Q88M10	Ubiquinone biosynthesis O-methyltransferase	2.59e-08	7.03e-03	NA	NA
5. P	B5Z7J7	Polyamine aminopropyltransferase	2.35e-02	2.67e-03	NA	NA
5. P	Q81ZZ8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.16e-05	8.89e-05	NA	NA
5. P	B7NFD6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.67e-05	3.89e-04	NA	NA
5. P	A5F4E5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.03e-05	8.26e-04	NA	NA
5. P	Q17WL9	Polyamine aminopropyltransferase	2.44e-02	4.06e-03	NA	NA
5. P	Q8Z474	Protein-L-isoaspartate O-methyltransferase	1.71e-05	1.64e-04	NA	NA
5. P	Q9PJW4	Demethylmenaquinone methyltransferase	7.35e-05	4.65e-02	NA	NA
5. P	B1XHD8	Carboxy-S-adenosyl-L-methionine synthase	7.17e-04	8.15e-03	NA	NA
5. P	B1YB61	Polyamine aminopropyltransferase	2.75e-04	4.81e-02	NA	NA
5. P	A7I4W9	Protein-L-isoaspartate O-methyltransferase	1.23e-05	8.08e-03	NA	NA
5. P	Q2S176	Protein-L-isoaspartate O-methyltransferase	1.09e-05	1.41e-04	NA	NA
5. P	C3K6J1	Ubiquinone biosynthesis O-methyltransferase	5.00e-08	1.10e-02	NA	NA
5. P	A1S4E3	Protein-L-isoaspartate O-methyltransferase	1.27e-05	2.42e-04	NA	NA
5. P	B1MCE2	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	4.72e-07	1.56e-02	NA	NA
5. P	A8FUW4	Carboxy-S-adenosyl-L-methionine synthase	3.48e-04	1.30e-02	NA	NA
5. P	P80895	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	1.25e-04	1.96e-02	NA	NA
5. P	P23506	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	1.26e-04	9.96e-03	NA	NA
5. P	A8LQK6	Protein-L-isoaspartate O-methyltransferase	4.43e-05	2.24e-05	NA	NA
5. P	B0B9D1	Release factor glutamine methyltransferase	1.11e-05	1.10e-02	NA	NA
5. P	A5UVB2	Demethylmenaquinone methyltransferase	1.60e-04	8.11e-04	NA	NA
5. P	C4ZQF4	Carboxy-S-adenosyl-L-methionine synthase	1.40e-03	8.15e-03	NA	NA
5. P	B2IA21	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.64e-05	6.16e-03	NA	NA
5. P	A0A077EWA5	Norbelladine 4'-O-methyltransferase	6.85e-04	2.82e-04	NA	NA
5. P	A8A3M2	Protein-L-isoaspartate O-methyltransferase	1.69e-05	2.07e-04	NA	NA
5. P	B2SFA2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.35e-05	1.16e-03	NA	NA
5. P	Q5RE14	Protein N-lysine methyltransferase METTL21A	2.67e-05	3.19e-05	NA	NA
5. P	A3Q3Q7	Putative O-methyltransferase Mjls_4009	5.36e-05	1.20e-03	NA	NA
5. P	Q8ZYN0	Protein-L-isoaspartate O-methyltransferase	8.57e-06	2.99e-02	NA	NA
5. P	Q0HIX5	Ubiquinone biosynthesis O-methyltransferase	7.53e-08	5.25e-03	NA	NA
5. P	A3PFL1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	7.21e-05	2.73e-02	NA	NA
5. P	P9WJZ7	Putative O-methyltransferase Rv1220c	3.28e-05	8.89e-03	NA	NA
5. P	B6EGR4	Ribosomal RNA small subunit methyltransferase J	2.79e-05	2.42e-02	NA	NA
5. P	P57463	Ribosomal RNA large subunit methyltransferase E	2.49e-04	1.52e-02	NA	NA
5. P	Q57836	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.06e-05	3.75e-02	NA	NA
5. P	Q27869	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	1.10e-04	1.57e-03	NA	NA
5. P	B1J5G4	Ubiquinone biosynthesis O-methyltransferase	3.42e-08	1.31e-02	NA	NA
5. P	Q81ZZ2	Ubiquinone biosynthesis O-methyltransferase	6.03e-08	8.89e-03	NA	NA
5. P	A0QCH0	Putative O-methyltransferase MAV_1364	6.86e-05	7.21e-03	NA	NA
5. P	P17993	Ubiquinone biosynthesis O-methyltransferase	6.86e-08	2.34e-02	NA	NA
5. P	O74386	Uncharacterized methyltransferase C3H7.11	1.57e-06	3.37e-03	NA	NA
5. P	Q4FQB1	Carboxy-S-adenosyl-L-methionine synthase	1.92e-04	2.47e-02	NA	NA
5. P	A9IQF4	Ubiquinone biosynthesis O-methyltransferase	3.80e-07	3.90e-05	NA	NA
5. P	Q71N41	Guanidinoacetate N-methyltransferase	6.10e-06	2.13e-03	NA	NA
5. P	A4SM99	Ubiquinone biosynthesis O-methyltransferase	6.57e-08	3.39e-02	NA	NA
5. P	B1KR07	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.72e-05	1.68e-04	NA	NA
5. P	Q74N89	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	1.34e-05	3.25e-03	NA	NA
5. P	B6JMT1	Protein-L-isoaspartate O-methyltransferase	1.07e-05	2.79e-07	NA	NA
5. P	B1J0L8	Carboxy-S-adenosyl-L-methionine synthase	7.30e-04	8.59e-03	NA	NA
5. P	Q253I8	Demethylmenaquinone methyltransferase	3.65e-04	3.04e-02	NA	NA
5. P	B3ELJ9	Protein-L-isoaspartate O-methyltransferase	3.10e-06	2.13e-04	NA	NA
5. P	A0R2D5	Putative O-methyltransferase MSMEG_5073/MSMEI_4947	2.87e-05	7.46e-06	NA	NA
5. P	A6X6Y1	Protein-L-isoaspartate O-methyltransferase	9.64e-06	5.31e-05	NA	NA
5. P	Q487E5	Protein-L-isoaspartate O-methyltransferase	5.39e-06	1.64e-04	NA	NA
5. P	A4Y937	Protein-L-isoaspartate O-methyltransferase	1.07e-04	6.17e-05	NA	NA
5. P	B4S0J8	Carboxy-S-adenosyl-L-methionine synthase	4.02e-04	4.80e-04	NA	NA
5. P	B5YX17	Ubiquinone biosynthesis O-methyltransferase	4.85e-08	2.49e-02	NA	NA
5. P	Q8P447	Polyamine aminopropyltransferase	1.56e-03	2.66e-02	NA	NA
5. P	P0A2K6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.88e-05	1.02e-03	NA	NA
5. P	A1JJT8	Protein-L-isoaspartate O-methyltransferase	1.88e-05	2.00e-05	NA	NA
5. P	B0TN76	Ribosomal RNA small subunit methyltransferase J	9.57e-05	7.40e-03	NA	NA
5. P	Q9ZCT9	Ubiquinone biosynthesis O-methyltransferase	5.66e-07	4.71e-04	NA	NA
5. P	A6UCF6	Ubiquinone biosynthesis O-methyltransferase	2.45e-06	5.87e-06	NA	NA
5. P	Q8E8K6	Ribosomal RNA small subunit methyltransferase J	6.21e-05	2.03e-02	NA	NA
5. P	A4TR39	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.94e-05	5.58e-04	NA	NA
5. P	A6WU68	Ribosomal RNA small subunit methyltransferase J	7.20e-05	3.31e-02	NA	NA
5. P	B7MW64	Carboxy-S-adenosyl-L-methionine synthase	7.88e-04	8.59e-03	NA	NA
5. P	A5UZW2	Protein-L-isoaspartate O-methyltransferase	6.35e-06	3.44e-04	NA	NA
5. P	A9MUB4	Carboxy-S-adenosyl-L-methionine synthase	7.82e-04	5.25e-03	NA	NA
5. P	O13748	Alpha N-terminal protein methyltransferase 1	1.23e-05	3.28e-02	NA	NA
5. P	Q9HZ63	Ubiquinone biosynthesis O-methyltransferase	7.48e-08	2.66e-02	NA	NA
5. P	Q47LE2	Demethylmenaquinone methyltransferase	1.86e-04	6.72e-03	NA	NA
5. P	Q7W5Z6	Ubiquinone biosynthesis O-methyltransferase	6.20e-08	1.85e-02	NA	NA
5. P	Q30T90	Carboxy-S-adenosyl-L-methionine synthase	6.28e-04	4.98e-04	NA	NA
5. P	Q74CZ5	Protein-L-isoaspartate O-methyltransferase	2.22e-04	3.84e-07	NA	NA
5. P	A8GFJ7	Carboxy-S-adenosyl-L-methionine synthase	7.95e-04	4.73e-02	NA	NA
5. P	Q2KCH9	Probable chemotaxis protein methyltransferase	3.09e-04	1.04e-04	NA	NA
5. P	B3PP83	Ubiquinone biosynthesis O-methyltransferase	2.75e-06	5.63e-04	NA	NA
5. P	B5FSM6	Carboxy-S-adenosyl-L-methionine synthase	1.48e-03	6.10e-03	NA	NA
5. P	B7LWJ2	Protein-L-isoaspartate O-methyltransferase	1.97e-04	1.35e-04	NA	NA
5. P	O28192	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	8.20e-06	1.53e-02	NA	NA
5. P	B2U4X1	Carboxy-S-adenosyl-L-methionine synthase	7.02e-04	1.55e-02	NA	NA
5. P	B0TZP1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.99e-05	2.13e-03	NA	NA
5. P	B6J676	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.99e-05	4.03e-03	NA	NA
5. P	Q8P9Y6	Protein-L-isoaspartate O-methyltransferase	1.04e-05	1.56e-02	NA	NA
5. P	Q475X0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.90e-05	6.98e-04	NA	NA
5. P	A9KD75	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.07e-05	6.00e-03	NA	NA
5. P	B1Y2L3	Ubiquinone biosynthesis O-methyltransferase	2.59e-08	4.85e-03	NA	NA
5. P	B7MZ44	Protein-L-isoaspartate O-methyltransferase	1.98e-04	2.26e-04	NA	NA
5. P	Q68WB5	Ubiquinone biosynthesis O-methyltransferase	3.23e-07	9.49e-04	NA	NA
5. P	C3K8U4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.21e-05	1.03e-02	NA	NA
5. P	B4RZG8	Protein-L-isoaspartate O-methyltransferase	1.78e-04	3.58e-06	NA	NA
5. P	B5FAF3	Protein-L-isoaspartate O-methyltransferase	2.34e-04	1.24e-04	NA	NA
5. P	A0LL58	Protein-L-isoaspartate O-methyltransferase 1	9.61e-06	7.05e-04	NA	NA
5. P	Q1RJY5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.96e-05	5.95e-04	NA	NA
5. P	Q885T9	Ubiquinone biosynthesis O-methyltransferase	4.87e-08	1.00e-02	NA	NA
5. P	Q0BHA0	Ubiquinone biosynthesis O-methyltransferase	2.49e-08	1.23e-03	NA	NA
5. P	Q9A6T6	Protein-L-isoaspartate O-methyltransferase	1.62e-05	3.60e-02	NA	NA
5. P	Q9PIH5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.96e-04	4.80e-04	NA	NA
5. P	Q48PJ4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.92e-05	1.64e-02	NA	NA
5. P	B4SJ34	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.29e-05	3.12e-02	NA	NA
5. P	Q491V7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.97e-05	1.90e-04	NA	NA
5. P	Q0AME1	Ubiquinone biosynthesis O-methyltransferase	4.98e-07	4.64e-03	NA	NA
5. P	A7MQL7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.90e-05	2.35e-04	NA	NA
5. P	A0KGH9	Protein-L-isoaspartate O-methyltransferase	1.22e-04	9.83e-07	NA	NA
5. P	B3PH48	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.12e-05	2.07e-04	NA	NA
5. P	Q3KH83	Protein-L-isoaspartate O-methyltransferase	5.58e-06	2.58e-05	NA	NA
5. P	Q14GU4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.89e-05	2.35e-03	NA	NA
5. P	P72077	Ribosomal RNA small subunit methyltransferase J	2.24e-07	1.16e-04	NA	NA
5. P	Q58108	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	8.50e-06	3.75e-02	NA	NA
5. P	O32029	Uncharacterized methyltransferase YrrT	3.26e-05	2.29e-02	NA	NA
5. P	Q9JXI7	Ubiquinone biosynthesis O-methyltransferase	2.27e-08	2.35e-03	NA	NA
5. P	Q3SM81	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.84e-05	9.37e-03	NA	NA
5. P	Q6CUI0	Protein N-terminal and lysine N-methyltransferase EFM7	1.03e-08	4.21e-03	NA	NA
5. P	Q5PMY8	Carboxy-S-adenosyl-L-methionine synthase	1.53e-03	6.10e-03	NA	NA
5. P	Q9JTE9	Ribosomal RNA small subunit methyltransferase J	1.34e-04	1.38e-04	NA	NA
5. P	Q7N8K3	Protein-L-isoaspartate O-methyltransferase	2.29e-05	3.86e-05	NA	NA
5. P	Q1BE01	Demethylmenaquinone methyltransferase	1.55e-04	1.21e-02	NA	NA
5. P	A7ZU40	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.36e-05	3.89e-04	NA	NA
5. P	A1UAY5	Demethylmenaquinone methyltransferase	1.52e-04	1.21e-02	NA	NA
5. P	Q92GT5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.17e-05	1.42e-02	NA	NA
5. P	Q8P558	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.85e-05	8.66e-03	NA	NA
5. P	Q2P928	Polyamine aminopropyltransferase	1.55e-03	2.23e-02	NA	NA
5. P	B5F3I5	Carboxy-S-adenosyl-L-methionine synthase	8.22e-04	6.10e-03	NA	NA
5. P	A4TQ01	Protein-L-isoaspartate O-methyltransferase	2.36e-05	3.90e-05	NA	NA
5. P	Q9H867	Protein N-lysine methyltransferase METTL21D	1.44e-05	1.25e-04	NA	NA
5. P	Q8YLP4	2-phytyl-1,4-naphtoquinone methyltransferase	3.77e-05	1.01e-02	NA	NA
5. P	P0A888	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.31e-05	3.89e-04	NA	NA
5. P	Q5RJL2	Probable methyltransferase-like protein 23	4.51e-08	4.40e-03	NA	NA
5. P	Q66B88	Carboxy-S-adenosyl-L-methionine synthase 1	1.55e-03	3.69e-02	NA	NA
5. P	P9WKL5	2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase	6.52e-07	9.21e-03	NA	NA
5. P	Q8KFW8	Protein-L-isoaspartate O-methyltransferase	5.81e-06	1.26e-07	NA	NA
5. P	Q1RJC7	Ubiquinone biosynthesis O-methyltransferase	1.55e-07	6.07e-04	NA	NA
5. P	Q3IJV7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.90e-05	9.15e-04	NA	NA
5. P	Q54KW9	Methyltransferase-like protein 23	5.79e-07	2.63e-04	NA	NA
5. P	A4YKT6	Ubiquinone biosynthesis O-methyltransferase	4.32e-07	1.28e-03	NA	NA
5. P	B7LU01	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.54e-05	4.08e-04	NA	NA
5. P	Q92047	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	1.13e-04	1.53e-02	NA	NA
5. P	Q9ZCP3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.77e-05	1.12e-03	NA	NA
5. P	Q820B5	Ubiquinone biosynthesis O-methyltransferase	3.93e-08	2.60e-03	NA	NA
5. P	Q31XA5	Protein-L-isoaspartate O-methyltransferase	1.72e-05	2.07e-04	NA	NA
5. P	C3N0H8	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.22e-06	3.35e-04	NA	NA
