Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX55011.1

JCVISYN3A_0876

Uncharacterized amino acid permease.
M. mycoides homolog: Q6MS69.
TIGRfam Classification: 2=Generic.
Category: Nonessential.

Statistics

Total GO Annotation: 401
Unique PROST Go: 282
Unique BLAST Go: 0
Unique Foldseek Go: 29

Total Homologs: 966
Unique PROST Homologs: 471
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 192

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Putative serine/threonine exchanger SteT
Antczak et al. [3]: L-type amino acid permease
Zhang et al. [4]: GO:1990822|basic amino acid transmembrane transport
Bianchi et al. [5]: Amino acid permease member

Structures and Sequence Alignment

The best structural homolog that predicted by 2. PF was P0CK99 (Aromatic amino acid transport protein AroP) with a FATCAT P-Value: 0 and RMSD of 3.07 angstrom. The sequence alignment identity is 24.3%.
Structural alignment shown in left. Query protein AVX55011.1 colored as red in alignment, homolog P0CK99 colored as blue. Query protein AVX55011.1 is also shown in right top, homolog P0CK99 showed in right bottom. They are colored based on secondary structures.

  AVX55011.1 M---KNKG-KL---L--EFLTLFAMTIGSVVGAGVYFKNKEILFDTRNPIIAIIL-WIIVGSVC-VSMVYL---FLE--IASSTKN------GG-SG-TI 76
      P0CK99 MMDSQQHGEQLKRGLKNRHIQLIA--LGGAIGTGLFLGSASVI-QSAGP--GIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGGFAGFAS 95

  AVX55011.1 GVWTKLFINRKVGSFFAILNAFFYLPVMQSMFISFFITFILMMFSTVQLKG--IHF----LLIFLTTGIAIIIINALINVFDLSISRKYQAFGTI---FK 167
      P0CK99 G-W-----N------YWVL----Y--VLVAM---AELTAV----------GKYIQFWYPEIPTWASAAAFFVIINA-INLTNVKV------FGEMEFWFA 157

  AVX55011.1 FIPLAIALIAGVVLFDQNGAFL----SGGINIT--N--PTGGTSKVEWSTN--NFNPLLFFRGFGGI-LFAFDGFIFICNSQRKAKYKDVVPKA---LIF 253
      P0CK99 IIKV-IAVIA-MILF---GAWLLFSDTAGPQATVRNLWEQGGFLPHGW-TGLVMMMAIIMF-SFGGLELV---G-ITAAEADNPEQS---IPKATNQVIY 243

  AVX55011.1 GMIFVSVFY--TL-IAVSLLMGSP------DGSIGALLEKLFN--GGKVLSSSDSSTLSRVANILTSVIIIIICSIGANNLS-YVSFVVIESDVIDKLY- 340
      P0CK99 RIL---IFYIGSLAVLLSLL---PWTRVTADTS-PFVL--IFHELG-------D--TF--VANALN--IVVLTAA-----LSVYNSCVYCNSRM---LFG 313

  AVX55011.1 LTSQKNISAKRIAIIQVS-VATAIYSTFILVGTLAT---VGLTNTATVEQAVSSTNGLIYPIQIIATSNACLSFIMIITLIIGA--LFNR-KTNK-VEVE 432
      P0CK99 LAQQGN-APK--ALLNVDKRGVPVSS--ILVSAVVTALCV-LLNYLAPESAF----GLLMAL-VV--SALVINWAM-ISL---AHMMFRRAKQQQGV--- 393

  AVX55011.1 KKKGFVVL----GSIAACCLVLFVTMSLFTILV-P-LDVINKNNNNSNWFTSNYYQGPLFILLTLLELGSVFIFWCIQEKRRK--KYDLENPEIQIIAKP 524
      P0CK99 -KTRFPALFYPFGNV--LCL-LFMAAVLIIMLMTPGMAI-------SVWLI------PVWLL--ILGVGYL----C-KEKTAKTVKAH------------ 457

