Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX55010.1
JCVISYN3A_0875

CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase.
M. mycoides homolog: Q6MS68.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 44
Unique PROST Go: 11
Unique BLAST Go: 21
Unique Foldseek Go: 0

Total Homologs: 93
Unique PROST Homologs: 21
Unique BLAST Homologs: 13
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: pgsA; CDP diacylglycerol glycerol 3 phosphate3 phosphatidyltransferase
Zhang et al. [4]: GO:0017169|CDP-alcohol phosphatidyltransferase activity
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q1C8L0 (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase) with a FATCAT P-Value: 0 and RMSD of 1.92 angstrom. The sequence alignment identity is 31.4%.
Structural alignment shown in left. Query protein AVX55010.1 colored as red in alignment, homolog Q1C8L0 colored as blue. Query protein AVX55010.1 is also shown in right top, homolog Q1C8L0 showed in right bottom. They are colored based on secondary structures. 

  AVX55010.1 MKQKTINLPNILTTIRILLVPIIIVLLLVDHYMNGLVFTNFSKFAW--FISGAIFIIASLTDFLDGWIARKYNLVTNFGKFFDPIADKLLVNATLIL--- 95
      Q1C8L0 MQ---LNIPTWLTLFRVVLIPFFV-----------LAF--YLPFVWAPMVCAIIFVFAAATDWFDGFLARRWKQTTRFGAFLDPVADKVMVAVALVLVAE 84

  AVX55010.1 -FSSLGVLPIWMTV---VLILRDTFIDFIR--MILSSKGITLAAGMGGKLKTTFQMIGLSLLFFINLKIFG--WSEWDWQNQL---VLIPMYIA---TFF 181
      Q1C8L0 HYHSW-----WITLPAATMIAREIIISSLREWMAEIGKRSSVAVSWVGKVKTMAQM-G-SLV--------GLLWRP-DHNVELASFVLL--YIAAVLTFW 166

  AVX55010.1 SIYSGVIYFLK-ARSNLF-- 198
      Q1C8L0 SMFQ---Y-LNAAWSDLLEP 182

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0043337 CDP-diacylglycerol-phosphatidylglycerol phosphatidyltransferase activity
1. PBF GO:0016021 integral component of membrane
1. PBF GO:0005886 plasma membrane
1. PBF GO:0046474 glycerophospholipid biosynthetic process
1. PBF GO:0008654 phospholipid biosynthetic process
1. PBF GO:0008444 CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase activity
1. PBF GO:0006655 phosphatidylglycerol biosynthetic process
2. PF GO:0016780 phosphotransferase activity, for other substituted phosphate groups
4. PB GO:0003881 CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity
4. PB GO:0005794 Golgi apparatus
4. PB GO:0030145 manganese ion binding
4. PB GO:0006661 phosphatidylinositol biosynthetic process
5. P GO:0005618 cell wall
5. P GO:0005741 mitochondrial outer membrane
5. P GO:0005887 integral component of plasma membrane
5. P GO:0019992 diacylglycerol binding
5. P GO:0046341 CDP-diacylglycerol metabolic process
5. P GO:0003882 CDP-diacylglycerol-serine O-phosphatidyltransferase activity
5. P GO:0043178 alcohol binding
5. P GO:0050520 phosphatidylcholine synthase activity
5. P GO:0000287 magnesium ion binding
5. P GO:0030246 carbohydrate binding
5. P GO:0005789 endoplasmic reticulum membrane
7. B GO:0007006 mitochondrial membrane organization
7. B GO:0008808 cardiolipin synthase activity
7. B GO:0004142 diacylglycerol cholinephosphotransferase activity
7. B GO:0031969 chloroplast membrane
7. B GO:0003841 1-acylglycerol-3-phosphate O-acyltransferase activity
7. B GO:0032049 cardiolipin biosynthetic process
7. B GO:0036148 phosphatidylglycerol acyl-chain remodeling
7. B GO:0005739 mitochondrion
7. B GO:0031966 mitochondrial membrane
7. B GO:1905711 response to phosphatidylethanolamine
7. B GO:0006873 cellular ion homeostasis
7. B GO:0006754 ATP biosynthetic process
7. B GO:0097068 response to thyroxine
7. B GO:0051881 regulation of mitochondrial membrane potential
7. B GO:0005743 mitochondrial inner membrane
7. B GO:0055091 phospholipid homeostasis
7. B GO:0071711 basement membrane organization
7. B GO:0008610 lipid biosynthetic process
7. B GO:0009941 chloroplast envelope
7. B GO:0047144 2-acylglycerol-3-phosphate O-acyltransferase activity
7. B GO:0010027 thylakoid membrane organization