5. P	Q74LY0	Demethylmenaquinone methyltransferase	1.69e-05	4.10e-03	NA	NA
5. P	Q1GCH8	Ubiquinone biosynthesis O-methyltransferase	6.11e-07	1.92e-03	NA	NA
5. P	P26236	Magnesium-protoporphyrin O-methyltransferase	6.31e-05	1.71e-04	NA	NA
5. P	B2K9A4	Ubiquinone biosynthesis O-methyltransferase	4.11e-08	1.24e-02	NA	NA
5. P	Q5PCY1	Ubiquinone biosynthesis O-methyltransferase	2.64e-08	2.21e-02	NA	NA
5. P	Q8XCH6	Carboxy-S-adenosyl-L-methionine synthase	1.59e-03	8.59e-03	NA	NA
5. P	B2VG41	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.70e-05	3.97e-04	NA	NA
5. P	B5YIQ8	Release factor glutamine methyltransferase	8.05e-06	1.23e-02	NA	NA
5. P	Q3SVP3	Ubiquinone biosynthesis O-methyltransferase	2.55e-07	9.58e-04	NA	NA
5. P	Q2RWE0	Release factor glutamine methyltransferase	1.25e-05	2.60e-03	NA	NA
5. P	Q1C474	Protein-L-isoaspartate O-methyltransferase	2.36e-05	3.90e-05	NA	NA
5. P	B5FFB3	Ribosomal RNA small subunit methyltransferase J	2.88e-05	3.94e-02	NA	NA
5. P	B4EWC9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.82e-05	3.92e-03	NA	NA
5. P	A4WFY5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.62e-05	4.01e-04	NA	NA
5. P	A8ANV7	Protein-L-isoaspartate O-methyltransferase	1.97e-04	1.63e-04	NA	NA
5. P	A4XPM7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.01e-05	1.68e-02	NA	NA
5. P	B5ZRR7	Ubiquinone biosynthesis O-methyltransferase	3.08e-06	1.42e-04	NA	NA
5. P	Q4ZPE6	Carboxy-S-adenosyl-L-methionine synthase	5.90e-04	3.17e-02	NA	NA
5. P	P53944	Mitochondrial MRF1 N(5)-glutamine methyltransferase MTQ1	1.62e-04	1.06e-03	NA	NA
5. P	Q1IGD2	tRNA (guanine-N(7)-)-methyltransferase	1.02e-05	4.21e-02	NA	NA
5. P	Q1RAR4	Carboxy-S-adenosyl-L-methionine synthase	7.24e-04	8.59e-03	NA	NA
5. P	Q7NQK7	Polyamine aminopropyltransferase	4.44e-04	8.22e-03	NA	NA
5. P	Q6FFY1	Ubiquinone biosynthesis O-methyltransferase	2.37e-08	2.21e-02	NA	NA
5. P	Q1CNB4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.96e-05	5.58e-04	NA	NA
5. P	Q729T9	Ribosomal RNA large subunit methyltransferase E	1.70e-05	1.70e-02	NA	NA
5. P	P9WIN2	Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase	1.55e-06	1.51e-02	NA	NA
5. P	B9MRW0	Polyamine aminopropyltransferase	3.74e-04	4.36e-03	NA	NA
5. P	B1YKZ4	Uncharacterized methyltransferase Exig_2346	2.16e-04	8.66e-03	NA	NA
5. P	C1AKN8	Demethylmenaquinone methyltransferase	2.00e-04	1.59e-02	NA	NA
5. P	Q2IIL9	Protein-L-isoaspartate O-methyltransferase	1.09e-04	7.08e-05	NA	NA
5. P	B8DNJ4	Ribosomal RNA large subunit methyltransferase E	1.96e-05	1.26e-02	NA	NA
5. P	Q8FGQ6	Carboxy-S-adenosyl-L-methionine synthase	7.60e-04	8.59e-03	NA	NA
5. P	B9KG20	Carboxy-S-adenosyl-L-methionine synthase	3.61e-04	1.76e-04	NA	NA
5. P	B4EBC4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.74e-05	4.44e-03	NA	NA
5. P	A4WCN5	Ubiquinone biosynthesis O-methyltransferase	6.48e-08	1.80e-02	NA	NA
5. P	Q9CQL0	Protein N-lysine methyltransferase METTL21A	1.57e-06	1.11e-05	NA	NA
5. P	Q0T3Q8	Carboxy-S-adenosyl-L-methionine synthase	7.37e-04	8.59e-03	NA	NA
5. P	Q1GFP1	Protein-L-isoaspartate O-methyltransferase	2.76e-05	4.01e-04	NA	NA
5. P	Q2KUG1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.64e-05	9.53e-03	NA	NA
5. P	Q5X0X6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.73e-05	5.32e-04	NA	NA
5. P	A3KI18	Geranyl diphosphate 2-C-methyltransferase	9.21e-07	1.74e-02	NA	NA
5. P	Q9HKE4	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	3.56e-06	9.02e-07	NA	NA
5. P	Q5YPB0	Demethylmenaquinone methyltransferase	2.22e-04	4.49e-04	NA	NA
5. P	Q8EEE7	Carboxy-S-adenosyl-L-methionine synthase	7.56e-04	6.42e-04	NA	NA
5. P	B0TK10	Protein-L-isoaspartate O-methyltransferase	1.25e-05	1.41e-04	NA	NA
5. P	B0T1Q1	Protein-L-isoaspartate O-methyltransferase	1.21e-05	1.42e-02	NA	NA
5. P	Q30YX3	Ribosomal RNA large subunit methyltransferase E	1.07e-05	6.21e-03	NA	NA
5. P	Q65GT8	Uncharacterized methyltransferase BLi02856/BL02021	2.97e-04	1.51e-02	NA	NA
5. P	B4T453	Protein-L-isoaspartate O-methyltransferase	1.67e-05	1.51e-04	NA	NA
5. P	Q3SK91	Ubiquinone biosynthesis O-methyltransferase	8.50e-08	3.22e-04	NA	NA
5. P	Q39IG8	Ubiquinone biosynthesis O-methyltransferase	2.84e-08	7.11e-04	NA	NA
5. P	Q1IDA6	Ubiquinone biosynthesis O-methyltransferase	4.18e-08	1.42e-02	NA	NA
5. P	Q3ILA5	Ubiquinone biosynthesis O-methyltransferase	3.11e-08	1.03e-02	NA	NA
5. P	Q0VQD1	Protein-L-isoaspartate O-methyltransferase	1.07e-05	2.23e-03	NA	NA
5. P	B6ISM3	Protein-L-isoaspartate O-methyltransferase	9.42e-06	1.79e-05	NA	NA
5. P	B5BEY0	Protein-L-isoaspartate O-methyltransferase	1.71e-05	1.64e-04	NA	NA
5. P	B6J3P6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.18e-05	6.00e-03	NA	NA
5. P	A7H3U1	Carboxy-S-adenosyl-L-methionine synthase	2.66e-04	8.33e-04	NA	NA
5. P	B3EEX3	Protein-L-isoaspartate O-methyltransferase	2.30e-06	2.22e-05	NA	NA
5. P	Q9JYF4	Ribosomal RNA small subunit methyltransferase J	1.38e-04	1.86e-04	NA	NA
5. P	Q2W4A2	Protein-L-isoaspartate O-methyltransferase	5.20e-05	3.23e-06	NA	NA
5. P	Q5RA89	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	1.20e-04	3.08e-03	NA	NA
5. P	P0A887	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.96e-05	3.89e-04	NA	NA
5. P	A7FKF4	Ubiquinone biosynthesis O-methyltransferase	5.60e-08	1.24e-02	NA	NA
5. P	A9NBI0	Ubiquinone biosynthesis O-methyltransferase	3.22e-08	2.60e-03	NA	NA
5. P	Q2W6W0	Ubiquinone biosynthesis O-methyltransferase	3.12e-06	7.23e-06	NA	NA
5. P	A9MIY3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.83e-05	9.15e-04	NA	NA
5. P	Q6D483	Carboxy-S-adenosyl-L-methionine synthase	7.09e-04	3.31e-02	NA	NA
5. P	A3QEP9	Carboxy-S-adenosyl-L-methionine synthase	3.86e-04	5.89e-03	NA	NA
5. P	A9MZR2	Polyamine aminopropyltransferase	1.37e-03	4.25e-02	NA	NA
5. P	B1W525	Demethylmenaquinone methyltransferase	1.69e-04	3.78e-03	NA	NA
5. P	Q48FM4	Ubiquinone biosynthesis O-methyltransferase	3.70e-08	2.23e-02	NA	NA
5. P	Q3JVZ6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.69e-05	4.21e-03	NA	NA
5. P	B1XAJ7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.42e-05	3.89e-04	NA	NA
5. P	Q0TGW2	Carboxy-S-adenosyl-L-methionine synthase	7.79e-04	8.59e-03	NA	NA
5. P	P9WFR2	Demethylmenaquinone methyltransferase	2.12e-04	1.59e-02	NA	NA
5. P	A3NRJ4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.73e-05	4.21e-03	NA	NA
5. P	A8G8B8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.19e-05	3.38e-04	NA	NA
5. P	Q47YJ3	Ribosomal RNA large subunit methyltransferase E	2.70e-05	3.25e-02	NA	NA
5. P	Q4UPN0	Polyamine aminopropyltransferase	1.56e-03	2.66e-02	NA	NA
5. P	B0KM36	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.92e-05	2.74e-03	NA	NA
5. P	Q5QUB2	Protein-L-isoaspartate O-methyltransferase	4.86e-05	1.88e-04	NA	NA
5. P	Q92H07	Ubiquinone biosynthesis O-methyltransferase	2.49e-06	4.56e-03	NA	NA
5. P	Q088H8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.69e-05	4.12e-04	NA	NA
5. P	B7LPH4	Carboxy-S-adenosyl-L-methionine synthase	1.55e-03	7.40e-03	NA	NA
5. P	Q2J302	Protein-L-isoaspartate O-methyltransferase 1	1.85e-05	3.15e-02	NA	NA
5. P	Q46Y42	Ubiquinone biosynthesis O-methyltransferase	8.02e-07	7.74e-04	NA	NA
5. P	C6A3F2	Protein-L-isoaspartate O-methyltransferase	4.03e-06	2.09e-03	NA	NA
5. P	A2BKH8	Protein-L-isoaspartate O-methyltransferase	6.41e-05	9.70e-03	NA	NA
5. P	A5II90	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.89e-05	2.44e-04	NA	NA
5. P	Q6LMT7	Protein-L-isoaspartate O-methyltransferase	9.13e-06	8.54e-05	NA	NA
5. P	B1XQE1	Protein-L-isoaspartate O-methyltransferase	1.15e-05	1.37e-02	NA	NA
5. P	A1KT06	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.07e-05	8.26e-04	NA	NA
5. P	Q00719	O-methyltransferase MdmC	3.87e-04	1.24e-05	NA	NA
5. P	A7FDE0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.20e-05	5.58e-04	NA	NA
5. P	Q0ANE2	Protein-L-isoaspartate O-methyltransferase	1.15e-04	1.26e-04	NA	NA
5. P	Q39VS0	Protein-L-isoaspartate O-methyltransferase	9.49e-06	1.81e-05	NA	NA
5. P	Q7MHQ8	Protein-L-isoaspartate O-methyltransferase	2.23e-04	9.52e-05	NA	NA
5. P	Q3JPX1	Ubiquinone biosynthesis O-methyltransferase	3.84e-08	3.04e-04	NA	NA
5. P	B1YV26	Ubiquinone biosynthesis O-methyltransferase	6.52e-08	1.23e-03	NA	NA
5. P	Q4UVL4	Ubiquinone biosynthesis O-methyltransferase	1.11e-07	1.89e-03	NA	NA
5. P	A4T8W9	Putative O-methyltransferase Mflv_2199	1.72e-04	6.10e-03	NA	NA
5. P	Q0VQX7	Carboxy-S-adenosyl-L-methionine synthase	3.76e-04	1.36e-03	NA	NA
5. P	B5YF00	Protein-L-isoaspartate O-methyltransferase	7.92e-06	1.00e-03	NA	NA
5. P	O01503	Electron transfer flavoprotein beta subunit lysine methyltransferase homolog	1.26e-04	9.21e-03	NA	NA
5. P	B3E6I4	Protein-L-isoaspartate O-methyltransferase	8.95e-05	2.07e-04	NA	NA
5. P	Q7VNB5	Ribosomal RNA small subunit methyltransferase J	5.26e-04	4.54e-02	NA	NA
5. P	Q8A005	Demethylmenaquinone methyltransferase	3.20e-05	2.10e-02	NA	NA
5. P	P67065	Demethylmenaquinone methyltransferase	9.30e-05	2.64e-03	NA	NA
5. P	Q4JBL7	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.62e-06	3.01e-04	NA	NA
5. P	Q4KHE7	Protein-L-isoaspartate O-methyltransferase	5.27e-06	5.00e-05	NA	NA
5. P	B7L7S3	Carboxy-S-adenosyl-L-methionine synthase	1.61e-03	8.59e-03	NA	NA
5. P	A6V2Q4	Ubiquinone biosynthesis O-methyltransferase	8.02e-08	2.45e-02	NA	NA
5. P	A9MF32	Protein-L-isoaspartate O-methyltransferase	1.69e-05	1.45e-04	NA	NA
5. P	A7NAA1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.26e-05	1.53e-03	NA	NA
5. P	A4IXK7	Ribosomal RNA small subunit methyltransferase J	1.25e-03	9.62e-03	NA	NA
5. P	C5BRL2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.21e-05	1.34e-03	NA	NA
5. P	B2K581	Protein-L-isoaspartate O-methyltransferase	1.91e-05	3.90e-05	NA	NA
5. P	A1RJQ8	Carboxy-S-adenosyl-L-methionine synthase	7.26e-04	2.57e-03	NA	NA
5. P	B1JXR2	Ubiquinone biosynthesis O-methyltransferase	7.18e-08	6.98e-04	NA	NA
5. P	B2SEQ2	Ribosomal RNA small subunit methyltransferase J	1.14e-03	9.62e-03	NA	NA
5. P	B4SZ73	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.79e-05	1.02e-03	NA	NA
5. P	Q5ZY91	tRNA (guanine-N(7)-)-methyltransferase	7.95e-05	8.37e-03	NA	NA
5. P	B0UAV0	Ubiquinone biosynthesis O-methyltransferase	3.94e-07	1.39e-04	NA	NA
5. P	B8DJP7	Protein-L-isoaspartate O-methyltransferase	4.68e-05	3.38e-04	NA	NA
5. P	Q8TYL4	Protein-L-isoaspartate O-methyltransferase	3.92e-06	8.51e-03	NA	NA
5. P	B8J017	Protein-L-isoaspartate O-methyltransferase	4.71e-05	3.04e-04	NA	NA
5. P	Q21BZ6	Ubiquinone biosynthesis O-methyltransferase	3.01e-07	2.48e-03	NA	NA
5. P	Q07N42	Protein-L-isoaspartate O-methyltransferase	9.76e-06	8.71e-05	NA	NA
5. P	A1TZ54	Protein-L-isoaspartate O-methyltransferase 1	1.10e-05	8.15e-03	NA	NA
5. P	B5R146	Carboxy-S-adenosyl-L-methionine synthase	1.50e-03	6.32e-03	NA	NA
5. P	Q63RZ8	Ubiquinone biosynthesis O-methyltransferase	3.63e-08	3.04e-04	NA	NA
5. P	Q6DAQ7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.10e-05	1.82e-03	NA	NA
5. P	A7MEB1	Carboxy-S-adenosyl-L-methionine synthase	7.98e-04	3.89e-03	NA	NA
5. P	Q9KVQ6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.96e-05	8.26e-04	NA	NA
5. P	A7I232	Carboxy-S-adenosyl-L-methionine synthase	2.39e-04	2.64e-02	NA	NA
5. P	A1URT5	Ubiquinone biosynthesis O-methyltransferase	1.87e-07	1.14e-05	NA	NA
5. P	Q31P90	2-phytyl-1,4-naphtoquinone methyltransferase	3.97e-05	1.91e-02	NA	NA
5. P	A7INP1	Protein-L-isoaspartate O-methyltransferase	4.39e-05	7.80e-03	NA	NA
5. P	Q97WC7	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.37e-06	2.23e-03	NA	NA
5. P	A8H1T1	Protein-L-isoaspartate O-methyltransferase	1.14e-05	1.97e-04	NA	NA
5. P	Q8D1I3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.52e-05	5.58e-04	NA	NA
5. P	Q606H1	Polyamine aminopropyltransferase	1.00e-03	2.59e-02	NA	NA