  AVX55011.1 TV 526
      P0CK99 -- 457

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0022857	transmembrane transporter activity
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0016021	integral component of membrane
1. PBF	GO:0015179	L-amino acid transmembrane transporter activity
2. PF	GO:0055085	transmembrane transport
2. PF	GO:0097639	L-lysine import across plasma membrane
2. PF	GO:0015872	dopamine transport
2. PF	GO:0005829	cytosol
2. PF	GO:0005328	neurotransmitter:sodium symporter activity
2. PF	GO:0042940	D-amino acid transport
2. PF	GO:0035524	proline transmembrane transport
2. PF	GO:0015734	taurine transport
2. PF	GO:1903801	L-leucine import across plasma membrane
2. PF	GO:0043858	arginine:ornithine antiporter activity
2. PF	GO:0003333	amino acid transmembrane transport
2. PF	GO:0015196	L-tryptophan transmembrane transporter activity
2. PF	GO:0042942	D-serine transport
2. PF	GO:0015175	neutral amino acid transmembrane transporter activity
2. PF	GO:0015171	amino acid transmembrane transporter activity
2. PF	GO:1904273	L-alanine import across plasma membrane
2. PF	GO:0006837	serotonin transport
2. PF	GO:0015851	nucleobase transport
2. PF	GO:0097638	L-arginine import across plasma membrane
2. PF	GO:0015658	branched-chain amino acid transmembrane transporter activity
2. PF	GO:0005309	creatine:sodium symporter activity
2. PF	GO:0005334	norepinephrine:sodium symporter activity
2. PF	GO:0015293	symporter activity
2. PF	GO:0015203	polyamine transmembrane transporter activity
2. PF	GO:0015188	L-isoleucine transmembrane transporter activity
2. PF	GO:0008292	acetylcholine biosynthetic process
2. PF	GO:0042943	D-amino acid transmembrane transporter activity
2. PF	GO:0005576	extracellular region
2. PF	GO:0015874	norepinephrine transport
2. PF	GO:0005283	amino acid:sodium symporter activity
2. PF	GO:0006814	sodium ion transport
2. PF	GO:0015827	tryptophan transport
2. PF	GO:0022889	serine transmembrane transporter activity
2. PF	GO:0031669	cellular response to nutrient levels
2. PF	GO:0015180	L-alanine transmembrane transporter activity
2. PF	GO:1904556	L-tryptophan transmembrane transport
2. PF	GO:0035725	sodium ion transmembrane transport
2. PF	GO:0005887	integral component of plasma membrane
2. PF	GO:0090067	regulation of thalamus size
2. PF	GO:0015182	L-asparagine transmembrane transporter activity
2. PF	GO:0015123	acetate transmembrane transporter activity
2. PF	GO:0015086	cadmium ion transmembrane transporter activity
2. PF	GO:0015495	gamma-aminobutyric acid:proton symporter activity
2. PF	GO:0031924	vitamin B6 transmembrane transporter activity
2. PF	GO:0015297	antiporter activity
2. PF	GO:0015185	gamma-aminobutyric acid transmembrane transporter activity
2. PF	GO:0071281	cellular response to iron ion
2. PF	GO:0015186	L-glutamine transmembrane transporter activity
2. PF	GO:0005304	L-valine transmembrane transporter activity
2. PF	GO:0015190	L-leucine transmembrane transporter activity
2. PF	GO:0015191	L-methionine transmembrane transporter activity
2. PF	GO:0015804	neutral amino acid transport
2. PF	GO:0032809	neuronal cell body membrane
2. PF	GO:0015881	creatine transmembrane transport
2. PF	GO:0006876	cellular cadmium ion homeostasis
2. PF	GO:0051139	metal ion:proton antiporter activity
2. PF	GO:0043005	neuron projection
2. PF	GO:0042605	peptide antigen binding
2. PF	GO:0005330	dopamine:sodium symporter activity
2. PF	GO:1990384	hyaloid vascular plexus regression
2. PF	GO:0006836	neurotransmitter transport
2. PF	GO:0015829	valine transport
2. PF	GO:0046873	metal ion transmembrane transporter activity
2. PF	GO:0015173	aromatic amino acid transmembrane transporter activity
2. PF	GO:0005332	gamma-aminobutyric acid:sodium symporter activity
2. PF	GO:0015496	putrescine:ornithine antiporter activity
2. PF	GO:0006865	amino acid transport
2. PF	GO:0015233	pantothenate transmembrane transporter activity
2. PF	GO:1990184	amino acid transport complex
2. PF	GO:0005737	cytoplasm
2. PF	GO:0051583	dopamine uptake involved in synaptic transmission
2. PF	GO:0005369	taurine:sodium symporter activity
2. PF	GO:0005326	neurotransmitter transmembrane transporter activity
2. PF	GO:0015187	glycine transmembrane transporter activity
2. PF	GO:0015887	pantothenate transmembrane transport
2. PF	GO:0015820	leucine transport
2. PF	GO:0015803	branched-chain amino acid transport
2. PF	GO:0015205	nucleobase transmembrane transporter activity
2. PF	GO:0015565	threonine efflux transmembrane transporter activity
2. PF	GO:0043879	glycolate transmembrane transporter activity
2. PF	GO:0005384	manganese ion transmembrane transporter activity
2. PF	GO:0016323	basolateral plasma membrane
2. PF	GO:0006847	plasma membrane acetate transport
2. PF	GO:1903352	L-ornithine transmembrane transport
2. PF	GO:0015818	isoleucine transport
2. PF	GO:0055072	iron ion homeostasis
5. P	GO:0022858	alanine transmembrane transporter activity
5. P	GO:0034228	ethanolamine transmembrane transporter activity
5. P	GO:0015181
5. P	GO:0008028	monocarboxylic acid transmembrane transporter activity
5. P	GO:0051939	gamma-aminobutyric acid import
5. P	GO:0150104	transport across blood-brain barrier