Uniprot GO Annotations

GO Description
GO:0016740 transferase activity
GO:0006629 lipid metabolic process
GO:0006119 oxidative phosphorylation
GO:0016780 phosphotransferase activity, for other substituted phosphate groups
GO:0016021 integral component of membrane
GO:0016020 membrane
GO:0008654 phospholipid biosynthetic process
GO:0008444 CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF Q9ZE96 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 5.75e-40 1.01e-26 0.8749
1. PBF Q5PI18 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.62e-35 1.23e-19 0.8731
1. PBF Q7N5C8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.16e-34 1.27e-15 0.8719
1. PBF P63757 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 4.58e-51 9.68e-34 0.8403
1. PBF P44528 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.71e-27 1.55e-14 0.8458
1. PBF P63755 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 4.58e-51 9.68e-34 0.8406
1. PBF Q3IYX7 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 9.03e-14 2.52e-17 0.7557
1. PBF Q6D364 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.03e-30 1.74e-12 0.8706
1. PBF P75520 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1.11e-16 6.19e-31 4.16e-28 0.8137
1. PBF O66076 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 3.85e-14 3.57e-15 8.55e-12 0.8049
1. PBF P9WPG4 Putative cardiolipin synthase 0.00e+00 5.94e-12 1.84e-11 0.772
1. PBF Q0TGS6 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.25e-35 1.77e-18 0.8741
1. PBF Q92JJ2 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.96e-39 3.09e-26 0.8866
1. PBF Q492P7 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 5.25e-35 4.89e-15 0.824
1. PBF O67908 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.36e-19 5.78e-04 0.867
1. PBF Q322L9 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.13e-35 9.83e-19 0.8757
1. PBF Q7VR12 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 9.51e-34 1.63e-12 0.8314
1. PBF Q6G9T0 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 4.58e-51 9.68e-34 0.8402
1. PBF Q8CPF7 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.41e-50 4.28e-31 0.8293
1. PBF Q0T3L5 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.13e-35 9.83e-19 0.8725
1. PBF Q66BN4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.11e-35 5.68e-10 0.869
1. PBF P45419 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.91e-16 1.24e-13 0.8129
1. PBF P63754 Putative cardiolipin synthase 0.00e+00 5.94e-12 1.84e-11 0.7825
1. PBF Q1C8L0 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.11e-35 5.68e-10 0.8701
1. PBF Q1CHE5 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.11e-35 5.68e-10 0.8691
1. PBF Q57N57 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.40e-34 6.63e-20 0.8731
1. PBF Q8ZF51 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.11e-35 5.68e-10 0.8681
1. PBF Q6GHF2 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 4.58e-51 9.68e-34 0.8399
1. PBF A1AC64 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.25e-35 1.77e-18 0.8759
1. PBF Q83R47 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.13e-35 9.83e-19 0.8754
1. PBF Q7CQB9 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.62e-35 1.23e-19 0.873
1. PBF P0ABF9 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.25e-35 1.77e-18 0.8744
1. PBF P63756 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 4.58e-51 9.68e-34 0.841
1. PBF Q2NTS8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.33e-34 1.17e-17 0.8743
1. PBF Q8XFD0 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.62e-35 1.23e-19 0.8736
1. PBF Q3Z2T6 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.25e-35 1.77e-18 0.8751
1. PBF P9WPG2 Probable phosphatidylglycerophosphate synthase 2.22e-13 1.07e-20 8.34e-25 0.8279
1. PBF Q5HPQ8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.41e-50 4.28e-31 0.8294
1. PBF P46322 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 2.77e-54 7.74e-37 0.819
1. PBF A4TK40 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.11e-35 5.68e-10 0.8683
1. PBF Q68XS5 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.46e-34 1.00e-26 0.8896
1. PBF Q4UN77 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 4.71e-39 1.66e-25 0.8647