5. P	A8GT99	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.34e-05	1.35e-02	NA	NA
5. P	A7MPA9	Ubiquinone biosynthesis O-methyltransferase	8.37e-08	2.37e-03	NA	NA
5. P	C3N8G6	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.23e-06	3.35e-04	NA	NA
5. P	Q8PLR3	Protein-L-isoaspartate O-methyltransferase	1.21e-05	6.96e-03	NA	NA
5. P	A1WZR2	Polyamine aminopropyltransferase	1.10e-03	6.72e-03	NA	NA
5. P	C0Q2E4	Carboxy-S-adenosyl-L-methionine synthase	8.04e-04	3.78e-03	NA	NA
5. P	Q8FEJ8	Protein-L-isoaspartate O-methyltransferase	1.97e-04	2.26e-04	NA	NA
5. P	Q63XA0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.65e-05	4.21e-03	NA	NA
5. P	A4T183	Demethylmenaquinone methyltransferase	1.95e-04	8.44e-03	NA	NA
5. P	A5WA45	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.35e-05	1.94e-03	NA	NA
5. P	Q02EV4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.89e-05	3.19e-03	NA	NA
5. P	B8CJQ2	Protein-L-isoaspartate O-methyltransferase	1.61e-05	1.16e-04	NA	NA
5. P	Q92MK1	Ubiquinone biosynthesis O-methyltransferase	2.42e-06	9.15e-05	NA	NA
5. P	Q6BKI8	Protein N-terminal and lysine N-methyltransferase EFM7	1.12e-05	8.80e-05	NA	NA
5. P	A3D475	Carboxy-S-adenosyl-L-methionine synthase	6.41e-04	8.97e-03	NA	NA
5. P	B2JEZ6	Ubiquinone biosynthesis O-methyltransferase	1.03e-07	3.22e-03	NA	NA
5. P	Q8WXB1	Protein N-lysine methyltransferase METTL21A	7.42e-06	8.46e-05	NA	NA
5. P	P53970	Protein-lysine N-methyltransferase EFM6	5.39e-04	6.29e-05	NA	NA
5. P	A8AFH1	Carboxy-S-adenosyl-L-methionine synthase	8.41e-04	1.61e-02	NA	NA
5. P	B2S828	Ubiquinone biosynthesis O-methyltransferase	2.04e-07	6.65e-06	NA	NA
5. P	A1VY43	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.07e-04	2.28e-04	NA	NA
5. P	Q3K8T6	Ubiquinone biosynthesis O-methyltransferase	5.18e-08	1.19e-02	NA	NA
5. P	B4F223	Protein-L-isoaspartate O-methyltransferase	2.42e-05	2.88e-05	NA	NA
5. P	B2USZ6	Polyamine aminopropyltransferase	2.40e-02	1.62e-03	NA	NA
5. P	A1SAJ8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.71e-05	7.81e-04	NA	NA
5. P	B2K217	Carboxy-S-adenosyl-L-methionine synthase 1	1.89e-03	3.69e-02	NA	NA
5. P	C1DHS2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.54e-05	2.53e-03	NA	NA
5. P	A0Q814	Ribosomal RNA small subunit methyltransferase J	1.14e-03	1.11e-02	NA	NA
5. P	Q6NC69	Ubiquinone biosynthesis O-methyltransferase	2.19e-07	2.57e-03	NA	NA
5. P	Q5HVI0	Carboxy-S-adenosyl-L-methionine synthase	2.79e-04	8.65e-04	NA	NA
5. P	Q28TH8	Protein-L-isoaspartate O-methyltransferase	3.44e-05	7.03e-03	NA	NA
5. P	Q47D25	Protein-L-isoaspartate O-methyltransferase	9.41e-06	8.46e-05	NA	NA
5. P	A4F7P5	Erythromycin 3''-O-methyltransferase	4.35e-06	1.67e-02	NA	NA
5. P	Q6FCN6	tRNA (guanine-N(7)-)-methyltransferase	5.16e-05	2.30e-02	NA	NA
5. P	Q73SL8	Demethylmenaquinone methyltransferase	1.82e-04	1.52e-02	NA	NA
5. P	A0LZ51	Protein-L-isoaspartate O-methyltransferase	1.04e-05	5.05e-05	NA	NA
5. P	A0A077EYL8	Norbelladine 4'-O-methyltransferase 3	NA	3.58e-04	NA	NA
5. P	B4SU91	Polyamine aminopropyltransferase	1.62e-03	3.72e-02	NA	NA
5. P	Q2SY32	Ubiquinone biosynthesis O-methyltransferase	4.07e-08	3.86e-04	NA	NA
5. P	A6VTA1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.06e-05	4.48e-03	NA	NA
5. P	A8FKB3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.01e-04	3.64e-04	NA	NA
5. P	A3MY16	Protein-L-isoaspartate O-methyltransferase	9.78e-06	1.55e-02	NA	NA
5. P	B4TNX9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.74e-05	1.02e-03	NA	NA
5. P	Q4I2X5	Protein N-terminal and lysine N-methyltransferase EFM7	2.41e-08	4.57e-06	NA	NA
5. P	B1YWF9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.70e-05	4.52e-03	NA	NA
5. P	B5FTS1	Protein-L-isoaspartate O-methyltransferase	1.73e-05	1.51e-04	NA	NA
5. P	Q55AS5	Probable caffeoyl-CoA O-methyltransferase 3	1.16e-04	5.03e-04	NA	NA
5. P	Q2YLN5	Ubiquinone biosynthesis O-methyltransferase	1.95e-07	6.65e-06	NA	NA
5. P	Q11E01	Ubiquinone biosynthesis O-methyltransferase	3.44e-06	3.39e-05	NA	NA
5. P	A7HXK6	Protein-L-isoaspartate O-methyltransferase	5.21e-05	1.79e-04	NA	NA
5. P	Q5QYG2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.32e-05	5.90e-04	NA	NA
5. P	B7VGS0	Ubiquinone biosynthesis O-methyltransferase	6.62e-08	2.08e-02	NA	NA
5. P	Q64XV8	Demethylmenaquinone methyltransferase	2.50e-05	8.08e-03	NA	NA
5. P	A4IXH9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.97e-05	1.50e-03	NA	NA
5. P	B8H209	Ubiquinone biosynthesis O-methyltransferase	3.73e-07	1.32e-05	NA	NA
5. P	P60593	Polyamine aminopropyltransferase	4.48e-04	3.72e-03	NA	NA
5. P	Q81ZV1	Demethylmenaquinone methyltransferase	2.51e-04	4.97e-02	NA	NA
5. P	Q145P0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.85e-05	6.30e-04	NA	NA
5. P	B4TTV7	Protein-L-isoaspartate O-methyltransferase	1.70e-05	1.64e-04	NA	NA
5. P	Q7VRJ1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.63e-05	2.61e-04	NA	NA
5. P	Q62MP4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.62e-05	4.21e-03	NA	NA
5. P	A3D789	Protein-L-isoaspartate O-methyltransferase	1.32e-04	2.91e-05	NA	NA
5. P	A1AXI6	Carboxy-S-adenosyl-L-methionine synthase	4.05e-04	3.88e-02	NA	NA
5. P	B2UFG8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.94e-05	3.13e-04	NA	NA
5. P	A8II77	Ribosomal RNA large subunit methyltransferase E	3.87e-04	3.23e-02	NA	NA
5. P	A1KCM8	tRNA (guanine-N(7)-)-methyltransferase	8.13e-06	1.52e-02	NA	NA
5. P	Q58292	Probable S-adenosylmethionine-dependent methyltransferase MJ0882	4.12e-09	1.86e-03	NA	NA
5. P	Q3MD91	2-phytyl-1,4-naphtoquinone methyltransferase	3.05e-05	2.34e-02	NA	NA
5. P	A4IR67	Uncharacterized methyltransferase GTNG_2476	4.09e-04	7.96e-04	NA	NA
5. P	Q9KUI8	Protein-L-isoaspartate O-methyltransferase	2.36e-04	4.10e-05	NA	NA
5. P	A1KI08	Putative O-methyltransferase BCG_1280c	2.97e-05	8.89e-03	NA	NA
5. P	B1MHC3	Demethylmenaquinone methyltransferase	1.72e-04	1.68e-03	NA	NA
5. P	Q04W54	tRNA (guanine-N(7)-)-methyltransferase	3.57e-06	2.66e-02	NA	NA
5. P	B5FCP8	Carboxy-S-adenosyl-L-methionine synthase	7.89e-04	2.73e-02	NA	NA
5. P	Q05874	Protein N-terminal and lysine N-methyltransferase EFM7	8.44e-09	1.16e-05	NA	NA
5. P	A5F9C1	Protein-L-isoaspartate O-methyltransferase	2.36e-04	4.10e-05	NA	NA
5. P	P0A2K5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.71e-05	1.02e-03	NA	NA
5. P	P56133	Protein-L-isoaspartate O-methyltransferase	2.24e-04	1.96e-06	NA	NA
5. P	Q8PK00	Ubiquinone biosynthesis O-methyltransferase	4.36e-08	8.08e-03	NA	NA
5. P	P93711	Caffeoyl-CoA O-methyltransferase	3.60e-04	7.34e-03	NA	NA
5. P	A1JIF2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.82e-05	6.73e-04	NA	NA
5. P	Q5LH04	Demethylmenaquinone methyltransferase	2.57e-05	8.08e-03	NA	NA
5. P	Q9A258	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.04e-04	9.94e-04	NA	NA
5. P	A6WR22	Protein-L-isoaspartate O-methyltransferase	1.32e-04	2.91e-05	NA	NA
5. P	B0T7D0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	9.99e-05	9.32e-04	NA	NA
5. P	A8LNK7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	7.29e-05	4.69e-02	NA	NA
5. P	Q57HN8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.84e-05	1.02e-03	NA	NA
5. P	B4U8W2	Polyamine aminopropyltransferase	3.96e-04	1.90e-02	NA	NA
5. P	A3DDA0	Polyamine aminopropyltransferase	9.29e-04	2.73e-02	NA	NA
5. P	Q3B1L6	Protein-L-isoaspartate O-methyltransferase	4.90e-06	1.22e-06	NA	NA
5. P	A8F2G9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.30e-05	1.19e-02	NA	NA
5. P	Q3BUS3	Protein-L-isoaspartate O-methyltransferase	1.38e-05	1.12e-02	NA	NA
5. P	B8GVY5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.09e-04	9.94e-04	NA	NA
5. P	Q5LWM6	Ubiquinone biosynthesis O-methyltransferase	5.14e-07	1.55e-03	NA	NA
5. P	Q5GYL2	Protein-L-isoaspartate O-methyltransferase	1.21e-05	1.26e-02	NA	NA
5. P	B9DN09	Uncharacterized methyltransferase Sca_1399	1.17e-04	5.03e-03	NA	NA
5. P	Q5WSQ8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.80e-05	4.93e-04	NA	NA
5. P	Q5KWV8	Uncharacterized methyltransferase GK2543	4.39e-04	3.79e-04	NA	NA
5. P	A9ADW3	Ubiquinone biosynthesis O-methyltransferase	7.07e-08	9.85e-04	NA	NA
5. P	A9MNC8	Carboxy-S-adenosyl-L-methionine synthase	7.84e-04	7.60e-03	NA	NA
5. P	Q72AZ1	Protein-L-isoaspartate O-methyltransferase	4.77e-05	3.42e-05	NA	NA
5. P	Q8PPP2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.45e-05	7.47e-03	NA	NA
5. P	B1ZJW1	Protein-L-isoaspartate O-methyltransferase	6.72e-06	1.06e-05	NA	NA
5. P	C6DDF9	Protein-L-isoaspartate O-methyltransferase	7.82e-06	7.67e-05	NA	NA
5. P	Q2YBR7	Protein-L-isoaspartate O-methyltransferase 2	8.26e-06	1.23e-05	NA	NA
5. P	A6V1G4	Protein-L-isoaspartate O-methyltransferase	5.11e-06	4.81e-05	NA	NA
5. P	B7USP7	Carboxy-S-adenosyl-L-methionine synthase	6.98e-04	5.21e-03	NA	NA
5. P	A7ZMZ5	Carboxy-S-adenosyl-L-methionine synthase	7.49e-04	8.59e-03	NA	NA
5. P	Q8FYK0	Ubiquinone biosynthesis O-methyltransferase	2.00e-07	6.65e-06	NA	NA
5. P	Q8E9R7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.14e-05	6.30e-04	NA	NA
5. P	B1J2S8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.48e-05	2.89e-03	NA	NA
5. P	Q81ZX2	Demethylmenaquinone methyltransferase	1.83e-04	2.15e-03	NA	NA
5. P	Q74ZB5	Protein N-terminal and lysine N-methyltransferase EFM7	8.45e-09	1.78e-04	NA	NA
5. P	Q3A209	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.96e-05	1.19e-02	NA	NA
5. P	B9LMQ1	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	1.69e-08	2.51e-02	NA	NA
5. P	P15246	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	1.17e-04	5.25e-03	NA	NA
5. P	Q5BLD8	Protein N-lysine methyltransferase METTL21A	1.52e-05	6.67e-05	NA	NA
5. P	Q97F67	Release factor glutamine methyltransferase	1.05e-06	4.85e-02	NA	NA
5. P	Q6CHE9	Protein N-terminal and lysine N-methyltransferase EFM7	2.08e-05	2.43e-05	NA	NA
5. P	Q30ZM2	Protein-L-isoaspartate O-methyltransferase	5.60e-06	4.29e-03	NA	NA
5. P	B8IUB0	Ubiquinone biosynthesis O-methyltransferase	7.21e-07	1.16e-04	NA	NA
5. P	Q7MSC3	Carboxy-S-adenosyl-L-methionine synthase	2.98e-03	1.11e-02	NA	NA
5. P	A1ASL8	Protein-L-isoaspartate O-methyltransferase 1	9.46e-05	1.04e-05	NA	NA
5. P	Q55467	Magnesium-protoporphyrin O-methyltransferase	1.26e-07	1.19e-02	NA	NA
5. P	Q9UT28	Protein N-terminal and lysine N-methyltransferase efm7	3.24e-08	6.72e-06	NA	NA
5. P	B5R8D2	Carboxy-S-adenosyl-L-methionine synthase	7.87e-04	6.32e-03	NA	NA
5. P	Q9HUC0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.30e-05	3.19e-03	NA	NA
5. P	Q2IWH1	Protein-L-isoaspartate O-methyltransferase 2	2.38e-05	1.85e-04	NA	NA
5. P	Q1MBA9	Ubiquinone biosynthesis O-methyltransferase	3.51e-07	2.58e-04	NA	NA
5. P	C0Q3E1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.74e-05	1.02e-03	NA	NA
5. P	C6E228	Carboxy-S-adenosyl-L-methionine synthase	5.56e-04	2.92e-02	NA	NA
5. P	A8H966	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.51e-05	7.32e-04	NA	NA
5. P	A9KV34	Ribosomal RNA small subunit methyltransferase J	5.24e-05	4.11e-02	NA	NA
5. P	B8NI24	O-methyltransferase imqG	1.80e-05	4.21e-03	NA	NA
5. P	C3NJQ5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.37e-06	6.92e-04	NA	NA
5. P	B9JB78	Ubiquinone biosynthesis O-methyltransferase	1.48e-07	7.90e-05	NA	NA
5. P	B7M2G1	Carboxy-S-adenosyl-L-methionine synthase	1.62e-03	8.59e-03	NA	NA
5. P	A9R431	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.83e-05	5.58e-04	NA	NA
5. P	Q2RTH7	Protein-L-isoaspartate O-methyltransferase	4.36e-05	1.26e-05	NA	NA
5. P	P9WHV2	Release factor glutamine methyltransferase	3.21e-05	2.81e-03	NA	NA
5. P	A5U6W0	Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase	1.33e-06	1.51e-02	NA	NA
5. P	Q43237	Caffeoyl-CoA O-methyltransferase	7.53e-04	4.61e-02	NA	NA
5. P	Q7NZ91	Ubiquinone biosynthesis O-methyltransferase	4.10e-08	3.42e-02	NA	NA