5. P	GO:0033265	choline binding
5. P	GO:1903786	regulation of glutathione biosynthetic process
5. P	GO:0005634	nucleus
5. P	GO:0033029	regulation of neutrophil apoptotic process
5. P	GO:1903826	L-arginine transmembrane transport
5. P	GO:0090517	L-lysine transmembrane import into vacuole
5. P	GO:0032006	regulation of TOR signaling
5. P	GO:0015489	putrescine transmembrane transporter activity
5. P	GO:0009450	gamma-aminobutyric acid catabolic process
5. P	GO:0015816	glycine transport
5. P	GO:0015888	thiamine transport
5. P	GO:0015220	choline transmembrane transporter activity
5. P	GO:1903204	negative regulation of oxidative stress-induced neuron death
5. P	GO:0005477	pyruvate secondary active transmembrane transporter activity
5. P	GO:0098691	dopaminergic synapse
5. P	GO:0016324	apical plasma membrane
5. P	GO:0034755	iron ion transmembrane transport
5. P	GO:0048002	antigen processing and presentation of peptide antigen
5. P	GO:0006600	creatine metabolic process
5. P	GO:0001762	beta-alanine transport
5. P	GO:2000211	regulation of glutamate metabolic process
5. P	GO:0005300	high-affinity tryptophan transmembrane transporter activity
5. P	GO:0005308	creatine transmembrane transporter activity
5. P	GO:0032753	positive regulation of interleukin-4 production
5. P	GO:0042908	xenobiotic transport
5. P	GO:1902274	positive regulation of (R)-carnitine transmembrane transport
5. P	GO:0015209	cytosine transmembrane transporter activity
5. P	GO:0015821	methionine transport
5. P	GO:0090494	dopamine uptake
5. P	GO:0048039	ubiquinone binding
5. P	GO:1901494	regulation of cysteine metabolic process
5. P	GO:0015225	biotin transmembrane transporter activity
5. P	GO:0031520	plasma membrane of cell tip
5. P	GO:0005298	proline:sodium symporter activity
5. P	GO:0015505	uracil:cation symporter activity
5. P	GO:0042907	xanthine transmembrane transporter activity
5. P	GO:0042941	D-alanine transport
5. P	GO:0009093	cysteine catabolic process
5. P	GO:0042773	ATP synthesis coupled electron transport
5. P	GO:1900749	(R)-carnitine transport
5. P	GO:0060586	multicellular organismal iron ion homeostasis
5. P	GO:0015370	solute:sodium symporter activity
5. P	GO:0005291	high-affinity L-histidine transmembrane transporter activity
5. P	GO:0000101	sulfur amino acid transport
5. P	GO:0015193	L-proline transmembrane transporter activity
5. P	GO:0030424	axon
5. P	GO:0031224	intrinsic component of membrane
5. P	GO:0055076	transition metal ion homeostasis
5. P	GO:0005307	choline:sodium symporter activity
5. P	GO:0034216	high-affinity thiamine:proton symporter activity
5. P	GO:0015848	spermidine transport
5. P	GO:0005368	taurine transmembrane transporter activity
5. P	GO:0015710	tellurite transport
5. P	GO:0006826	iron ion transport
5. P	GO:0010940	positive regulation of necrotic cell death
5. P	GO:0009636	response to toxic substance
5. P	GO:0021591	ventricular system development
5. P	GO:0015648	lipid-linked peptidoglycan transporter activity
5. P	GO:0008523	sodium-dependent multivitamin transmembrane transporter activity
5. P	GO:0090515	L-glutamate transmembrane import into vacuole
5. P	GO:0070574	cadmium ion transmembrane transport
5. P	GO:0019534	toxin transmembrane transporter activity
5. P	GO:0098721	uracil import across plasma membrane
5. P	GO:0015184	L-cystine transmembrane transporter activity
5. P	GO:0006877	cellular cobalt ion homeostasis
5. P	GO:0098810	neurotransmitter reuptake
5. P	GO:1904271	L-proline import across plasma membrane
5. P	GO:0040018	positive regulation of multicellular organism growth
5. P	GO:1901281	fructoselysine catabolic process
5. P	GO:0015813	L-glutamate transmembrane transport
5. P	GO:0051180	vitamin transport
5. P	GO:0021756	striatum development
5. P	GO:0030977	taurine binding
5. P	GO:0001504	neurotransmitter uptake
5. P	GO:0034229	ethanolamine transport
5. P	GO:0098718	serine import across plasma membrane
5. P	GO:0098712	L-glutamate import across plasma membrane
5. P	GO:0061537	glycine secretion, neurotransmission
5. P	GO:0042053	regulation of dopamine metabolic process
5. P	GO:0098739	import across plasma membrane
5. P	GO:0015837	amine transport
5. P	GO:0034258	nicotinamide riboside transport
5. P	GO:0008021	synaptic vesicle
5. P	GO:0031402	sodium ion binding
5. P	GO:0015707	nitrite transport
5. P	GO:0034775	glutathione transmembrane transport
5. P	GO:0002537	nitric oxide production involved in inflammatory response
5. P	GO:0042416	dopamine biosynthetic process
5. P	GO:0090482	vitamin transmembrane transporter activity
5. P	GO:0060134	prepulse inhibition
5. P	GO:0015856	cytosine transport
5. P	GO:1903692	methionine import across plasma membrane
5. P	GO:0070839	metal ion export
5. P	GO:0090516	L-serine transmembrane import into vacuole
5. P	GO:0000102	L-methionine secondary active transmembrane transporter activity
5. P	GO:0071918	urea transmembrane transport
5. P	GO:0015878	biotin transport
5. P	GO:1903089	5-amino-1-ribofuranosylimidazole-4-carboxamide transmembrane transporter activity
5. P	GO:0006828	manganese ion transport
5. P	GO:1904200	iodide transmembrane transport
5. P	GO:0098713	leucine import across plasma membrane