1. PBF P47360 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1.11e-16 4.06e-23 1.67e-23 0.8207
1. PBF Q1RAM8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.25e-35 1.77e-18 0.8736
1. PBF Q5HGE8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 4.58e-51 9.68e-34 0.8421
1. PBF Q32HD9 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.25e-35 1.77e-18 0.8743
1. PBF A1JLU9 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 1.35e-35 2.09e-13 0.8686
1. PBF Q1RKM3 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 7.21e-39 2.79e-24 0.8991
1. PBF Q8D2N9 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 2.48e-32 2.37e-12 0.8521
1. PBF P0ABG0 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.25e-35 1.77e-18 0.8757
2. PF Q7LXU6 Archaetidylinositol phosphate synthase 6.22e-15 1.60e-10 NA 0.6694
4. PB Q10153 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 4.79e-13 2.61e-05 0.003 NA
4. PB P9WPG5 Putative cardiolipin synthase 0.00e+00 5.94e-12 1.84e-11 NA
4. PB Q8GUK6 Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2 2.76e-13 3.36e-04 5.25e-04 NA
4. PB P0ABF8 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 0.00e+00 6.25e-35 1.77e-18 NA
4. PB P9WPG3 Probable phosphatidylglycerophosphate synthase 1.85e-13 1.07e-20 8.34e-25 NA
4. PB O58215 Archaetidylinositol phosphate synthase 8.13e-14 1.56e-13 0.022 NA
4. PB Q8LBA6 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 1.89e-13 1.50e-07 0.001 NA
4. PB Q9M2W3 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 2 0.00e+00 1.24e-10 5.04e-22 NA
5. P O67456 Uncharacterized protein aq_1480 2.27e-13 4.42e-08 NA NA
5. P O27726 Archaetidylinositol phosphate synthase 1.75e-14 1.63e-09 NA NA
5. P Q8VDP6 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 4.21e-14 4.53e-05 NA NA
5. P A0A0H3MFZ3 Phosphatidylinositol phosphate synthase 3.02e-13 1.14e-09 NA NA
5. P P06197 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 3.08e-13 6.70e-06 NA NA
5. P Q98MN3 Phosphatidylcholine synthase 2.79e-05 3.62e-02 NA NA
5. P P76090 Inner membrane protein YnbA 9.05e-10 5.24e-09 NA NA
5. P Q9F7Y9 Phosphatidylinositol phosphate synthase 5.78e-13 8.77e-09 NA NA
5. P Q9YBS3 Archaetidylinositol phosphate synthase 2.00e-15 9.58e-10 NA NA
5. P Q6A8U1 Phosphatidylinositol phosphate synthase 6.26e-14 1.69e-11 NA NA
5. P B2HM76 Phosphatidylinositol phosphate synthase 9.59e-13 1.03e-07 NA NA
5. P O14735 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 5.02e-14 2.59e-05 NA NA
5. P P9WPG6 Phosphatidylinositol phosphate synthase 3.43e-13 1.14e-09 NA NA
5. P P70500 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 6.35e-14 2.76e-05 NA NA
5. P P76226 Inner membrane protein YnjF 5.94e-10 1.25e-12 NA NA
5. P P9WPG7 Phosphatidylinositol phosphate synthase 3.53e-13 1.14e-09 NA NA
5. P Q827U4 Phosphatidylinositol phosphate synthase 1.85e-09 1.88e-06 NA NA
5. P P39823 CDP-diacylglycerol--serine O-phosphatidyltransferase 2.89e-08 3.25e-05 NA NA
5. P D0B707 Phosphatidylcholine synthase 8.98e-06 2.19e-02 NA NA
5. P B1MCK4 Phosphatidylinositol phosphate synthase 2.05e-13 1.80e-10 NA NA
5. P Q8NPZ2 Phosphatidylinositol phosphate synthase 4.94e-13 2.48e-08 NA NA
7. B O13899 Uncharacterized CDP-alcohol phosphatidyltransferase class-I family protein C22A12.08c 5.31e-05 NA 6.44e-10 NA
7. B O01916 Probable cardiolipin synthase (CMP-forming) 3.16e-14 NA 4.45e-11 NA
7. B Q93YW7 Cardiolipin synthase (CMP-forming), mitochondrial 5.48e-14 NA 7.57e-05 NA
7. B O80952 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1, chloroplastic 1.11e-16 NA 1.76e-19 NA
7. B Q07560 Cardiolipin synthase (CMP-forming) 3.09e-13 NA 1.83e-12 NA
7. B Q7ZW02 Cholinephosphotransferase 1 1.40e-07 NA 0.005 NA
7. B Q9UJA2 Cardiolipin synthase (CMP-forming) 2.43e-13 NA 6.14e-08 NA
7. B Q8H8U0 Cardiolipin synthase (CMP-forming), mitochondrial 0.00e+00 NA 9.71e-15 NA
7. B Q8MZC4 Probable cardiolipin synthase (CMP-forming) 1.98e-12 NA 5.48e-11 NA
7. B Q80ZM8 Cardiolipin synthase (CMP-forming) 3.12e-13 NA 1.73e-08 NA
7. B Q8SX37 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1.01e-09 NA 0.045 NA
7. B Q5U2V5 Cardiolipin synthase (CMP-forming) 3.20e-13 NA 1.81e-08 NA
7. B Q5N9A1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1, chloroplastic 5.97e-14 NA 8.07e-06 NA