5. P	Q28IN4	EEF1A lysine methyltransferase 3	1.70e-06	5.68e-04	NA	NA
5. P	Q1LRG9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.05e-05	2.19e-03	NA	NA
5. P	Q1GC56	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	1.73e-05	8.08e-03	NA	NA
5. P	Q39D13	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.77e-05	2.60e-03	NA	NA
5. P	B8GQ45	Polyamine aminopropyltransferase	3.30e-03	2.55e-02	NA	NA
5. P	A5ICZ5	Ribosomal RNA small subunit methyltransferase J	4.30e-05	2.99e-02	NA	NA
5. P	Q7VKW2	Ubiquinone biosynthesis O-methyltransferase	4.28e-07	1.80e-02	NA	NA
5. P	A0PQX0	Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1	1.91e-06	9.37e-03	NA	NA
5. P	B1LQ63	Protein-L-isoaspartate O-methyltransferase	1.72e-05	2.07e-04	NA	NA
5. P	Q8FSB3	Demethylmenaquinone methyltransferase	1.22e-04	3.28e-02	NA	NA
5. P	Q8ZBQ0	Protein-L-isoaspartate O-methyltransferase	2.36e-05	3.90e-05	NA	NA
5. P	Q163U2	Protein-L-isoaspartate O-methyltransferase	2.92e-05	1.62e-05	NA	NA
5. P	Q5WVL3	Ribosomal RNA small subunit methyltransferase J	5.26e-05	2.87e-02	NA	NA
5. P	A8GPI0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.64e-05	2.11e-03	NA	NA
5. P	B2SX35	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.29e-05	7.59e-04	NA	NA
5. P	Q3A4N4	Protein-L-isoaspartate O-methyltransferase	1.14e-05	8.36e-06	NA	NA
5. P	B7N6X3	Protein-L-isoaspartate O-methyltransferase	1.68e-05	2.07e-04	NA	NA
5. P	B6J1W2	Ubiquinone biosynthesis O-methyltransferase	3.40e-08	2.60e-03	NA	NA
5. P	A4SRB5	Protein-L-isoaspartate O-methyltransferase	1.26e-04	9.83e-07	NA	NA
5. P	B8J9E3	Protein-L-isoaspartate O-methyltransferase	5.86e-04	8.29e-05	NA	NA
5. P	B8ZQZ1	Putative O-methyltransferase MLBr01075	5.77e-05	2.34e-02	NA	NA
5. P	P34666	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	8.90e-05	3.84e-02	NA	NA
5. P	Q7U0D0	Putative O-methyltransferase Mb1252c	1.62e-04	8.89e-03	NA	NA
5. P	Q3SKJ2	Protein-L-isoaspartate O-methyltransferase	1.41e-05	1.79e-03	NA	NA
5. P	A1B5M0	Protein-L-isoaspartate O-methyltransferase	2.99e-05	6.61e-05	NA	NA
5. P	B9KPP7	Ubiquinone biosynthesis O-methyltransferase	3.92e-07	1.92e-05	NA	NA
5. P	Q9C9W3	Putative caffeoyl-CoA O-methyltransferase At1g67980	2.54e-04	3.82e-03	NA	NA
5. P	A4JC58	tRNA (guanine-N(7)-)-methyltransferase	8.33e-05	1.37e-02	NA	NA
5. P	Q0HL66	Protein-L-isoaspartate O-methyltransferase	1.00e-04	1.28e-03	NA	NA
5. P	Q2FRW3	Protein-L-isoaspartate O-methyltransferase	4.57e-06	1.40e-05	NA	NA
5. P	B5EZU8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.90e-05	1.02e-03	NA	NA
5. P	Q1R7U8	Protein-L-isoaspartate O-methyltransferase	1.97e-04	2.26e-04	NA	NA
5. P	A0A2H5AIZ6	Norbelladine 4'-O-methyltransferase	7.50e-04	7.05e-04	NA	NA
5. P	C0RFB8	Ubiquinone biosynthesis O-methyltransferase	1.78e-07	2.28e-05	NA	NA
5. P	Q1I5M8	Carboxy-S-adenosyl-L-methionine synthase	3.44e-04	4.39e-02	NA	NA
5. P	A0L1M4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.69e-05	5.17e-04	NA	NA
5. P	Q15P27	Protein-L-isoaspartate O-methyltransferase	1.24e-04	8.45e-06	NA	NA
5. P	B5QW73	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.25e-05	1.02e-03	NA	NA
5. P	Q2J2H9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.31e-05	2.82e-02	NA	NA
5. P	B0RTZ8	Protein-L-isoaspartate O-methyltransferase	1.11e-05	1.56e-02	NA	NA
5. P	Q7S634	Protein N-terminal and lysine N-methyltransferase efm7	1.18e-07	1.14e-03	NA	NA
5. P	A5FEA5	Protein-L-isoaspartate O-methyltransferase	1.40e-05	1.33e-04	NA	NA
5. P	P72818	2-phytyl-1,4-naphtoquinone methyltransferase	3.55e-05	1.44e-02	NA	NA
5. P	Q2LUT4	Protein-L-isoaspartate O-methyltransferase	1.26e-05	2.69e-03	NA	NA
5. P	O24144	Caffeoyl-CoA O-methyltransferase 1	6.85e-04	1.30e-03	NA	NA
5. P	Q5PKP4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.03e-05	1.02e-03	NA	NA
5. P	Q5V3Q6	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	1.23e-08	1.19e-02	NA	NA
5. P	Q5BAD0	Protein N-terminal and lysine N-methyltransferase efm7	2.97e-05	8.46e-05	NA	NA
5. P	B1J2G9	tRNA (guanine-N(7)-)-methyltransferase	1.41e-05	2.03e-02	NA	NA
5. P	B0CIC6	Ubiquinone biosynthesis O-methyltransferase	2.02e-07	6.65e-06	NA	NA
5. P	P0DUL6	O-methyltransferase hkm8	5.03e-05	8.81e-04	NA	NA
5. P	Q9FKT9	Nicotianamine synthase 2	5.03e-07	3.25e-02	NA	NA
5. P	Q6N453	Ribosomal RNA small subunit methyltransferase J	1.41e-07	1.41e-02	NA	NA
5. P	B8GX51	Protein-L-isoaspartate O-methyltransferase	1.56e-05	3.60e-02	NA	NA
5. P	C4KJM8	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.26e-06	3.35e-04	NA	NA
5. P	B2JCU8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.53e-05	3.64e-04	NA	NA
5. P	Q32A11	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.70e-05	3.89e-04	NA	NA
5. P	Q4R5H0	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	1.27e-04	5.07e-03	NA	NA
5. P	B0KTX4	Ubiquinone biosynthesis O-methyltransferase	6.71e-08	7.28e-03	NA	NA
5. P	Q0I516	tRNA (guanine-N(7)-)-methyltransferase	1.08e-05	2.55e-02	NA	NA
5. P	Q0TAM1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.70e-05	3.38e-04	NA	NA
5. P	O84027	Release factor glutamine methyltransferase	1.01e-05	1.02e-02	NA	NA
5. P	A4IGU3	Protein N-lysine methyltransferase METTL21A	1.94e-06	6.37e-07	NA	NA
5. P	Q2A5B9	Ribosomal RNA small subunit methyltransferase J	1.24e-03	9.62e-03	NA	NA
5. P	B0U4U6	Protein-L-isoaspartate O-methyltransferase	9.22e-06	9.28e-06	NA	NA
5. P	Q478Z3	tRNA (guanine-N(7)-)-methyltransferase	1.03e-05	6.55e-03	NA	NA
5. P	Q3BSF8	Ubiquinone biosynthesis O-methyltransferase	6.98e-08	2.89e-02	NA	NA
5. P	B1JB29	Protein-L-isoaspartate O-methyltransferase	2.58e-05	1.37e-05	NA	NA
5. P	B7MBS9	Carboxy-S-adenosyl-L-methionine synthase	7.70e-04	8.59e-03	NA	NA
5. P	B1JP75	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.77e-05	5.58e-04	NA	NA
5. P	B6JFP0	Protein-L-isoaspartate O-methyltransferase	5.96e-06	2.31e-05	NA	NA
5. P	Q3J3D1	Protein-L-isoaspartate O-methyltransferase	4.98e-05	2.66e-02	NA	NA
5. P	A9M3A0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.31e-05	1.59e-03	NA	NA
5. P	O51215	Release factor glutamine methyltransferase	NA	3.38e-04	NA	NA
5. P	Q5HWE7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.12e-04	2.28e-04	NA	NA
5. P	C4ZZP7	Protein-L-isoaspartate O-methyltransferase	1.69e-05	2.07e-04	NA	NA
5. P	Q1I3T0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.95e-05	1.53e-03	NA	NA
5. P	B0BUT9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.18e-05	1.35e-02	NA	NA
5. P	A3PNM3	Ubiquinone biosynthesis O-methyltransferase	3.62e-07	1.79e-05	NA	NA
5. P	Q1QEI9	Ubiquinone biosynthesis O-methyltransferase	2.85e-07	3.82e-05	NA	NA
5. P	Q9K075	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.33e-05	8.57e-04	NA	NA
5. P	Q2FWE1	Release factor glutamine methyltransferase	2.31e-06	2.75e-02	NA	NA
5. P	Q05197	Phosphatidylethanolamine N-methyltransferase	5.49e-06	1.48e-02	NA	NA
5. P	Q5E6A3	Carboxy-S-adenosyl-L-methionine synthase	7.06e-04	1.95e-02	NA	NA
5. P	A4FV42	Protein N-lysine methyltransferase METTL21A	3.28e-05	4.10e-05	NA	NA
5. P	Q88MF0	Protein-L-isoaspartate O-methyltransferase	3.94e-05	2.80e-05	NA	NA
5. P	Q2K3S8	Ubiquinone biosynthesis O-methyltransferase	2.70e-06	1.88e-04	NA	NA
5. P	B2SHF6	Polyamine aminopropyltransferase	1.56e-03	2.23e-02	NA	NA
5. P	Q5H6E7	Polyamine aminopropyltransferase	1.56e-03	2.23e-02	NA	NA
5. P	B5Z887	Protein-L-isoaspartate O-methyltransferase	1.15e-05	4.84e-07	NA	NA
5. P	A9N9F4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.00e-05	6.78e-03	NA	NA
5. P	C3LS22	Protein-L-isoaspartate O-methyltransferase	2.32e-04	4.10e-05	NA	NA
5. P	A4VJV3	Protein-L-isoaspartate O-methyltransferase	5.33e-06	2.22e-04	NA	NA
5. P	B0UWE3	tRNA (guanine-N(7)-)-methyltransferase	9.92e-06	2.51e-02	NA	NA
5. P	B3QCF3	Ubiquinone biosynthesis O-methyltransferase	2.08e-07	2.57e-03	NA	NA
5. P	A1AET7	Protein-L-isoaspartate O-methyltransferase	1.96e-04	2.26e-04	NA	NA
5. P	Q2NYW4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.83e-05	5.84e-03	NA	NA
5. P	Q8EBR6	Protein-L-isoaspartate O-methyltransferase	1.27e-04	4.84e-04	NA	NA
5. P	B7LXF5	Protein-L-isoaspartate O-methyltransferase	1.71e-05	2.07e-04	NA	NA
5. P	Q0KEH6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.61e-05	5.17e-04	NA	NA
5. P	Q1B4T4	Putative O-methyltransferase Mmcs_3995	4.83e-05	1.22e-04	NA	NA
5. P	Q6MCB5	Demethylmenaquinone methyltransferase	7.88e-05	4.12e-04	NA	NA
5. P	Q04XB2	tRNA (guanine-N(7)-)-methyltransferase	4.04e-06	2.66e-02	NA	NA
5. P	Q483C9	Carboxy-S-adenosyl-L-methionine synthase	4.65e-04	3.02e-02	NA	NA
5. P	Q9PD92	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.68e-05	3.75e-03	NA	NA
5. P	Q1BTN4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.49e-05	4.32e-03	NA	NA
5. P	Q081N3	Carboxy-S-adenosyl-L-methionine synthase	7.47e-04	4.85e-03	NA	NA
5. P	Q3IDD2	Protein-L-isoaspartate O-methyltransferase	7.42e-06	1.64e-04	NA	NA
5. P	Q8ZMF9	Protein-L-isoaspartate O-methyltransferase	1.70e-05	1.51e-04	NA	NA
5. P	A7ZED5	Carboxy-S-adenosyl-L-methionine synthase	2.46e-04	7.09e-03	NA	NA
5. P	Q21H69	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.39e-05	1.32e-03	NA	NA
5. P	Q16D32	Ubiquinone biosynthesis O-methyltransferase	3.74e-07	1.69e-04	NA	NA
5. P	A1S6P4	Carboxy-S-adenosyl-L-methionine synthase	4.30e-04	7.54e-03	NA	NA
5. P	Q13VB4	Ubiquinone biosynthesis O-methyltransferase	7.95e-08	2.35e-03	NA	NA
5. P	A1SST5	Carboxy-S-adenosyl-L-methionine synthase	4.63e-04	5.54e-03	NA	NA
5. P	A8G9Z6	Protein-L-isoaspartate O-methyltransferase	7.57e-06	6.35e-05	NA	NA
5. P	Q5F7B7	Ribosomal RNA small subunit methyltransferase J	1.81e-07	1.16e-04	NA	NA
5. P	A3CXP8	Protein-L-isoaspartate O-methyltransferase	1.08e-05	3.07e-04	NA	NA
5. P	Q57N92	Carboxy-S-adenosyl-L-methionine synthase	7.74e-04	3.78e-03	NA	NA
5. P	B4TYS8	Carboxy-S-adenosyl-L-methionine synthase	7.77e-04	6.32e-03	NA	NA
5. P	Q6G5K3	Ubiquinone biosynthesis O-methyltransferase	1.33e-07	4.95e-05	NA	NA
5. P	B6CZ62	Transmembrane O-methyltransferase homolog	5.12e-05	6.27e-03	NA	NA
5. P	A8I4G3	Protein-L-isoaspartate O-methyltransferase	8.33e-06	2.98e-04	NA	NA
5. P	C3MHQ9	Ubiquinone biosynthesis O-methyltransferase	1.44e-07	1.88e-05	NA	NA
5. P	Q1INS6	Protein-L-isoaspartate O-methyltransferase	7.91e-06	1.41e-03	NA	NA
5. P	A9FQE4	Ribosomal RNA large subunit methyltransferase E	6.57e-05	3.59e-03	NA	NA
5. P	A0Q549	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.21e-05	1.31e-03	NA	NA
5. P	Q73WV2	Putative O-methyltransferase MAP_2558	6.03e-05	5.21e-03	NA	NA
5. P	B8ECV6	Ribosomal RNA small subunit methyltransferase J	4.58e-05	1.57e-02	NA	NA
5. P	A8G0S7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.41e-05	5.79e-04	NA	NA
5. P	Q4UTP9	Protein-L-isoaspartate O-methyltransferase	9.43e-06	1.56e-02	NA	NA
5. P	A6WXQ0	Ubiquinone biosynthesis O-methyltransferase	4.10e-07	7.31e-06	NA	NA
5. P	A6WXR2	Ribosomal RNA small subunit methyltransferase J	4.82e-05	6.61e-03	NA	NA
5. P	A1U4P7	Protein-L-isoaspartate O-methyltransferase 2	3.67e-05	5.63e-04	NA	NA
5. P	P9WJZ6	Putative O-methyltransferase MT1258	3.01e-05	8.89e-03	NA	NA
5. P	P78860	rRNA methyltransferase 2, mitochondrial	1.44e-04	2.71e-02	NA	NA
5. P	P9WFR3	Demethylmenaquinone methyltransferase	2.00e-04	1.59e-02	NA	NA
5. P	B5XPZ6	Carboxy-S-adenosyl-L-methionine synthase	8.60e-04	2.30e-02	NA	NA
5. P	B0RS27	Ubiquinone biosynthesis O-methyltransferase	7.24e-08	1.89e-03	NA	NA
5. P	Q4FVG3	Ubiquinone biosynthesis O-methyltransferase	2.28e-07	3.41e-04	NA	NA
5. P	A8EY40	Ubiquinone biosynthesis O-methyltransferase	3.73e-07	1.14e-03	NA	NA
5. P	Q4ZWP9	Protein-L-isoaspartate O-methyltransferase	5.47e-06	1.03e-04	NA	NA
5. P	Q3IYM5	Ubiquinone biosynthesis O-methyltransferase	4.07e-07	3.06e-05	NA	NA
5. P	A8A171	Carboxy-S-adenosyl-L-methionine synthase	7.81e-04	8.59e-03	NA	NA