5. P	GO:0015824	proline transport
5. P	GO:0015807	L-amino acid transport
5. P	GO:0015690	aluminum cation transport
5. P	GO:0071705	nitrogen compound transport
5. P	GO:0000100	S-methylmethionine transmembrane transporter activity
5. P	GO:0043030	regulation of macrophage activation
5. P	GO:0045334	clathrin-coated endocytic vesicle
5. P	GO:1904256	positive regulation of iron ion transmembrane transporter activity
5. P	GO:0000324	fungal-type vacuole
5. P	GO:0015810	aspartate transmembrane transport
5. P	GO:0015705	iodide transport
5. P	GO:0015204	urea transmembrane transporter activity
5. P	GO:0015809
5. P	GO:0006849	plasma membrane pyruvate transport
5. P	GO:0031528	microvillus membrane
5. P	GO:0012506	vesicle membrane
5. P	GO:0015291	secondary active transmembrane transporter activity
5. P	GO:0015838	amino-acid betaine transport
5. P	GO:0098591	external side of apical plasma membrane
5. P	GO:0015101	organic cation transmembrane transporter activity
5. P	GO:0005275	amine transmembrane transporter activity
5. P	GO:0032975	amino acid transmembrane import into vacuole
5. P	GO:0042420	dopamine catabolic process
5. P	GO:0045232	S-layer organization
5. P	GO:0016600	flotillin complex
5. P	GO:0045342	MHC class II biosynthetic process
5. P	GO:0008137	NADH dehydrogenase (ubiquinone) activity
5. P	GO:0015912	short-chain fatty acid transport
5. P	GO:0005290	L-histidine transmembrane transporter activity
5. P	GO:0009267	cellular response to starvation
5. P	GO:0071235	cellular response to proline
5. P	GO:0015174	basic amino acid transmembrane transporter activity
5. P	GO:0035240	dopamine binding
5. P	GO:1903810	L-histidine import across plasma membrane
5. P	GO:0015129	lactate transmembrane transporter activity
5. P	GO:0008504	monoamine transmembrane transporter activity
5. P	GO:0015083	aluminum ion transmembrane transporter activity
5. P	GO:0015189	L-lysine transmembrane transporter activity
5. P	GO:0045730	respiratory burst
5. P	GO:0009925	basal plasma membrane
5. P	GO:0055071	manganese ion homeostasis
5. P	GO:0090518	L-arginine transmembrane import into vacuole
5. P	GO:0022804	active transmembrane transporter activity
5. P	GO:0140135	mechanosensitive cation channel activity
5. P	GO:0097449	astrocyte projection
5. P	GO:0007595	lactation
5. P	GO:0043872	lysine:cadaverine antiporter activity
5. P	GO:0070306	lens fiber cell differentiation
5. P	GO:0015847	putrescine transport
5. P	GO:1903804	glycine import across plasma membrane
5. P	GO:0044853	plasma membrane raft
5. P	GO:0015811	L-cystine transport
5. P	GO:0090513	L-histidine transmembrane import into vacuole
5. P	GO:0000041	transition metal ion transport
5. P	GO:0019811	cocaine binding
5. P	GO:0005774	vacuolar membrane
5. P	GO:1990403	embryonic brain development
5. P	GO:0015327	cystine:glutamate antiporter activity
5. P	GO:1904717	regulation of AMPA glutamate receptor clustering
5. P	GO:0015805	S-adenosyl-L-methionine transport
5. P	GO:1903714	isoleucine transmembrane transport
5. P	GO:1905803	negative regulation of cellular response to manganese ion
5. P	GO:0051721	protein phosphatase 2A binding
5. P	GO:0051223	regulation of protein transport
5. P	GO:1901367	response to L-cysteine
5. P	GO:0015846	polyamine transport
5. P	GO:0015806	S-methylmethionine transport
5. P	GO:0097640	L-ornithine import across plasma membrane
5. P	GO:1903401	L-lysine transmembrane transport
5. P	GO:0042734	presynaptic membrane
5. P	GO:0070327	thyroid hormone transport
5. P	GO:0010042	response to manganese ion
5. P	GO:0140206	dipeptide import across plasma membrane
5. P	GO:0005294	neutral L-amino acid secondary active transmembrane transporter activity
5. P	GO:0051936	gamma-aminobutyric acid reuptake
5. P	GO:0015295	solute:proton symporter activity
5. P	GO:0015844	monoamine transport
5. P	GO:0090514	L-tyrosine transmembrane import into vacuole
5. P	GO:0015195	L-threonine transmembrane transporter activity
5. P	GO:1904782	negative regulation of NMDA glutamate receptor activity
5. P	GO:0005412	glucose:sodium symporter activity
5. P	GO:0071419	cellular response to amphetamine
5. P	GO:1903088	5-amino-1-ribofuranosylimidazole-4-carboxamide transmembrane transport
5. P	GO:0089718	amino acid import across plasma membrane
5. P	GO:0051938	L-glutamate import
5. P	GO:0051512	positive regulation of unidimensional cell growth
5. P	GO:0015718	monocarboxylic acid transport
5. P	GO:1903988	iron ion export across plasma membrane
5. P	GO:0015833	peptide transport
5. P	GO:0051454	intracellular pH elevation
5. P	GO:0015654	tellurite transmembrane transporter activity
5. P	GO:1905647	proline import across plasma membrane
5. P	GO:0015836	lipid-linked peptidoglycan transport
5. P	GO:1990822	basic amino acid transmembrane transport
5. P	GO:0002309	T cell proliferation involved in immune response
5. P	GO:0015386	potassium:proton antiporter activity
5. P	GO:0061459	L-arginine transmembrane transporter activity
5. P	GO:0015349	thyroid hormone transmembrane transporter activity
5. P	GO:0010039	response to iron ion
5. P	GO:0031526	brush border membrane
5. P	GO:0015828	tyrosine transport
5. P	GO:0002606	positive regulation of dendritic cell antigen processing and presentation
5. P	GO:1905847	negative regulation of cellular response to oxidopamine
5. P	GO:0022890	inorganic cation transmembrane transporter activity
5. P	GO:0005313	L-glutamate transmembrane transporter activity
5. P	GO:0015840	urea transport
5. P	GO:0015871	choline transport
5. P	GO:0046915	transition metal ion transmembrane transporter activity
5. P	GO:0000064	L-ornithine transmembrane transporter activity
5. P	GO:0015812	gamma-aminobutyric acid transport
5. P	GO:1905135	biotin import across plasma membrane
5. P	GO:0042220	response to cocaine
5. P	GO:0015801	aromatic amino acid transport
5. P	GO:0032740	positive regulation of interleukin-17 production
5. P	GO:0015655	alanine:sodium symporter activity
5. P	GO:0008507	sodium:iodide symporter activity
5. P	GO:0032328	alanine transport
5. P	GO:0015817	histidine transport
5. P	GO:0009624	response to nematode
5. P	GO:0005302	L-tyrosine transmembrane transporter activity
5. P	GO:0050804	modulation of chemical synaptic transmission
5. P	GO:0000329	fungal-type vacuole membrane
5. P	GO:0042944	D-alanine transmembrane transporter activity
5. P	GO:0032126	eisosome
5. P	GO:0099055	integral component of postsynaptic membrane
5. P	GO:1901482	L-lysine import into vacuole involved in cellular response to nitrogen starvation
5. P	GO:1902023
5. P	GO:0005783	endoplasmic reticulum
5. P	GO:0005416	amino acid:cation symporter activity
5. P	GO:1901235	(R)-carnitine transmembrane transporter activity
5. P	GO:0043025	neuronal cell body
5. P	GO:0015839	cadaverine transport
5. P	GO:0015822	ornithine transport
5. P	GO:1901481	L-glutamate import involved in cellular response to nitrogen starvation
5. P	GO:0019858	cytosine metabolic process
5. P	GO:0015802	basic amino acid transport
5. P	GO:0007274	neuromuscular synaptic transmission
5. P	GO:0045597	positive regulation of cell differentiation
5. P	GO:0007271	synaptic transmission, cholinergic
5. P	GO:0015192	L-phenylalanine transmembrane transporter activity
5. P	GO:0035094	response to nicotine
5. P	GO:0015823	phenylalanine transport
5. P	GO:0022893	low-affinity tryptophan transmembrane transporter activity
5. P	GO:0030026	cellular manganese ion homeostasis
5. P	GO:0042165	neurotransmitter binding
5. P	GO:0021984	adenohypophysis development
5. P	GO:0048021	regulation of melanin biosynthetic process
5. P	GO:0098797	plasma membrane protein complex
5. P	GO:0015691	cadmium ion transport
5. P	GO:0042116	macrophage activation
5. P	GO:0042906	xanthine transport
5. P	GO:0030285	integral component of synaptic vesicle membrane
5. P	GO:0015199	amino-acid betaine transmembrane transporter activity
5. P	GO:0015183	L-aspartate transmembrane transporter activity
5. P	GO:0001761	beta-alanine transmembrane transporter activity
5. P	GO:0005381	iron ion transmembrane transporter activity
5. P	GO:0051620	norepinephrine uptake
5. P	GO:0071421	manganese ion transmembrane transport
5. P	GO:0015355	secondary active monocarboxylate transmembrane transporter activity
5. P	GO:0015819	lysine transport
5. P	GO:0000821	regulation of arginine metabolic process
5. P	GO:0015606	spermidine transmembrane transporter activity
5. P	GO:0034761	positive regulation of iron ion transmembrane transport
5. P	GO:0015194	L-serine transmembrane transporter activity
5. P	GO:0032729	positive regulation of interferon-gamma production
5. P	GO:0099056	integral component of presynaptic membrane
5. P	GO:0140125	thiamine import across plasma membrane
5. P	GO:0006590	thyroid hormone generation
5. P	GO:0071944	cell periphery
5. P	GO:0032178	medial membrane band
5. P	GO:0098982	GABA-ergic synapse
5. P	GO:0002827	positive regulation of T-helper 1 type immune response
5. P	GO:0015111	iodide transmembrane transporter activity
5. P	GO:1902475	L-alpha-amino acid transmembrane transport
5. P	GO:0090461	glutamate homeostasis
6. F	GO:0015379	potassium:chloride symporter activity
6. F	GO:1903841	cellular response to arsenite(3-)
6. F	GO:0080135	regulation of cellular response to stress
6. F	GO:0009847	spore germination
6. F	GO:0044292	dendrite terminus
6. F	GO:0009734	auxin-activated signaling pathway
6. F	GO:0140157	ammonium import across plasma membrane
6. F	GO:0015377	cation:chloride symporter activity
6. F	GO:0033120	positive regulation of RNA splicing
6. F	GO:0006813	potassium ion transport
6. F	GO:0051610	serotonin uptake
6. F	GO:0048854	brain morphogenesis
6. F	GO:0044316	cone cell pedicle
6. F	GO:0098793	presynapse
6. F	GO:0046872	metal ion binding
6. F	GO:0051378	serotonin binding
6. F	GO:0050998	nitric-oxide synthase binding
6. F	GO:0015079	potassium ion transmembrane transporter activity
6. F	GO:0032329	serine transport
6. F	GO:0005335	serotonin:sodium symporter activity
6. F	GO:0071310	cellular response to organic substance
6. F	GO:0046621	negative regulation of organ growth
6. F	GO:0045787	positive regulation of cell cycle
6. F	GO:0005295	neutral amino acid:sodium symporter activity
6. F	GO:0089709	L-histidine transmembrane transport
6. F	GO:0006525	arginine metabolic process
6. F	GO:0098659	inorganic cation import across plasma membrane
6. F	GO:0006868	glutamine transport
6. F	GO:0019483	beta-alanine biosynthetic process