5. P	B0R515	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	1.80e-08	5.35e-03	NA	NA
5. P	B6I6D3	Protein-L-isoaspartate O-methyltransferase	1.69e-05	2.07e-04	NA	NA
5. P	A5G4S7	Protein-L-isoaspartate O-methyltransferase 2	1.62e-05	1.02e-05	NA	NA
5. P	A6L3D5	Demethylmenaquinone methyltransferase	2.83e-05	6.05e-03	NA	NA
5. P	A5GA37	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.63e-05	1.90e-02	NA	NA
5. P	Q07VB6	Ubiquinone biosynthesis O-methyltransferase	4.29e-06	2.89e-03	NA	NA
5. P	B7UNG3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.68e-05	3.89e-04	NA	NA
5. P	A3N5U8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.48e-05	4.21e-03	NA	NA
5. P	A9N1H6	Protein-L-isoaspartate O-methyltransferase	1.69e-05	1.51e-04	NA	NA
5. P	A1KV29	Ribosomal RNA small subunit methyltransferase J	1.39e-04	5.42e-04	NA	NA
5. P	Q9ZQV9	Nicotianamine synthase 1	7.11e-07	4.18e-02	NA	NA
5. P	B3PFU2	Carboxy-S-adenosyl-L-methionine synthase	4.84e-04	1.85e-02	NA	NA
5. P	B8CNX5	Carboxy-S-adenosyl-L-methionine synthase	3.32e-04	9.70e-03	NA	NA
5. P	Q5X479	Ribosomal RNA small subunit methyltransferase J	4.38e-05	1.08e-02	NA	NA
5. P	A7ZQI7	Protein-L-isoaspartate O-methyltransferase	1.66e-05	2.07e-04	NA	NA
5. P	O07431	Catechol O-methyltransferase	2.11e-05	1.89e-03	NA	NA
5. P	B0TJ16	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.78e-05	5.58e-04	NA	NA
5. P	Q89XU2	Ubiquinone biosynthesis O-methyltransferase	4.53e-07	3.49e-03	NA	NA
5. P	O08249	Protein-L-isoaspartate O-methyltransferase	3.39e-05	7.34e-07	NA	NA
5. P	A8FL14	Carboxy-S-adenosyl-L-methionine synthase	2.62e-04	1.02e-03	NA	NA
5. P	Q87LQ6	Protein-L-isoaspartate O-methyltransferase	1.32e-04	3.71e-04	NA	NA
5. P	Q32H79	Carboxy-S-adenosyl-L-methionine synthase	7.32e-04	8.59e-03	NA	NA
5. P	B2T641	Ubiquinone biosynthesis O-methyltransferase	6.41e-08	5.12e-03	NA	NA
5. P	A9M0C4	Ubiquinone biosynthesis O-methyltransferase	2.42e-08	1.06e-02	NA	NA
5. P	Q07LH9	Ribosomal RNA large subunit methyltransferase E	3.43e-04	7.54e-03	NA	NA
5. P	Q5NFE1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.65e-05	2.35e-03	NA	NA
5. P	Q43161	Caffeoyl-CoA O-methyltransferase	1.32e-03	1.90e-02	NA	NA
5. P	B4TPG0	Ubiquinone biosynthesis O-methyltransferase	5.08e-08	2.25e-02	NA	NA
5. P	Q4ZZG3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.03e-05	1.64e-02	NA	NA
5. P	Q21UL3	Ubiquinone biosynthesis O-methyltransferase	7.47e-08	1.10e-04	NA	NA
5. P	A3D9F2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.61e-05	6.18e-04	NA	NA
5. P	Q8DDP9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.06e-05	1.52e-03	NA	NA
5. P	B1IUT6	Protein-L-isoaspartate O-methyltransferase	2.00e-04	2.07e-04	NA	NA
5. P	Q31IM5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.23e-05	9.53e-03	NA	NA
5. P	A3DMG3	Protein-L-isoaspartate O-methyltransferase	4.63e-06	4.57e-04	NA	NA
5. P	Q9CD86	Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase	1.16e-06	1.07e-02	NA	NA
5. P	Q5QZ53	Ubiquinone biosynthesis O-methyltransferase	7.90e-08	7.22e-05	NA	NA
5. P	A4QHQ6	tRNA (guanine-N(7)-)-methyltransferase	1.79e-05	4.50e-02	NA	NA
5. P	A8A6U0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.24e-05	3.89e-04	NA	NA
5. P	Q0BBY4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.86e-05	4.52e-03	NA	NA
5. P	A5W820	Protein-L-isoaspartate O-methyltransferase	4.02e-05	2.80e-05	NA	NA
5. P	Q12PY8	Protein-L-isoaspartate O-methyltransferase	1.33e-05	3.13e-04	NA	NA
5. P	B7NBM1	Carboxy-S-adenosyl-L-methionine synthase	7.29e-04	7.94e-03	NA	NA
5. P	A5EJV5	Protein-L-isoaspartate O-methyltransferase	1.63e-05	4.22e-05	NA	NA
5. P	C1DCV3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.08e-05	6.85e-04	NA	NA
5. P	A8LQ43	Ubiquinone biosynthesis O-methyltransferase	6.06e-07	3.00e-03	NA	NA
5. P	Q123X2	Protein-L-isoaspartate O-methyltransferase 2	3.41e-05	6.42e-04	NA	NA
5. P	Q5P833	Protein-L-isoaspartate O-methyltransferase	3.78e-06	2.79e-04	NA	NA
5. P	A4YJH0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.97e-05	4.01e-02	NA	NA
5. P	B1JJF4	Protein-L-isoaspartate O-methyltransferase	2.35e-05	3.90e-05	NA	NA
5. P	A0KAF5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.84e-05	4.32e-03	NA	NA
5. P	Q8D382	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.76e-05	1.73e-03	NA	NA
5. P	A8GPB1	Ubiquinone biosynthesis O-methyltransferase	3.99e-06	3.42e-02	NA	NA
5. P	B8E004	Release factor glutamine methyltransferase	5.90e-06	1.26e-02	NA	NA
5. P	Q13EZ9	Ubiquinone biosynthesis O-methyltransferase	1.83e-07	8.30e-03	NA	NA
5. P	Q6MHQ3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.71e-05	1.16e-02	NA	NA
5. P	Q9KS61	Chemotaxis protein methyltransferase 2	3.78e-04	3.54e-04	NA	NA
5. P	A6WIE9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.91e-05	6.18e-04	NA	NA
5. P	A0PLV5	Demethylmenaquinone methyltransferase	1.50e-04	6.21e-03	NA	NA
5. P	Q62M18	Ubiquinone biosynthesis O-methyltransferase	3.64e-08	3.04e-04	NA	NA
5. P	A1T3S1	Demethylmenaquinone methyltransferase	1.63e-04	1.64e-02	NA	NA
5. P	O24149	Caffeoyl-CoA O-methyltransferase 2	7.20e-04	2.84e-03	NA	NA
5. P	Q8EWB6	tRNA (guanine-N(7)-)-methyltransferase	2.56e-05	1.17e-02	NA	NA
5. P	B2I705	Ubiquinone biosynthesis O-methyltransferase	1.70e-07	4.32e-02	NA	NA
5. P	C3MJI5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.20e-06	3.35e-04	NA	NA
5. P	B4RIY4	Ribosomal RNA small subunit methyltransferase J	1.26e-04	1.08e-04	NA	NA
5. P	O94628	Uncharacterized methyltransferase C1347.09	8.74e-06	4.14e-03	NA	NA
5. P	Q7P0V2	Ribosomal RNA small subunit methyltransferase J	2.73e-05	4.11e-02	NA	NA
5. P	Q0BNE2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.15e-05	1.53e-03	NA	NA
5. P	Q1R477	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.11e-05	3.38e-04	NA	NA
5. P	B7L996	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.12e-05	3.89e-04	NA	NA
5. P	A9KYL8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.24e-05	6.18e-04	NA	NA
5. P	Q5LQ09	Protein-L-isoaspartate O-methyltransferase	2.70e-05	5.73e-04	NA	NA
5. P	Q88D17	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.70e-05	1.94e-03	NA	NA
5. P	Q0A7L5	Protein-L-isoaspartate O-methyltransferase	2.35e-05	1.34e-02	NA	NA
5. P	A1RP78	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.49e-05	5.90e-04	NA	NA
5. P	A7FLX4	Protein-L-isoaspartate O-methyltransferase	2.36e-05	3.90e-05	NA	NA
5. P	Q14GA7	Ribosomal RNA small subunit methyltransferase J	1.19e-03	9.62e-03	NA	NA
5. P	A1JLA0	Ubiquinone biosynthesis O-methyltransferase	5.03e-08	1.76e-02	NA	NA
5. P	Q0ADP2	Protein-L-isoaspartate O-methyltransferase	1.43e-04	1.55e-02	NA	NA
5. P	Q9A9X1	Ubiquinone biosynthesis O-methyltransferase	5.17e-07	1.32e-05	NA	NA
5. P	A7IQW5	Protein-lysine methyltransferase C42C1.13	2.94e-05	3.70e-06	NA	NA
5. P	B3QEZ3	Ribosomal RNA small subunit methyltransferase J	3.42e-05	1.60e-02	NA	NA
5. P	A5EWT6	Ribosomal RNA small subunit methyltransferase J	4.11e-07	1.73e-03	NA	NA
5. P	A9VY77	Protein-L-isoaspartate O-methyltransferase	1.08e-05	3.45e-02	NA	NA
5. P	B6YXH6	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	2.20e-05	3.75e-02	NA	NA
5. P	B2HRQ2	Demethylmenaquinone methyltransferase	2.88e-04	4.64e-03	NA	NA
5. P	Q74EU2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	4.08e-05	5.40e-03	NA	NA
5. P	Q5JFG9	Polyamine aminopropyltransferase	6.37e-04	4.81e-02	NA	NA
5. P	Q9PF94	tRNA (guanine-N(7)-)-methyltransferase	5.60e-05	2.03e-02	NA	NA
5. P	B7V3F6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.36e-05	3.19e-03	NA	NA
5. P	A4YV66	Protein-L-isoaspartate O-methyltransferase	1.36e-05	2.04e-05	NA	NA
5. P	Q98G87	Ubiquinone biosynthesis O-methyltransferase	3.56e-07	1.85e-04	NA	NA
5. P	B5F407	Protein-L-isoaspartate O-methyltransferase	1.70e-05	1.51e-04	NA	NA
5. P	Q0HZP7	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.77e-05	5.17e-04	NA	NA
5. P	B4RK11	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.34e-05	6.48e-04	NA	NA
5. P	A0A0S2UWT1	Caffeoyl-CoA O-methyltransferase 2	7.01e-04	2.15e-03	NA	NA
5. P	Q2Y6R0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.23e-05	5.90e-04	NA	NA
5. P	A7MJ61	Protein-L-isoaspartate O-methyltransferase	1.38e-04	1.88e-05	NA	NA
5. P	Q4UMW4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.92e-05	2.17e-03	NA	NA
5. P	A1AC31	Carboxy-S-adenosyl-L-methionine synthase	7.60e-04	8.59e-03	NA	NA
5. P	Q0HUY5	Carboxy-S-adenosyl-L-methionine synthase	6.58e-04	1.46e-02	NA	NA
5. P	Q7VZG7	Ubiquinone biosynthesis O-methyltransferase	6.19e-08	1.80e-02	NA	NA
5. P	Q83KQ5	Carboxy-S-adenosyl-L-methionine synthase	7.92e-04	8.59e-03	NA	NA
5. P	Q3SRQ7	Protein-L-isoaspartate O-methyltransferase	3.01e-05	4.08e-04	NA	NA
5. P	A1Y9I9	Transmembrane O-methyltransferase homolog	6.26e-05	1.86e-02	NA	NA
5. P	B2TZI8	Protein-L-isoaspartate O-methyltransferase	1.68e-05	2.07e-04	NA	NA
5. P	A9BH07	Protein-L-isoaspartate O-methyltransferase	8.46e-06	2.19e-03	NA	NA
5. P	B5QW14	Protein-L-isoaspartate O-methyltransferase	1.72e-05	1.51e-04	NA	NA
5. P	Q0I685	Polyamine aminopropyltransferase	3.13e-03	4.39e-02	NA	NA
5. P	A9M8K8	Ubiquinone biosynthesis O-methyltransferase	2.11e-07	6.65e-06	NA	NA
5. P	Q5E8R9	Ribosomal RNA small subunit methyltransferase J	2.42e-05	3.25e-02	NA	NA
5. P	A1VC40	Ribosomal RNA large subunit methyltransferase E	1.57e-05	1.70e-02	NA	NA
5. P	B7V8C3	Protein-L-isoaspartate O-methyltransferase	5.72e-06	4.10e-05	NA	NA
5. P	A8EVV4	Carboxy-S-adenosyl-L-methionine synthase	3.29e-04	4.94e-03	NA	NA
5. P	A8H551	Carboxy-S-adenosyl-L-methionine synthase	3.35e-04	1.02e-02	NA	NA
5. P	Q2RWE9	Ubiquinone biosynthesis O-methyltransferase	9.02e-07	1.03e-04	NA	NA
5. P	B6I1E8	Carboxy-S-adenosyl-L-methionine synthase	7.77e-04	8.59e-03	NA	NA
5. P	C5BCA4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.27e-05	2.44e-04	NA	NA
5. P	Q3Z2P6	Carboxy-S-adenosyl-L-methionine synthase	7.14e-04	1.24e-02	NA	NA
5. P	Q5N4X9	2-phytyl-1,4-naphtoquinone methyltransferase	4.57e-05	1.91e-02	NA	NA
5. P	A1TSA0	Ubiquinone biosynthesis O-methyltransferase	4.17e-08	1.32e-02	NA	NA
5. P	Q6AWU6	Probable thiol methyltransferase 2	3.68e-07	1.17e-03	NA	NA
5. P	B2FK95	Protein-L-isoaspartate O-methyltransferase	1.12e-05	4.93e-02	NA	NA
5. P	Q9KVR6	Ribosomal RNA small subunit methyltransferase J	3.35e-05	4.46e-02	NA	NA
5. P	Q7CQC4	Carboxy-S-adenosyl-L-methionine synthase	7.89e-04	6.10e-03	NA	NA
5. P	B1XCR9	Protein-L-isoaspartate O-methyltransferase	1.69e-05	2.07e-04	NA	NA
5. P	A3PUJ1	Demethylmenaquinone methyltransferase	1.65e-04	1.10e-02	NA	NA
5. P	B4RC42	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	9.24e-05	6.35e-05	NA	NA
5. P	Q2P2C4	Ubiquinone biosynthesis O-methyltransferase	9.55e-08	1.68e-02	NA	NA
5. P	A4WDU8	Protein-L-isoaspartate O-methyltransferase	1.59e-05	7.44e-05	NA	NA
5. P	P67064	Demethylmenaquinone methyltransferase	1.09e-04	2.64e-03	NA	NA
5. P	Q1CLR2	Protein-L-isoaspartate O-methyltransferase	7.72e-06	3.90e-05	NA	NA
5. P	A4FV98	EEF1A lysine methyltransferase 3	3.59e-06	1.52e-04	NA	NA
5. P	B7N2E1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.20e-05	3.38e-04	NA	NA
5. P	Q7TXK3	Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase	1.42e-06	1.51e-02	NA	NA
5. P	Q96AZ1	EEF1A lysine methyltransferase 3	7.14e-07	7.38e-04	NA	NA
5. P	Q2SN12	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.05e-05	4.03e-03	NA	NA
5. P	A4WW91	Ubiquinone biosynthesis O-methyltransferase	4.07e-07	6.66e-04	NA	NA
5. P	A5U1R8	Putative O-methyltransferase MRA_1229	1.55e-04	8.89e-03	NA	NA
5. P	Q6LLM4	Ribosomal RNA small subunit methyltransferase J	2.11e-05	2.01e-02	NA	NA
5. P	B8E8T7	Protein-L-isoaspartate O-methyltransferase	1.08e-04	2.91e-05	NA	NA
5. P	Q5NEV4	Ribosomal RNA small subunit methyltransferase J	1.14e-03	9.62e-03	NA	NA