Uniprot GO Annotations

GO	Description
GO:0022857	transmembrane transporter activity
GO:0016020	membrane
GO:0055085	transmembrane transport
GO:0016021	integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	O34739	Serine/threonine exchanger SteT	1.11e-16	1.52e-23	0.009	0.6873
1. PBF	P75472	Uncharacterized protein MPN_308	0.00e+00	8.22e-58	6.22e-14	0.7247
2. PF	A4TMF6	Divalent metal cation transporter MntH	1.11e-16	1.65e-03	NA	0.6493
2. PF	Q9GJT6	Sodium-dependent dopamine transporter	1.52e-06	2.39e-03	NA	0.5591
2. PF	A9N628	Threonine/serine transporter TdcC	1.44e-09	8.14e-07	NA	0.596
2. PF	P0AAD7	Serine transporter SdaC	5.37e-08	7.77e-05	NA	0.5755
2. PF	Q6G9F4	Putative branched-chain amino acid carrier protein SAS1350	2.46e-08	9.83e-12	NA	0.6041
2. PF	P71345	Branched-chain amino acid transport system carrier protein	9.58e-09	8.80e-10	NA	0.5585
2. PF	Q3YXB3	Threonine/serine transporter TdcC	1.42e-09	1.36e-06	NA	0.6271
2. PF	B7NDA4	Threonine/serine transporter TdcC	3.05e-09	1.54e-06	NA	0.6444
2. PF	B7MY49	Divalent metal cation transporter MntH	4.86e-10	5.84e-04	NA	0.613
2. PF	C0PZC8	Divalent metal cation transporter MntH	5.16e-10	1.31e-04	NA	0.6581
2. PF	Q0TF69	Divalent metal cation transporter MntH	3.30e-12	5.84e-04	NA	0.6499
2. PF	B5R3U1	Divalent metal cation transporter MntH	3.88e-10	1.84e-04	NA	0.6494
2. PF	O74248	Putative polyamine transporter	3.12e-11	1.01e-14	NA	0.6506
2. PF	P42964	Uncharacterized membrane protein YcsG	9.52e-08	2.97e-07	NA	0.5649
2. PF	Q9XS59	Sodium-dependent neutral amino acid transporter B(0)AT2	8.62e-06	9.60e-05	NA	0.5793
2. PF	A2RI87	Serine permease SerP1	3.47e-12	6.04e-17	NA	0.7197
2. PF	Q46065	Aromatic amino acid transport protein AroP	0.00e+00	1.99e-17	NA	0.707
2. PF	A2RNZ6	Lysine permease LysP	0.00e+00	3.94e-17	NA	0.6235
2. PF	P0A771	Divalent metal cation transporter MntH	4.55e-10	5.84e-04	NA	0.6414
2. PF	Q49XK9	Putative branched-chain amino acid carrier protein SSP1343	1.54e-08	2.77e-12	NA	0.5866
2. PF	Q9CEY5	Probable agmatine/putrescine antiporter AguD	1.26e-12	2.48e-22	NA	0.7094
2. PF	B5F6Q0	Threonine/serine transporter TdcC	1.58e-09	7.02e-07	NA	0.6152
2. PF	Q931T9	Divalent metal cation transporter MntH	1.40e-08	1.04e-02	NA	0.5484
2. PF	Q3YZE0	Divalent metal cation transporter MntH	6.81e-10	5.84e-04	NA	0.6075
2. PF	O31462	Uncharacterized amino acid permease YbgF	0.00e+00	8.60e-24	NA	0.6716
2. PF	B5RCN6	Divalent metal cation transporter MntH	5.50e-10	1.84e-04	NA	0.6263
2. PF	Q28I47	Putative sodium-coupled neutral amino acid transporter 8	1.22e-11	2.31e-05	NA	0.6456
2. PF	Q7A166	Divalent metal cation transporter MntH	1.37e-08	1.13e-02	NA	0.5832
2. PF	P37460	Proline-specific permease ProY	0.00e+00	4.41e-21	NA	0.7325
2. PF	P63342	Inner membrane transport protein YqeG	1.79e-11	2.72e-07	NA	0.6978
2. PF	P0A190	Probable transport protein YifK	7.56e-11	1.32e-23	NA	0.6918
2. PF	Q6DFE7	Putative sodium-coupled neutral amino acid transporter 7	3.09e-08	2.06e-02	NA	0.6289
2. PF	A4WEU1	Threonine/serine transporter TdcC	1.20e-09	3.21e-06	NA	0.6316
2. PF	B5QZS1	Threonine/serine transporter TdcC	1.29e-09	7.02e-07	NA	0.6373
2. PF	A2RMP5	Aromatic amino acid permease FywP	5.55e-15	5.39e-22	NA	0.6601
2. PF	P39137	Amino-acid permease RocE	0.00e+00	1.06e-21	NA	0.7005
2. PF	Q8FL49	Aromatic amino acid transport protein AroP	0.00e+00	3.95e-20	NA	0.717
2. PF	B5REJ9	Threonine/serine transporter TdcC	1.23e-09	7.02e-07	NA	0.6121
2. PF	P63350	Uncharacterized transporter Mb2022c	4.33e-15	7.64e-12	NA	0.6482
2. PF	Q668N2	Divalent metal cation transporter MntH	1.11e-16	1.65e-03	NA	0.6276
2. PF	Q29GB8	Sodium-dependent nutrient amino acid transporter 1	8.01e-07	3.14e-04	NA	0.5423
2. PF	Q0T2A8	Divalent metal cation transporter MntH	3.87e-12	3.85e-04	NA	0.5866
2. PF	B6I491	Threonine/serine transporter TdcC	1.56e-09	1.66e-06	NA	0.6277
2. PF	P75462	Uncharacterized protein MG226 homolog	0.00e+00	4.35e-31	NA	0.6877
2. PF	P63236	Glutamate/gamma-aminobutyrate antiporter	0.00e+00	8.89e-25	NA	0.6126
2. PF	P0AAE9	Probable cadaverine/lysine antiporter	7.44e-12	2.13e-24	NA	0.6801
2. PF	B7UJ20	Threonine/serine transporter TdcC	2.69e-09	1.66e-06	NA	0.654
2. PF	Q9FEL7	Auxin transporter-like protein 2	1.84e-10	4.75e-02	NA	0.5945
2. PF	B7NPS9	Divalent metal cation transporter MntH	4.81e-10	5.84e-04	NA	0.6254
2. PF	P0AAE4	Proline-specific permease ProY	0.00e+00	1.17e-21	NA	0.7294
2. PF	Q8Z1R2	Cation/acetate symporter ActP	7.10e-07	5.60e-04	NA	0.3785
2. PF	A1WR47	Divalent metal cation transporter MntH	7.31e-12	8.76e-03	NA	0.5023
2. PF	Q45577	Probable amino acid-proton symporter YbeC	1.55e-07	1.68e-31	NA	0.6158
2. PF	Q6GHY0	Divalent metal cation transporter MntH	1.31e-08	1.53e-02	NA	0.5871
2. PF	A2RL65	Aspartate/glutamate permease AcaP	4.69e-13	3.32e-29	NA	0.6945
2. PF	B1IRJ9	Threonine/serine transporter TdcC	1.32e-09	1.54e-06	NA	0.6124
2. PF	P60062	Arginine/agmatine antiporter	0.00e+00	4.16e-23	NA	0.6395
2. PF	Q2FH31	Putative branched-chain amino acid carrier protein SAUSA300_1300	2.50e-08	9.83e-12	NA	0.6023
2. PF	P96593	Divalent metal cation transporter MntH	6.30e-12	3.94e-02	NA	0.5818