5. P	B0TSA1	Carboxy-S-adenosyl-L-methionine synthase	6.79e-04	8.66e-03	NA	NA
5. P	Q31GD8	Ubiquinone biosynthesis O-methyltransferase	7.02e-08	4.93e-04	NA	NA
5. P	Q2NVM1	Protein-L-isoaspartate O-methyltransferase	1.40e-04	4.31e-05	NA	NA
5. P	Q1H4T5	tRNA (guanine-N(7)-)-methyltransferase	1.20e-05	3.84e-02	NA	NA
5. P	A4JCG7	Ubiquinone biosynthesis O-methyltransferase	2.99e-08	1.28e-03	NA	NA
5. P	Q12KQ0	tRNA (guanine-N(7)-)-methyltransferase	1.13e-05	1.79e-02	NA	NA
5. P	A1AI22	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.28e-05	3.38e-04	NA	NA
5. P	B8E0T1	Protein-L-isoaspartate O-methyltransferase	8.42e-06	3.58e-04	NA	NA
5. P	B2RJE9	Demethylmenaquinone methyltransferase	3.12e-05	3.34e-02	NA	NA
5. P	P59911	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.41e-05	2.69e-03	NA	NA
5. P	Q15NL2	Carboxy-S-adenosyl-L-methionine synthase	1.30e-03	2.66e-02	NA	NA
5. P	Q8PHF4	tRNA (guanine-N(7)-)-methyltransferase	1.28e-05	2.62e-02	NA	NA
5. P	Q2P1L5	Protein-L-isoaspartate O-methyltransferase	1.24e-05	1.26e-02	NA	NA
5. P	Q3YYB9	Protein-L-isoaspartate O-methyltransferase	1.95e-04	1.57e-04	NA	NA
5. P	Q4K8M4	Ubiquinone biosynthesis O-methyltransferase	6.17e-08	1.82e-02	NA	NA
5. P	A5VSK3	Ubiquinone biosynthesis O-methyltransferase	2.01e-07	6.65e-06	NA	NA
5. P	Q02PX7	Ubiquinone biosynthesis O-methyltransferase	6.87e-08	3.04e-02	NA	NA
5. P	A0A0A2IBN3	O-methyltransferase cnsE	3.39e-07	4.11e-02	NA	NA
5. P	Q0SZ25	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.41e-05	3.89e-04	NA	NA
5. P	B9KQJ8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.39e-05	2.73e-02	NA	NA
5. P	A8ACY2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.72e-05	6.54e-04	NA	NA
5. P	Q5F3N1	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	1.15e-04	1.95e-02	NA	NA
5. P	Q1BY35	Ubiquinone biosynthesis O-methyltransferase	6.96e-08	6.98e-04	NA	NA
5. P	Q13V14	tRNA (guanine-N(7)-)-methyltransferase	1.25e-05	4.28e-02	NA	NA
5. P	Q57598	tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase TrmI	6.77e-06	3.28e-02	NA	NA
5. P	A1K8Q1	Ubiquinone biosynthesis O-methyltransferase	6.37e-08	1.62e-03	NA	NA
5. P	A8FSK8	tRNA (guanine-N(7)-)-methyltransferase	9.90e-06	4.18e-02	NA	NA
5. P	B8F4B1	Ubiquinone biosynthesis O-methyltransferase	2.19e-07	6.78e-03	NA	NA
5. P	Q96ZL5	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	1.48e-06	3.65e-03	NA	NA
5. P	Q4FNA2	Ubiquinone biosynthesis O-methyltransferase	1.15e-07	1.96e-03	NA	NA
5. P	P60594	Polyamine aminopropyltransferase	4.89e-04	3.72e-03	NA	NA
5. P	B1JYJ6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.57e-05	4.44e-03	NA	NA
5. P	Q2NTJ7	Carboxy-S-adenosyl-L-methionine synthase	8.55e-04	1.96e-03	NA	NA
5. P	P22062	Protein-L-isoaspartate(D-aspartate) O-methyltransferase	1.25e-04	9.13e-03	NA	NA
5. P	Q5WZ61	tRNA (guanine-N(7)-)-methyltransferase	9.89e-06	1.79e-02	NA	NA
5. P	A9KYG4	Protein-L-isoaspartate O-methyltransferase	1.38e-04	4.40e-05	NA	NA
5. P	B7MHC0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.88e-05	3.38e-04	NA	NA
5. P	Q8DD95	Ribosomal RNA small subunit methyltransferase J	2.91e-05	1.12e-02	NA	NA
5. P	A7HC32	Protein-L-isoaspartate O-methyltransferase 1	7.93e-06	1.83e-04	NA	NA
5. P	Q60354	Putative methyltransferase MJ0046	4.90e-06	1.90e-02	NA	NA
5. P	C5D4Y0	Uncharacterized methyltransferase GWCH70_2477	4.77e-04	2.55e-02	NA	NA
5. P	B8EA69	Carboxy-S-adenosyl-L-methionine synthase	6.57e-04	3.37e-03	NA	NA
5. P	P0A889	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.09e-05	3.89e-04	NA	NA
5. P	Q9C5D7	Probable caffeoyl-CoA O-methyltransferase At4g26220	4.78e-04	1.02e-02	NA	NA
5. P	A4WU05	Protein-L-isoaspartate O-methyltransferase	3.60e-05	2.23e-02	NA	NA
5. P	A7NI01	Protein-L-isoaspartate O-methyltransferase	6.73e-05	2.13e-04	NA	NA
5. P	Q83JY3	Protein-L-isoaspartate O-methyltransferase	1.96e-04	1.54e-04	NA	NA
5. P	B2I9C6	tRNA (guanine-N(7)-)-methyltransferase	8.32e-05	1.52e-02	NA	NA
5. P	B4TFW3	Protein-L-isoaspartate O-methyltransferase	1.72e-05	1.51e-04	NA	NA
5. P	A6WNQ8	Carboxy-S-adenosyl-L-methionine synthase	6.80e-04	8.97e-03	NA	NA
5. P	O42898	Probable catechol O-methyltransferase 1	9.55e-06	5.59e-03	NA	NA
5. P	A0KU88	Protein-L-isoaspartate O-methyltransferase	9.87e-05	6.98e-04	NA	NA
5. P	Q1CBG0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.12e-05	3.61e-04	NA	NA
5. P	Q7MZ81	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.02e-05	3.79e-04	NA	NA
5. P	A1KG35	Demethylmenaquinone methyltransferase	3.20e-04	1.59e-02	NA	NA
5. P	A0A077ESS0	Norbelladine 4'-O-methyltransferase 5	6.36e-04	1.41e-03	NA	NA
5. P	Q1C9H5	Ubiquinone biosynthesis O-methyltransferase	5.96e-08	1.24e-02	NA	NA
5. P	B3QQM1	Protein-L-isoaspartate O-methyltransferase	7.51e-06	4.19e-08	NA	NA
5. P	Q8C436	Protein N-lysine methyltransferase METTL21D	1.12e-07	2.84e-04	NA	NA
5. P	Q82VW0	Protein-L-isoaspartate O-methyltransferase	1.61e-04	6.49e-03	NA	NA
5. P	A6WQU4	tRNA (guanine-N(7)-)-methyltransferase	1.07e-05	2.82e-02	NA	NA
5. P	P45683	Protein-L-isoaspartate O-methyltransferase	5.35e-06	4.10e-05	NA	NA
5. P	Q9C9W4	Tapetum-specific methyltransferase 1	2.75e-04	2.01e-02	NA	NA
5. P	A5TZT8	Demethylmenaquinone methyltransferase	2.85e-04	1.59e-02	NA	NA
5. P	A8H9X0	Ribosomal RNA small subunit methyltransferase J	1.26e-06	2.89e-03	NA	NA
5. P	B7J8G6	Ribosomal RNA large subunit methyltransferase E	1.36e-04	3.19e-03	NA	NA
5. P	A3D707	tRNA (guanine-N(7)-)-methyltransferase	1.06e-05	2.82e-02	NA	NA
5. P	P9WIN3	Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase	1.61e-06	1.51e-02	NA	NA
5. P	Q1LSK2	Ribosomal RNA large subunit methyltransferase E	1.78e-05	1.70e-02	NA	NA
5. P	Q9RMN9	Fatty-acid O-methyltransferase	5.76e-07	3.20e-02	NA	NA
5. P	A1SE26	Demethylmenaquinone methyltransferase	9.19e-05	2.79e-03	NA	NA
5. P	C3LPS5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.99e-05	8.26e-04	NA	NA
5. P	A9WBM9	Release factor glutamine methyltransferase	6.87e-07	8.44e-03	NA	NA
5. P	A7HTX8	Ubiquinone biosynthesis O-methyltransferase	8.22e-07	4.81e-05	NA	NA
5. P	Q9SLP8	Caffeoyl-CoA O-methyltransferase	6.15e-04	1.81e-03	NA	NA
5. P	B7NT87	Protein-L-isoaspartate O-methyltransferase	1.97e-04	1.97e-04	NA	NA
5. P	B6JM63	Polyamine aminopropyltransferase	2.34e-02	4.85e-03	NA	NA
5. P	B7NS48	Carboxy-S-adenosyl-L-methionine synthase	1.42e-03	7.03e-03	NA	NA
5. P	Q086A4	Protein-L-isoaspartate O-methyltransferase	1.06e-05	1.89e-03	NA	NA
5. P	Q0BNN3	Ribosomal RNA small subunit methyltransferase J	1.14e-03	9.62e-03	NA	NA
5. P	B1J4E5	Carboxy-S-adenosyl-L-methionine synthase	3.40e-04	3.60e-02	NA	NA
5. P	A8MGS9	Uncharacterized methyltransferase Clos_1076	6.11e-05	3.22e-03	NA	NA
5. P	Q6ARM1	Protein-L-isoaspartate O-methyltransferase	1.09e-05	1.32e-02	NA	NA
5. P	Q3JAW6	Protein-L-isoaspartate O-methyltransferase 2	5.91e-06	8.22e-03	NA	NA
5. P	Q0T1H4	Protein-L-isoaspartate O-methyltransferase	1.71e-05	2.07e-04	NA	NA
5. P	Q9HL75	Polyamine aminopropyltransferase	3.14e-04	5.64e-03	NA	NA
5. P	Q7NZD3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.68e-05	1.30e-03	NA	NA
5. P	A9AWD7	(+)-O-methylkolavelool synthase	9.15e-07	8.03e-04	NA	NA
5. P	Q97BN7	Polyamine aminopropyltransferase	2.24e-04	1.66e-03	NA	NA
5. P	B2K0Y4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.77e-05	5.58e-04	NA	NA
5. P	A0K594	tRNA (guanine-N(7)-)-methyltransferase	9.73e-05	2.34e-02	NA	NA
5. P	Q9XGI7	Nicotianamine synthase	1.09e-06	3.15e-02	NA	NA
5. P	B1LD01	Carboxy-S-adenosyl-L-methionine synthase	1.71e-03	8.59e-03	NA	NA
5. P	Q9JPD1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.29e-04	6.27e-03	NA	NA
5. P	B2TVI4	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.72e-05	3.89e-04	NA	NA
5. P	O04899	Caffeoyl-CoA O-methyltransferase 5	7.06e-04	1.38e-02	NA	NA
5. P	Q0HXG4	Protein-L-isoaspartate O-methyltransferase	1.00e-04	1.28e-03	NA	NA
5. P	Q8DC56	Protein-L-isoaspartate O-methyltransferase	2.41e-04	9.52e-05	NA	NA
5. P	Q8NT39	Demethylmenaquinone methyltransferase	1.03e-04	3.94e-02	NA	NA
5. P	B5YY82	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.93e-05	3.89e-04	NA	NA
5. P	A0QRH1	Demethylmenaquinone methyltransferase	1.64e-04	5.25e-03	NA	NA
5. P	A5GEF7	Protein-L-isoaspartate O-methyltransferase 1	1.46e-05	1.26e-02	NA	NA
5. P	Q83A90	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.04e-05	6.00e-03	NA	NA
5. P	Q12S23	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.45e-05	2.61e-04	NA	NA
5. P	A7MTX1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.24e-05	5.07e-04	NA	NA
5. P	A4FG18	Geranyl diphosphate 2-C-methyltransferase	4.53e-07	5.44e-03	NA	NA
5. P	C4K2K3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.55e-05	8.01e-03	NA	NA
5. P	B5RDP9	Protein-L-isoaspartate O-methyltransferase	1.70e-05	1.51e-04	NA	NA
5. P	A0KIF6	Carboxy-S-adenosyl-L-methionine synthase	6.71e-04	4.14e-02	NA	NA
5. P	A1VD15	Protein-L-isoaspartate O-methyltransferase	4.71e-05	3.42e-05	NA	NA
5. P	P0A7A5	Protein-L-isoaspartate O-methyltransferase	1.67e-05	2.07e-04	NA	NA
5. P	A0RPY4	Carboxy-S-adenosyl-L-methionine synthase	2.84e-04	1.29e-02	NA	NA
5. P	A1BDC1	Protein-L-isoaspartate O-methyltransferase	1.76e-06	5.17e-04	NA	NA
5. P	A1VYV0	Carboxy-S-adenosyl-L-methionine synthase	3.44e-04	2.94e-03	NA	NA
5. P	Q72W15	tRNA (guanine-N(7)-)-methyltransferase	4.31e-06	1.35e-02	NA	NA
5. P	B7UHG2	Protein-L-isoaspartate O-methyltransferase	1.70e-05	2.07e-04	NA	NA
5. P	C6E4U6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.46e-05	4.14e-02	NA	NA
5. P	B2AH07	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.31e-05	1.05e-03	NA	NA
5. P	Q9HQG3	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	1.96e-08	5.35e-03	NA	NA
5. P	Q31UF3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.85e-05	3.89e-04	NA	NA
5. P	Q1GGU4	Polyamine aminopropyltransferase	4.62e-03	3.94e-02	NA	NA
5. P	Q0HEA1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.88e-05	5.17e-04	NA	NA
5. P	B7VK62	Protein-L-isoaspartate O-methyltransferase	2.50e-04	1.94e-04	NA	NA
5. P	B5RFM8	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.92e-05	1.02e-03	NA	NA
5. P	A8ZXR8	Protein-L-isoaspartate O-methyltransferase	6.26e-06	2.11e-03	NA	NA
5. P	B0U6V1	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	5.51e-05	5.21e-03	NA	NA
5. P	A6VDI6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.18e-05	2.97e-03	NA	NA
5. P	A6TGL3	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.92e-05	1.92e-04	NA	NA
5. P	B7M638	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.12e-05	3.89e-04	NA	NA
5. P	A4SGH4	Protein-L-isoaspartate O-methyltransferase	7.91e-06	4.67e-05	NA	NA
5. P	A6H0V1	Protein-L-isoaspartate O-methyltransferase	1.21e-05	5.44e-03	NA	NA
5. P	B7LEG1	Protein-L-isoaspartate O-methyltransferase	1.69e-05	2.07e-04	NA	NA
5. P	A7MU00	Ribosomal RNA small subunit methyltransferase J	2.22e-05	4.01e-02	NA	NA
5. P	Q28VP7	Ubiquinone biosynthesis O-methyltransferase	5.99e-07	5.31e-05	NA	NA
5. P	Q8Y278	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.66e-05	2.35e-04	NA	NA
5. P	A1KMU6	Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase	1.31e-06	1.51e-02	NA	NA
5. P	C3PKL1	Demethylmenaquinone methyltransferase	1.67e-04	3.11e-03	NA	NA
5. P	Q66EB9	Protein-L-isoaspartate O-methyltransferase	2.11e-05	3.90e-05	NA	NA
5. P	A3PIZ8	Protein-L-isoaspartate O-methyltransferase	3.25e-05	2.66e-02	NA	NA
5. P	Q1CT37	Polyamine aminopropyltransferase	2.42e-02	7.47e-03	NA	NA
5. P	A8H1J9	tRNA (guanine-N(7)-)-methyltransferase	1.01e-05	2.21e-02	NA	NA
5. P	Q8CUK1	Uncharacterized methyltransferase OB1106	4.24e-04	1.12e-02	NA	NA
5. P	A9AUP1	Protein-L-isoaspartate O-methyltransferase	1.67e-05	3.63e-05	NA	NA
5. P	P0A7A6	Protein-L-isoaspartate O-methyltransferase	1.70e-05	2.07e-04	NA	NA
5. P	Q86IC8	Probable caffeoyl-CoA O-methyltransferase 2	6.70e-05	3.12e-02	NA	NA
5. P	B9LZA9	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.91e-05	5.03e-03	NA	NA
5. P	Q8YJ98	Ubiquinone biosynthesis O-methyltransferase	1.67e-07	2.28e-05	NA	NA
5. P	A8HVC4	Ubiquinone biosynthesis O-methyltransferase	1.09e-06	5.12e-04	NA	NA
5. P	Q6MCW9	Protein-L-isoaspartate O-methyltransferase	2.45e-05	1.81e-05	NA	NA
5. P	A4VGE5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.68e-05	1.06e-02	NA	NA
5. P	B1MLM0	Putative O-methyltransferase MAB_1361c	2.21e-06	1.06e-04	NA	NA
5. P	Q32CI7	Protein-L-isoaspartate O-methyltransferase	1.68e-05	2.07e-04	NA	NA
5. P	B0R4J5	Chemotaxis protein methyltransferase	1.53e-04	2.36e-02	NA	NA
5. P	Q66FT0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.00e-05	5.58e-04	NA	NA
5. P	O25503	Polyamine aminopropyltransferase	4.77e-03	2.03e-02	NA	NA
5. P	A9L3I3	Carboxy-S-adenosyl-L-methionine synthase	6.76e-04	8.97e-03	NA	NA
5. P	Q1I655	Protein-L-isoaspartate O-methyltransferase	2.46e-05	1.09e-05	NA	NA
5. P	B5Z3A5	Protein-L-isoaspartate O-methyltransferase	1.70e-05	2.07e-04	NA	NA
5. P	A4JHS6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.57e-05	1.68e-03	NA	NA
5. P	C0PXA3	Protein-L-isoaspartate O-methyltransferase	1.70e-05	1.51e-04	NA	NA
5. P	Q57KJ8	Protein-L-isoaspartate O-methyltransferase	1.69e-05	1.51e-04	NA	NA
5. P	B5FNW6	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.17e-05	1.02e-03	NA	NA
5. P	Q8Y0Z5	Ubiquinone biosynthesis O-methyltransferase	9.60e-08	1.44e-03	NA	NA
5. P	A1K4F0	Protein-L-isoaspartate O-methyltransferase	8.13e-05	4.44e-05	NA	NA
5. P	Q11TS0	Protein-L-isoaspartate O-methyltransferase	1.03e-05	2.22e-04	NA	NA
5. P	Q73L97	Ribosomal RNA large subunit methyltransferase E	1.32e-04	2.87e-03	NA	NA
5. P	Q47GP8	Ubiquinone biosynthesis O-methyltransferase	7.64e-08	7.11e-04	NA	NA
5. P	A8GXR2	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	2.94e-05	6.85e-04	NA	NA
5. P	Q0HIZ7	Carboxy-S-adenosyl-L-methionine synthase	6.56e-04	6.27e-03	NA	NA
5. P	Q02R96	Protein-L-isoaspartate O-methyltransferase	5.18e-06	4.10e-05	NA	NA
5. P	Q5PEE9	Protein-L-isoaspartate O-methyltransferase	1.68e-05	1.64e-04	NA	NA
5. P	Q2T139	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.06e-05	4.21e-03	NA	NA
5. P	Q6G0I1	Ubiquinone biosynthesis O-methyltransferase	2.84e-07	3.29e-05	NA	NA
5. P	D3YWP0	EEF1A lysine methyltransferase 3	3.40e-06	2.77e-05	NA	NA
5. P	Q6NCU3	Protein-L-isoaspartate O-methyltransferase	4.75e-04	3.63e-05	NA	NA
5. P	B1IW72	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.23e-05	3.89e-04	NA	NA
5. P	A9AFC0	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.55e-05	2.97e-03	NA	NA
5. P	C3LPR5	Ribosomal RNA small subunit methyltransferase J	3.33e-05	4.46e-02	NA	NA
5. P	A4Y2Q5	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	3.51e-05	5.90e-04	NA	NA
5. P	Q2GDL7	Ribosomal RNA large subunit methyltransferase E	1.99e-04	3.12e-02	NA	NA
5. P	Q6D1B6	Protein-L-isoaspartate O-methyltransferase	7.89e-06	1.90e-04	NA	NA
5. P	O24151	Caffeoyl-CoA O-methyltransferase 4	6.95e-04	1.55e-03	NA	NA
5. P	A1RSC6	Protein-L-isoaspartate O-methyltransferase	2.53e-08	5.59e-03	NA	NA
5. P	Q1BYF4	tRNA (guanine-N(7)-)-methyltransferase	8.84e-05	2.34e-02	NA	NA
5. P	A9M1A6	Ribosomal RNA small subunit methyltransferase J	1.37e-04	1.38e-04	NA	NA
5. P	P9WHV3	Release factor glutamine methyltransferase	2.16e-05	4.21e-03	NA	NA
5. P	B0SW81	Ubiquinone biosynthesis O-methyltransferase	3.16e-07	1.15e-05	NA	NA
5. P	A6Q429	Carboxy-S-adenosyl-L-methionine synthase	6.48e-04	7.05e-04	NA	NA
5. P	Q4ZQ90	Ubiquinone biosynthesis O-methyltransferase	3.89e-08	2.23e-02	NA	NA
5. P	Q5A013	Protein N-terminal and lysine N-methyltransferase EFM7	1.82e-05	9.06e-05	NA	NA
6. F	P57269	Release factor glutamine methyltransferase	3.31e-07	NA	NA	0.6578
6. F	B3QLQ8	Ribosomal protein L11 methyltransferase	1.01e-06	NA	NA	0.7462
6. F	P67055	Demethylmenaquinone methyltransferase	2.50e-06	NA	NA	0.5598
6. F	A0L9S5	Ribosomal RNA large subunit methyltransferase G	4.04e-05	NA	NA	0.673
6. F	A8FSS4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.56e-05	NA	NA	0.6207
6. F	Q63DL9	Demethylmenaquinone methyltransferase	5.65e-06	NA	NA	0.5884
6. F	Q9KSJ9	Ubiquinone biosynthesis O-methyltransferase	1.53e-07	NA	NA	0.5632
6. F	Q29LT4	Glutathione S-transferase C-terminal domain-containing protein homolog	5.31e-04	NA	NA	0.5374
6. F	C3L8S6	Demethylmenaquinone methyltransferase	5.16e-06	NA	NA	0.5888
6. F	A4Y952	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.28e-05	NA	NA	0.6844
6. F	Q8TGX6	tRNA (guanine(26)-N(2))-dimethyltransferase	3.50e-05	NA	NA	0.4734
6. F	P57705	tRNA (guanine(26)-N(2))-dimethyltransferase	4.78e-05	NA	NA	0.4582
6. F	O58523	tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase	5.29e-07	NA	NA	0.6807
6. F	P94298	Demethylmenaquinone methyltransferase	2.92e-06	NA	NA	0.5632
6. F	Q56308	Protein-L-isoaspartate O-methyltransferase	6.48e-07	NA	NA	0.5435
6. F	B1WZ70	Ribosomal RNA small subunit methyltransferase H	3.87e-06	NA	NA	0.5026
6. F	B7LM95	Ubiquinone biosynthesis O-methyltransferase	4.62e-08	NA	NA	0.548
6. F	Q4WQZ0	Methyltransferase tpcH	7.58e-05	NA	NA	0.6074
6. F	Q8CWG0	Demethylmenaquinone methyltransferase	4.77e-06	NA	NA	0.5732
6. F	Q93HB4	Uncharacterized RNA methyltransferase SAV_2389	1.49e-04	NA	NA	0.6571
6. F	Q64VV4	Ribosomal protein L11 methyltransferase	4.15e-06	NA	NA	0.7316
6. F	Q1I4K4	Ribosomal RNA large subunit methyltransferase G	7.47e-07	NA	NA	0.6317
6. F	C3SBW0	Pavine N-methyltransferase	1.34e-06	NA	NA	0.53
6. F	Q9KQ83	50S ribosomal protein L3 glutamine methyltransferase	1.96e-06	NA	NA	0.4714
6. F	P57136	Ribosomal RNA small subunit methyltransferase D	8.57e-10	NA	NA	0.5855
6. F	Q3J7D1	Carboxy-S-adenosyl-L-methionine synthase	6.45e-04	NA	NA	0.5433
6. F	A0R213	Release factor glutamine methyltransferase	2.04e-05	NA	NA	0.6037
6. F	P44150	Uncharacterized protein HI_1273	7.57e-06	NA	NA	0.4766
6. F	Q0HXI0	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.44e-05	NA	NA	0.6736
6. F	A4VI28	Ribosomal RNA large subunit methyltransferase G	1.24e-06	NA	NA	0.6188
6. F	A5UDB0	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	2.31e-04	NA	NA	0.608
6. F	B7GHP8	Demethylmenaquinone methyltransferase	3.80e-06	NA	NA	0.5814
6. F	Q9CNN7	50S ribosomal protein L3 glutamine methyltransferase	2.37e-06	NA	NA	0.4607
6. F	Q9KCC4	Demethylmenaquinone methyltransferase	3.74e-06	NA	NA	0.5681
6. F	C3SBU5	(S)-tetrahydroprotoberberine N-methyltransferase 1	2.40e-06	NA	NA	0.5591
6. F	P0A293	50S ribosomal protein L3 glutamine methyltransferase	2.37e-06	NA	NA	0.5494
6. F	B7K639	Ribosomal RNA small subunit methyltransferase H	1.76e-05	NA	NA	0.4829
6. F	B2GBW2	Ribosomal protein L11 methyltransferase	3.54e-06	NA	NA	0.7555
6. F	P45832	Release factor glutamine methyltransferase	6.49e-07	NA	NA	0.6104
6. F	A8FEK9	Demethylmenaquinone methyltransferase	3.07e-06	NA	NA	0.5901
6. F	Q32GZ5	Release factor glutamine methyltransferase	2.33e-07	NA	NA	0.5847
6. F	Q5HTI5	tRNA (guanine-N(7)-)-methyltransferase	4.62e-04	NA	NA	0.621
6. F	Q02G60	Ribosomal RNA large subunit methyltransferase G	6.77e-07	NA	NA	0.6352
6. F	Q831F7	Release factor glutamine methyltransferase	1.61e-06	NA	NA	0.6145
6. F	A4SGV9	Malonyl-[acyl-carrier protein] O-methyltransferase	1.25e-04	NA	NA	0.5251
6. F	Q7CIA2	Release factor glutamine methyltransferase	4.41e-07	NA	NA	0.5251
6. F	A8ADY5	Ubiquinone biosynthesis O-methyltransferase	5.01e-08	NA	NA	0.577
6. F	Q5C9L6	(S)-coclaurine N-methyltransferase	2.21e-06	NA	NA	0.5627
6. F	Q4R3U8	tRNA wybutosine-synthesizing protein 2 homolog	1.19e-03	NA	NA	0.485
6. F	Q814U1	Release factor glutamine methyltransferase	2.80e-05	NA	NA	0.4743
6. F	A0KTP8	Ribosomal RNA large subunit methyltransferase G	3.81e-07	NA	NA	0.6427
6. F	B8DBZ5	Demethylmenaquinone methyltransferase	2.51e-06	NA	NA	0.5598
6. F	Q6MU88	Release factor glutamine methyltransferase	1.63e-06	NA	NA	0.5557
6. F	Q8AAZ8	Ribosomal protein L11 methyltransferase	4.22e-06	NA	NA	0.734
6. F	O54099	Uncharacterized RNA methyltransferase SCO5901	1.70e-04	NA	NA	0.6685
6. F	Q4K5Q4	Ribosomal RNA large subunit methyltransferase G	7.64e-07	NA	NA	0.6783
6. F	Q4ZNG3	Ribosomal RNA large subunit methyltransferase G	7.47e-07	NA	NA	0.6348
6. F	Q9ZCB3	Bifunctional methyltransferase	5.02e-04	NA	NA	0.524
6. F	C6CWS7	Malonyl-[acyl-carrier protein] O-methyltransferase	1.55e-04	NA	NA	0.5992
6. F	P54471	tRNA (adenine(22)-N(1))-methyltransferase	8.06e-06	NA	NA	0.7006
6. F	B4EZ30	Ubiquinone biosynthesis O-methyltransferase	6.68e-08	NA	NA	0.5613
6. F	Q97W08	tRNA 4-demethylwyosine(37)-methyltransferase Taw21	3.66e-06	NA	NA	0.5956
6. F	Q8D035	L-histidine 2-aminobutanoyltransferase	1.04e-06	NA	NA	0.5243
6. F	Q9KQ26	Release factor glutamine methyltransferase	7.79e-07	NA	NA	0.6263
6. F	O66617	Uncharacterized RNA methyltransferase aq_257	1.13e-04	NA	NA	0.6615
6. F	Q5LEW2	Ribosomal protein L11 methyltransferase	4.10e-06	NA	NA	0.7314
6. F	O05972	Uncharacterized protein RP028	2.27e-03	NA	NA	0.6329
6. F	Q4QLU9	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	2.45e-04	NA	NA	0.6165
6. F	Q71Y84	Demethylmenaquinone methyltransferase	2.50e-06	NA	NA	0.5601
6. F	P0ACC2	Release factor glutamine methyltransferase	4.39e-07	NA	NA	0.5768
6. F	P0CS09	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	4.25e-03	NA	NA	0.681
6. F	A0A0H2ZHV3	L-histidine 2-aminobutanoyltransferase	1.06e-06	NA	NA	0.5891
6. F	Q7XB08	(S)-coclaurine N-methyltransferase	1.22e-06	NA	NA	0.5657
6. F	Q8R619	Release factor glutamine methyltransferase	3.48e-06	NA	NA	0.5615
6. F	Q971V9	tRNA (guanine(26)-N(2))-dimethyltransferase	8.24e-05	NA	NA	0.4315
6. F	Q9KPR9	Ribosomal RNA large subunit methyltransferase G	5.35e-05	NA	NA	0.6127
6. F	Q5JIB3	tRNA (guanine(26)-N(2))-dimethyltransferase	7.34e-05	NA	NA	0.4649
6. F	Q8EBQ3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.47e-05	NA	NA	0.5929
6. F	P49016	Demethylmenaquinone methyltransferase	4.82e-06	NA	NA	0.5419
6. F	P21921	Precorrin-6Y C(5,15)-methyltransferase [decarboxylating]	5.38e-04	NA	NA	0.6306
6. F	A0AK43	Demethylmenaquinone methyltransferase	2.50e-06	NA	NA	0.5677
6. F	Q466T6	tRNA (guanine(26)-N(2))-dimethyltransferase	2.81e-05	NA	NA	0.4305
6. F	Q8TT94	Protein-L-isoaspartate O-methyltransferase 2	1.78e-06	NA	NA	0.4557
6. F	C5D6C2	tRNA (guanine-N(7)-)-methyltransferase	5.65e-06	NA	NA	0.4757
6. F	B9IVN5	Demethylmenaquinone methyltransferase	3.60e-06	NA	NA	0.5883
6. F	Q8TI93	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	3.58e-06	NA	NA	0.6123
6. F	A1S4D3	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	2.92e-05	NA	NA	0.6384
6. F	Q8PU28	tRNA (guanine(26)-N(2))-dimethyltransferase	3.85e-05	NA	NA	0.4123
6. F	A3MV65	Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase	6.42e-06	NA	NA	0.6778
6. F	P81554	tRNA (guanine(26)-N(2))-dimethyltransferase	1.00e-04	NA	NA	0.5199
6. F	A0A1X9WEP1	Nocamycin O-methyltransferase	1.38e-04	NA	NA	0.6976
6. F	A6L2N4	Ribosomal protein L11 methyltransferase	5.66e-06	NA	NA	0.7377
6. F	Q8EAR4	Release factor glutamine methyltransferase	7.25e-07	NA	NA	0.6522
6. F	Q5E6T2	Release factor glutamine methyltransferase	5.64e-07	NA	NA	0.6604
6. F	Q48DT7	Ribosomal RNA large subunit methyltransferase G	7.41e-07	NA	NA	0.6404
6. F	Q89AT0	Release factor glutamine methyltransferase	6.45e-07	NA	NA	0.6302
6. F	Q0EDR2	Ribosomal RNA large subunit methyltransferase G	7.57e-07	NA	NA	0.6326
6. F	Q7VXJ6	50S ribosomal protein L3 glutamine methyltransferase	3.33e-06	NA	NA	0.5166
6. F	P55905	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial	1.62e-04	NA	NA	0.508
6. F	A5F5X3	Ribosomal RNA large subunit methyltransferase G	5.47e-05	NA	NA	0.6165