2. PF	Q9CG19	Glutamate/gamma-aminobutyrate antiporter	0.00e+00	7.36e-24	NA	0.6415
2. PF	Q5HG12	Putative branched-chain amino acid carrier protein SACOL1443	2.57e-08	9.83e-12	NA	0.5941
2. PF	P54425	Uncharacterized transporter YbxG	8.88e-16	1.77e-26	NA	0.7471
2. PF	B5BB80	Divalent metal cation transporter MntH	5.92e-10	1.37e-04	NA	0.6622
2. PF	P44727	Tyrosine-specific transport protein 1	0.00e+00	6.36e-07	NA	0.6163
2. PF	E1W822	Aromatic amino acid transport protein AroP	0.00e+00	3.06e-20	NA	0.6508
2. PF	B7LMN9	Cation/acetate symporter ActP	9.49e-07	7.15e-04	NA	0.377
2. PF	P37034	Uncharacterized transporter lpg1691	0.00e+00	1.80e-26	NA	0.7505
2. PF	E9F8M0	Transmembrane transporter swnT	2.32e-14	2.83e-09	NA	0.6593
2. PF	Q8ZCK2	Divalent metal cation transporter MntH	1.11e-16	1.65e-03	NA	0.6361
2. PF	B5BGF7	Threonine/serine transporter TdcC	1.58e-09	7.02e-07	NA	0.6144
2. PF	P94575	Probable allantoin permease	2.77e-07	5.80e-10	NA	0.5569
2. PF	B7M6R1	Divalent metal cation transporter MntH	5.70e-10	5.84e-04	NA	0.6138
2. PF	P31661	Sodium- and chloride-dependent creatine transporter 1	3.50e-06	3.25e-03	NA	0.5444
2. PF	P0A4W1	L-asparagine permease 2	0.00e+00	6.23e-23	NA	0.6419
2. PF	Q5HGX9	Divalent metal cation transporter MntH	1.47e-08	1.13e-02	NA	0.631
2. PF	P0C217	Putative amino-acid transporter CPE0389	4.44e-16	3.62e-22	NA	0.5504
2. PF	Q5EA97	Putative sodium-coupled neutral amino acid transporter 11	1.30e-14	4.23e-03	NA	0.6413
2. PF	Q8ZGS9	Arginine/agmatine antiporter	0.00e+00	3.92e-23	NA	0.7023
2. PF	B5YZU5	Divalent metal cation transporter MntH	4.55e-10	5.84e-04	NA	0.646
2. PF	B2U0A0	Threonine/serine transporter TdcC	2.98e-09	1.66e-06	NA	0.6555
2. PF	B4NDL8	Sodium-dependent nutrient amino acid transporter 1	3.48e-07	4.55e-07	NA	0.4648
2. PF	Q9I703	Probable GABA permease	1.89e-15	5.84e-17	NA	0.6363
2. PF	B2K137	Cation/acetate symporter ActP	6.58e-07	1.29e-03	NA	0.4341
2. PF	Q1QZ83	Divalent metal cation transporter MntH	6.06e-12	3.14e-02	NA	0.5491
2. PF	P40812	L-asparagine permease	0.00e+00	1.29e-17	NA	0.6276
2. PF	P65545	Divalent metal cation transporter MntH	4.73e-12	1.87e-03	NA	0.5412
2. PF	Q1CJV0	Divalent metal cation transporter MntH	1.11e-16	1.65e-03	NA	0.6281
2. PF	A9R563	Cation/acetate symporter ActP	6.78e-07	1.63e-03	NA	0.4299
2. PF	Q8X968	Aromatic amino acid transport protein AroP	0.00e+00	8.29e-21	NA	0.7068
2. PF	O32257	Uncharacterized amino acid permease YvbW	0.00e+00	1.41e-19	NA	0.7348
2. PF	B5YS06	Threonine/serine transporter TdcC	1.20e-09	1.36e-06	NA	0.6593
2. PF	A6TAU9	Threonine/serine transporter TdcC	1.43e-09	1.18e-07	NA	0.6447
2. PF	P0AAF2	Putrescine transporter PotE	2.11e-15	5.74e-17	NA	0.7488
2. PF	A6U0S3	Divalent metal cation transporter MntH	1.46e-08	1.13e-02	NA	0.5836
2. PF	Q5L5E6	Arginine/agmatine antiporter	8.68e-13	2.82e-23	NA	0.627
2. PF	P9WQM8	L-asparagine permease 1	0.00e+00	1.15e-21	NA	0.6196
2. PF	P0A188	Aromatic amino acid transport protein AroP	0.00e+00	3.06e-20	NA	0.7472
2. PF	P34054	Amino-acid permease inda1	7.25e-14	1.40e-10	NA	0.6076
2. PF	P0A2N5	Inner membrane transporter YjeM	0.00e+00	7.61e-27	NA	0.7178
2. PF	P0ADA0	Branched-chain amino acid transport system 2 carrier protein	1.88e-08	3.86e-09	NA	0.5993
2. PF	A9MGK8	Cation/acetate symporter ActP	6.77e-07	6.78e-04	NA	0.4291
2. PF	Q46170	Arginine/ornithine antiporter	2.27e-13	1.14e-28	NA	0.6125
2. PF	Q32BK1	Threonine/serine transporter TdcC	3.08e-09	1.47e-06	NA	0.641
2. PF	Q1R8X4	Divalent metal cation transporter MntH	6.78e-10	5.84e-04	NA	0.6225
2. PF	Q9PK20	Arginine/agmatine antiporter	2.78e-15	2.92e-24	NA	0.6136
2. PF	B7N0B7	Threonine/serine transporter TdcC	3.19e-09	1.66e-06	NA	0.6559
2. PF	B7LCE3	Divalent metal cation transporter MntH	4.89e-10	5.84e-04	NA	0.6162
2. PF	B3TP03	Cationic amino acid transporter 2	1.18e-08	1.00e-05	NA	0.5043
2. PF	Q5RAG7	Cystine/glutamate transporter	1.22e-15	1.43e-07	NA	0.6587
2. PF	P63341	Inner membrane transport protein YqeG	1.84e-11	2.72e-07	NA	0.7029
2. PF	O59942	Amino-acid permease 2	1.07e-13	1.55e-11	NA	0.6264
2. PF	B1JFZ6	Divalent metal cation transporter MntH	7.63e-12	1.65e-03	NA	0.6201
2. PF	P60063	Arginine/agmatine antiporter	0.00e+00	4.16e-23	NA	0.639
2. PF	Q9RPF4	Divalent metal cation transporter MntH	6.79e-10	1.31e-04	NA	0.6243
2. PF	Q8GH68	Divalent metal cation transporter MntH	1.34e-08	3.72e-02	NA	0.4905
2. PF	Q28I80	Y+L amino acid transporter 2	8.51e-13	1.53e-11	NA	0.6429
2. PF	Q27946	Natural resistance-associated macrophage protein 1	9.00e-08	3.56e-03	NA	0.4719
2. PF	B0B7U3	Arginine/agmatine antiporter	1.78e-15	1.40e-24	NA	0.6198
2. PF	A1AG28	Threonine/serine transporter TdcC	1.36e-09	1.66e-06	NA	0.6551
2. PF	B5FHX7	Threonine/serine transporter TdcC	1.36e-09	7.02e-07	NA	0.623
2. PF	O07576	Uncharacterized amino acid permease YhdG	0.00e+00	2.60e-08	NA	0.663
2. PF	Q99U80	Putative branched-chain amino acid carrier protein SAV1407	2.32e-08	9.83e-12	NA	0.5969
2. PF	B1LMI9	Divalent metal cation transporter MntH	4.57e-10	5.84e-04	NA	0.6257
2. PF	A2RI86	DL-alanine permease SerP2	2.19e-09	1.21e-15	NA	0.6885
2. PF	P0AAE7	Putative arginine/ornithine antiporter	1.44e-15	9.69e-22	NA	0.683