6. F	Q7VNM5	Putative 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	7.38e-09	NA	NA	0.468
6. F	Q3YZX6	Ubiquinone biosynthesis O-methyltransferase	3.61e-08	NA	NA	0.5482
6. F	Q7U6V8	Uncharacterized RNA methyltransferase SYNW1228	1.04e-03	NA	NA	0.6896
6. F	A1RHE4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.01e-05	NA	NA	0.6965
6. F	B3GXZ9	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.68e-04	NA	NA	0.6217
6. F	A0A1C9U5X5	Reticuline N-methyltransferase	2.38e-06	NA	NA	0.5882
6. F	A3MTQ5	tRNA (guanine(26)-N(2))-dimethyltransferase	3.00e-05	NA	NA	0.5141
6. F	Q0T2P9	Ubiquinone biosynthesis O-methyltransferase	4.35e-08	NA	NA	0.5509
6. F	Q73AY2	Demethylmenaquinone methyltransferase	5.48e-06	NA	NA	0.5788
6. F	Q2SE61	Ubiquinone biosynthesis O-methyltransferase	1.05e-07	NA	NA	0.55
6. F	B7MXR3	Ubiquinone biosynthesis O-methyltransferase	4.57e-08	NA	NA	0.5721
6. F	C3SBU4	Probable (S)-tetrahydroprotoberberine N-methyltransferase 2	2.23e-06	NA	NA	0.5346
6. F	B8E8S1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.56e-05	NA	NA	0.6762
6. F	A8GGX8	Ubiquinone biosynthesis O-methyltransferase	9.47e-08	NA	NA	0.5809
6. F	O86169	Demethylmenaquinone methyltransferase	2.69e-06	NA	NA	0.5442
6. F	Q9PEV0	Ribosomal RNA small subunit methyltransferase B	3.30e-05	NA	NA	0.61
6. F	A6WR37	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.82e-05	NA	NA	0.6635
6. F	Q820C5	Ubiquinone biosynthesis O-methyltransferase	4.48e-08	NA	NA	0.5507
6. F	Q8PY64	Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating)	2.49e-06	NA	NA	0.5654
6. F	A0KU76	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.30e-05	NA	NA	0.6628
6. F	Q9HVH4	Ribosomal RNA large subunit methyltransferase G	7.98e-07	NA	NA	0.6408
6. F	Q2RFW1	Release factor glutamine methyltransferase	1.97e-07	NA	NA	0.6588
6. F	Q89DG5	50S ribosomal protein L3 glutamine methyltransferase	2.86e-06	NA	NA	0.5958
6. F	A5W920	Ribosomal RNA large subunit methyltransferase G	7.99e-07	NA	NA	0.6499
6. F	Q9HUX4	L-histidine 2-aminobutanoyltransferase	1.21e-06	NA	NA	0.5538
6. F	A0A0D3MJQ5	Arsenite methyltransferase	2.61e-06	NA	NA	0.525
6. F	Q3B172	Malonyl-[acyl-carrier protein] O-methyltransferase	1.47e-04	NA	NA	0.4964
6. F	B0JKS7	Ribosomal RNA small subunit methyltransferase H	2.09e-05	NA	NA	0.4976
6. F	B7K9F0	Ribosomal RNA small subunit methyltransferase H	1.27e-02	NA	NA	0.5187
6. F	Q7VKC4	Ribosomal RNA small subunit methyltransferase B	2.93e-04	NA	NA	0.5799
6. F	P0CS08	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	4.40e-03	NA	NA	0.6811
6. F	A5UI99	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	2.30e-04	NA	NA	0.6072
6. F	Q49404	Uncharacterized protein MG259	7.86e-04	NA	NA	0.431
6. F	O52025	Arsenite methyltransferase	5.67e-06	NA	NA	0.5864
6. F	B1KPU0	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.30e-05	NA	NA	0.6553
6. F	O66506	Release factor glutamine methyltransferase	1.88e-05	NA	NA	0.6159
6. F	P0A294	50S ribosomal protein L3 glutamine methyltransferase	2.39e-06	NA	NA	0.528
6. F	Q0AK73	tRNA (guanine-N(7)-)-methyltransferase	6.93e-06	NA	NA	0.5135
6. F	Q6DDT5	Glutathione S-transferase C-terminal domain-containing protein	2.24e-02	NA	NA	0.5003
6. F	P60093	Ribosomal protein L11 methyltransferase	4.34e-06	NA	NA	0.7229
6. F	Q0HL77	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	3.60e-05	NA	NA	0.6737
6. F	Q9HVC8	Release factor glutamine methyltransferase	3.08e-07	NA	NA	0.6255
6. F	Q9V106	tRNA (cytosine(49)-C(5))-methyltransferase	2.18e-06	NA	NA	0.5707
6. F	Q87WA9	Ribosomal RNA large subunit methyltransferase G	7.20e-07	NA	NA	0.6467
6. F	B1J2W7	Ribosomal RNA large subunit methyltransferase G	4.92e-05	NA	NA	0.6761
6. F	A9KYI1	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.59e-05	NA	NA	0.6988
6. F	A4YHH9	tRNA (guanine(26)-N(2))-dimethyltransferase	1.30e-04	NA	NA	0.5215
6. F	Q9HZU0	Precorrin-6Y C(5,15)-methyltransferase [decarboxylating]	3.06e-04	NA	NA	0.6022
6. F	Q7MYI0	Ribosomal RNA small subunit methyltransferase B	5.11e-05	NA	NA	0.5792
6. F	Q72IH5	tRNA (guanine(6)-N2)-methyltransferase	1.60e-06	NA	NA	0.6988
6. F	C5A6N2	tRNA (guanine(26)-N(2))-dimethyltransferase	9.33e-05	NA	NA	0.5108
6. F	A7H2A2	tRNA (guanine-N(7)-)-methyltransferase	4.71e-04	NA	NA	0.6073
6. F	Q8EKR0	Ribosomal RNA small subunit methyltransferase B	5.72e-05	NA	NA	0.5831
6. F	Q81FQ6	Demethylmenaquinone methyltransferase	3.76e-06	NA	NA	0.5716
6. F	Q88E20	Ribosomal RNA large subunit methyltransferase G	7.54e-07	NA	NA	0.6508
6. F	A4XQA3	Ribosomal RNA large subunit methyltransferase G	1.05e-06	NA	NA	0.6092
6. F	A1W0R3	tRNA (guanine-N(7)-)-methyltransferase	9.32e-05	NA	NA	0.4985
6. F	A5PKL6	Glutathione S-transferase C-terminal domain-containing protein	7.87e-04	NA	NA	0.4965
6. F	Q9V1P3	tRNA (guanine(26)-N(2))-dimethyltransferase	9.87e-05	NA	NA	0.517
6. F	Q5E3U5	50S ribosomal protein L3 glutamine methyltransferase	1.50e-06	NA	NA	0.5188
6. F	C5D3E5	Demethylmenaquinone methyltransferase	2.41e-06	NA	NA	0.549
6. F	P40816	Release factor glutamine methyltransferase	3.63e-07	NA	NA	0.6638
6. F	Q87SB8	tRNA1(Val) (adenine(37)-N6)-methyltransferase	1.88e-06	NA	NA	0.5995
6. F	Q92SI3	tRNA (guanine-N(7)-)-methyltransferase	1.73e-05	NA	NA	0.4988
6. F	Q2T4P1	Polyketide synthase ThaQ	2.62e-01	NA	NA	0.4592
6. F	Q9I347	50S ribosomal protein L3 glutamine methyltransferase	2.20e-06	NA	NA	0.4863
6. F	A6VC08	Ribosomal RNA large subunit methyltransferase G	8.50e-07	NA	NA	0.6268
6. F	O87694	Cobalamin biosynthesis bifunctional protein CbiET	1.74e-04	NA	NA	0.6239
6. F	A0A1C9U5X7	N-methyltransferase 4	1.62e-06	NA	NA	0.5795
6. F	Q8ZWT5	tRNA (guanine(26)-N(2))-dimethyltransferase	1.03e-04	NA	NA	0.6119
6. F	P35549	rRNA 2'-O-methyltransferase fibrillarin	6.30e-05	NA	NA	0.6776
6. F	A7GN50	Demethylmenaquinone methyltransferase	2.37e-06	NA	NA	0.5567
6. F	Q6FE96	Ribosomal RNA small subunit methyltransferase C	4.65e-05	NA	NA	0.6206
6. F	Q9F8T9	C-methyltransferase CouO	6.08e-08	NA	NA	0.589
6. F	P45873	Release factor glutamine methyltransferase	1.36e-05	NA	NA	0.4955
6. F	Q5FIS5	tRNA (guanine-N(7)-)-methyltransferase	1.91e-06	NA	NA	0.5467
6. F	A7MXM2	tRNA1(Val) (adenine(37)-N6)-methyltransferase	1.70e-06	NA	NA	0.5903
6. F	Q8GBB2	tRNA (adenine(58)-N(1))-methyltransferase TrmI	7.25e-07	NA	NA	0.6935
6. F	Q7VL11	Malonyl-[acyl-carrier protein] O-methyltransferase	3.23e-04	NA	NA	0.4835
6. F	P9WLL8	Uncharacterized protein MT2127	1.58e-03	NA	NA	0.568
6. F	Q4J947	tRNA (guanine(26)-N(2))-dimethyltransferase	1.12e-04	NA	NA	0.5001
6. F	P39200	50S ribosomal protein L3 glutamine methyltransferase	1.72e-06	NA	NA	0.5362
6. F	Q74CC6	Uncharacterized RNA methyltransferase GSU1748	1.15e-04	NA	NA	0.6522
6. F	Q65VK8	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	5.88e-05	NA	NA	0.6279
6. F	B7VJ58	tRNA1(Val) (adenine(37)-N6)-methyltransferase	8.81e-10	NA	NA	0.5965
6. F	A9VMC2	Demethylmenaquinone methyltransferase	4.05e-06	NA	NA	0.571
6. F	B1YCV9	tRNA (guanine(26)-N(2))-dimethyltransferase	6.29e-05	NA	NA	0.5039
6. F	A3D7B5	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	4.50e-05	NA	NA	0.6734
6. F	Q12PZ8	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	1.73e-04	NA	NA	0.6352
6. F	B7HL23	Demethylmenaquinone methyltransferase	3.62e-06	NA	NA	0.5888
6. F	Q8KG70	Ribosomal protein L11 methyltransferase	3.37e-05	NA	NA	0.7474
6. F	Q1RH40	Bifunctional methyltransferase	3.59e-04	NA	NA	0.5173
6. F	Q8TT93	Protein-L-isoaspartate O-methyltransferase 1	5.12e-06	NA	NA	0.403
6. F	A8FMY4	tRNA (guanine-N(7)-)-methyltransferase	1.91e-04	NA	NA	0.5064
6. F	Q5KXU0	Demethylmenaquinone methyltransferase	3.08e-06	NA	NA	0.5497
6. F	Q8A1D7	Release factor glutamine methyltransferase	7.31e-06	NA	NA	0.5278
6. F	Q3K6H7	Ribosomal RNA large subunit methyltransferase G	7.12e-07	NA	NA	0.6539
6. F	B1YKF9	tRNA (guanine-N(7)-)-methyltransferase	3.22e-06	NA	NA	0.5851
6. F	B7HHR7	Demethylmenaquinone methyltransferase	2.43e-06	NA	NA	0.5721
6. F	B7IP91	Demethylmenaquinone methyltransferase	2.88e-06	NA	NA	0.5701
6. F	Q2GCL0	tRNA (guanine-N(7)-)-methyltransferase	6.52e-06	NA	NA	0.5459
6. F	A4WMB7	tRNA (guanine(26)-N(2))-dimethyltransferase	9.06e-05	NA	NA	0.5254
6. F	Q5SKN4	tRNA (adenine(58)-N(1))-methyltransferase TrmI	6.78e-07	NA	NA	0.6945
6. F	P45106	50S ribosomal protein L3 glutamine methyltransferase	2.51e-06	NA	NA	0.4665
6. F	B1MK43	Uncharacterized methyltransferase MAB_4481	8.85e-04	NA	NA	0.4703
6. F	Q9A9T7	Release factor glutamine methyltransferase	6.61e-07	NA	NA	0.6269
6. F	Q108P1	(S)-tetrahydroprotoberberine N-methyltransferase	2.31e-06	NA	NA	0.5697
6. F	B8F5M9	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	2.81e-04	NA	NA	0.4848
6. F	Q4R6Y8	Glutathione S-transferase C-terminal domain-containing protein	1.46e-03	NA	NA	0.5395
6. F	A4IRW9	tRNA (guanine-N(7)-)-methyltransferase	3.94e-06	NA	NA	0.5216
6. F	Q5KW28	tRNA (guanine-N(7)-)-methyltransferase	6.00e-06	NA	NA	0.5245
6. F	Q30SG7	tRNA (guanine-N(7)-)-methyltransferase	7.96e-05	NA	NA	0.6062
6. F	Q55214	Aklanonic acid methyltransferase DauC	3.84e-07	NA	NA	0.5889
6. F	Q9L9F3	8-demethylnovobiocic acid C(8)-methyltransferase	4.80e-08	NA	NA	0.5701
6. F	Q2S4C3	Ribosomal protein L11 methyltransferase	1.89e-06	NA	NA	0.726
6. F	P67056	Demethylmenaquinone methyltransferase	4.16e-06	NA	NA	0.5601
6. F	C3P5A0	Demethylmenaquinone methyltransferase	5.45e-06	NA	NA	0.588
6. F	B4S687	Malonyl-[acyl-carrier protein] O-methyltransferase	1.56e-04	NA	NA	0.5409
6. F	P44083	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	2.54e-04	NA	NA	0.6399
6. F	Q9K3L9	Ribosomal RNA large subunit methyltransferase G	5.49e-05	NA	NA	0.6117
6. F	P0DG18	tRNA (guanine-N(7)-)-methyltransferase	3.28e-06	NA	NA	0.4875
6. F	Q82TM7	Uncharacterized RNA methyltransferase NE1857	6.99e-04	NA	NA	0.6087
6. F	A3N1B8	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	3.77e-04	NA	NA	0.6215
6. F	Q54818	Aklanonic acid methyltransferase DnrC	1.04e-04	NA	NA	0.6119
6. F	P0A5G2	Uncharacterized protein Mb2093c	1.66e-03	NA	NA	0.5791
6. F	B8IJ00	Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	6.55e-05	NA	NA	0.5489
6. F	Q8PW90	Protein-L-isoaspartate O-methyltransferase	3.28e-06	NA	NA	0.4876
6. F	B0KHQ8	Ribosomal RNA large subunit methyltransferase G	7.91e-07	NA	NA	0.6312
6. F	O27258	tRNA (guanine(26)-N(2))-dimethyltransferase	4.81e-05	NA	NA	0.4615
6. F	C1EN10	Demethylmenaquinone methyltransferase	5.64e-06	NA	NA	0.5867
6. F	Q6HL42	Demethylmenaquinone methyltransferase	4.58e-06	NA	NA	0.5865
6. F	C1KWN1	Demethylmenaquinone methyltransferase	3.71e-06	NA	NA	0.5676
6. F	P67500	tRNA (guanine-N(7)-)-methyltransferase	3.20e-06	NA	NA	0.6234
6. F	Q5WGT4	Demethylmenaquinone methyltransferase	4.05e-06	NA	NA	0.554
6. F	A1RV26	tRNA (guanine(26)-N(2))-dimethyltransferase	6.02e-05	NA	NA	0.4426
6. F	B7JGZ8	Demethylmenaquinone methyltransferase	5.76e-06	NA	NA	0.5882
6. F	Q12Y46	tRNA (guanine(26)-N(2))-dimethyltransferase	3.42e-05	NA	NA	0.4313
6. F	B7UFP4	Ubiquinone biosynthesis O-methyltransferase	6.48e-08	NA	NA	0.5509
6. F	Q81SW0	Demethylmenaquinone methyltransferase	3.52e-06	NA	NA	0.5793
6. F	Q92G13	Bifunctional methyltransferase	6.74e-04	NA	NA	0.5169
6. F	Q32DK7	50S ribosomal protein L3 glutamine methyltransferase	2.47e-06	NA	NA	0.5456
6. F	O05979	Uncharacterized protein RP789	9.61e-04	NA	NA	0.4429
6. F	Q086B4	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	6.90e-05	NA	NA	0.6408
6. F	Q81JX2	Release factor glutamine methyltransferase	2.98e-05	NA	NA	0.4717
6. F	A5EVQ4	Carboxy-S-adenosyl-L-methionine synthase	3.93e-05	NA	NA	0.5198
6. F	A0A0H3JXA8	D-histidine 2-aminobutanoyltransferase	1.03e-06	NA	NA	0.5535
7. B	B0SH16	Ribosome maturation factor RimP	1.94e-01	NA	0.009	NA
7. B	B0SQH2	Ribosome maturation factor RimP	1.77e-01	NA	0.009	NA