2. PF	P94532	Peptide transporter CstA	3.09e-06	3.53e-05	NA	0.4997
2. PF	B7MB46	Threonine/serine transporter TdcC	1.11e-09	1.91e-06	NA	0.638
2. PF	P46349	GABA permease	2.57e-11	2.77e-26	NA	0.6728
2. PF	A8ADJ8	Divalent metal cation transporter MntH	4.85e-10	1.44e-02	NA	0.6226
2. PF	Q31WR5	Threonine/serine transporter TdcC	1.31e-09	1.66e-06	NA	0.6276
2. PF	Q874L4	Vitamin B6 transporter TPN1	1.25e-06	4.04e-05	NA	0.4643
2. PF	B1LFL8	Threonine/serine transporter TdcC	1.29e-09	1.54e-06	NA	0.63
2. PF	P51143	Sodium-dependent noradrenaline transporter	1.74e-06	4.52e-04	NA	0.5446
2. PF	Q8ZLW1	Threonine/serine transporter TdcC	1.30e-09	7.02e-07	NA	0.6418
2. PF	Q7A5N9	Putative branched-chain amino acid carrier protein SA1239	2.19e-11	9.83e-12	NA	0.5942
2. PF	P59737	Aromatic amino acid transport protein AroP	0.00e+00	2.98e-21	NA	0.7209
2. PF	P9WQM4	Uncharacterized transporter MT2031	7.68e-11	2.86e-31	NA	0.6297
2. PF	Q83Q28	Threonine/serine transporter TdcC	1.61e-09	1.54e-06	NA	0.6411
2. PF	Q28039	Sodium- and chloride-dependent glycine transporter 1	4.77e-06	9.49e-05	NA	0.5476
2. PF	P0AAF0	Probable cadaverine/lysine antiporter	6.06e-12	2.13e-24	NA	0.6532
2. PF	Q6GAA9	Divalent metal cation transporter MntH	1.45e-08	1.13e-02	NA	0.5737
2. PF	P0A189	Probable transport protein YifK	2.89e-15	1.32e-23	NA	0.6867
2. PF	O07577	Uncharacterized sodium-dependent transporter YhdH	3.26e-07	1.06e-11	NA	0.5424
2. PF	Q98I99	Divalent metal cation transporter MntH	2.69e-12	1.93e-02	NA	0.5623
2. PF	P0AAE6	Putative arginine/ornithine antiporter	9.99e-16	9.69e-22	NA	0.6899
2. PF	P56436	Natural resistance-associated macrophage protein 1	1.01e-07	3.83e-02	NA	0.4591
2. PF	B6I6U2	Divalent metal cation transporter MntH	4.18e-10	5.84e-04	NA	0.6533
2. PF	Q0TCY8	Threonine/serine transporter TdcC	3.84e-09	1.66e-06	NA	0.6564
2. PF	Q7YQK4	Large neutral amino acids transporter small subunit 1	3.47e-13	4.15e-08	NA	0.6915
2. PF	A5IRZ2	Divalent metal cation transporter MntH	1.41e-08	1.13e-02	NA	0.5701
2. PF	Q2YX69	Divalent metal cation transporter MntH	1.44e-08	9.47e-03	NA	0.5471
2. PF	B0BC08	Arginine/agmatine antiporter	1.55e-15	1.40e-24	NA	0.6166
2. PF	P57864	Uncharacterized protein PM0681	1.60e-12	1.54e-05	NA	0.5316
2. PF	O34618	Uncharacterized amino acid permease YtnA	5.20e-11	8.21e-25	NA	0.6831
2. PF	Q38UX8	Divalent metal cation transporter MntH	4.09e-10	3.45e-03	NA	0.576
2. PF	P49280	Natural resistance-associated macrophage protein 1	1.30e-07	1.74e-03	NA	0.4837
2. PF	Q5PCA8	Threonine/serine transporter TdcC	1.41e-09	7.02e-07	NA	0.6397
2. PF	P47467	Uncharacterized protein MG225	0.00e+00	1.71e-41	NA	0.6512
2. PF	A7FGC8	Divalent metal cation transporter MntH	5.51e-12	1.65e-03	NA	0.6193
2. PF	O07002	Aspartate-proton symporter	5.11e-15	7.52e-37	NA	0.5931
2. PF	Q8Z4X5	Divalent metal cation transporter MntH	5.05e-10	1.37e-04	NA	0.6665
2. PF	Q3KLY0	Arginine/agmatine antiporter	1.64e-12	1.94e-21	NA	0.6456
2. PF	P44615	Serine transporter SdaC	1.40e-09	1.28e-05	NA	0.6255
2. PF	P39636	Amino-acid permease RocC	8.88e-16	3.16e-24	NA	0.6857
2. PF	P0AAD9	Threonine/serine transporter TdcC	2.88e-09	1.36e-06	NA	0.6581
2. PF	A2RI97	Histidine permease HisP	2.33e-15	2.49e-28	NA	0.6513
2. PF	B7MH51	Divalent metal cation transporter MntH	4.88e-10	5.84e-04	NA	0.6414
2. PF	Q7NA72	Cation/acetate symporter ActP	7.42e-07	2.74e-05	NA	0.4337
2. PF	Q1R6L7	Threonine/serine transporter TdcC	1.40e-09	1.66e-06	NA	0.6512
2. PF	A1JIM8	Threonine/serine transporter TdcC	1.36e-09	4.22e-07	NA	0.6716
2. PF	P9WQM2	Uncharacterized transporter MT2055	4.77e-15	7.64e-12	NA	0.6364
2. PF	A8I499	Cationic amino acid transporter 2	4.18e-08	3.54e-06	NA	0.5479
2. PF	Q2YY11	Putative branched-chain amino acid carrier protein SAB1263c	3.74e-08	6.40e-12	NA	0.5902
2. PF	B1IX71	Divalent metal cation transporter MntH	4.67e-10	5.84e-04	NA	0.6254
2. PF	B4TVX7	Threonine/serine transporter TdcC	1.36e-09	7.02e-07	NA	0.6147
2. PF	A1L3M3	Y+L amino acid transporter 2	1.17e-12	8.85e-11	NA	0.6083
2. PF	P94369	Putative purine-cytosine permease YxlA	4.57e-08	5.36e-05	NA	0.5751
2. PF	B7N5Z2	Divalent metal cation transporter MntH	4.86e-10	5.84e-04	NA	0.6042
2. PF	P28785	Low affinity tryptophan permease	0.00e+00	5.71e-09	NA	0.705
2. PF	P0AAE1	D-serine/D-alanine/glycine transporter	0.00e+00	1.39e-16	NA	0.6964
2. PF	Q5RAE3	Large neutral amino acids transporter small subunit 2	1.89e-15	1.74e-13	NA	0.6238
2. PF	Q02DS7	Tryptophan-specific transport protein	0.00e+00	1.07e-11	NA	0.6811
2. PF	Q9X7P0	L-asparagine permease	0.00e+00	1.64e-17	NA	0.656
2. PF	A7E3U5	Putative sodium-coupled neutral amino acid transporter 7	2.00e-09	5.83e-03	NA	0.5996
2. PF	A9MPR1	Threonine/serine transporter TdcC	1.30e-09	5.48e-07	NA	0.6104
2. PF	C0PZ16	Threonine/serine transporter TdcC	1.43e-09	7.02e-07	NA	0.6429
2. PF	A6TC38	Divalent metal cation transporter MntH	4.54e-10	2.68e-03	NA	0.6448
2. PF	A1ADR7	Divalent metal cation transporter MntH	3.93e-12	5.84e-04	NA	0.6068
2. PF	Q6DCE8	Cationic amino acid transporter 2	4.27e-08	1.43e-06	NA	0.5254
2. PF	P39599	Uncharacterized symporter YwcA	1.02e-07	9.60e-04	NA	0.4049
2. PF	B2K911	Divalent metal cation transporter MntH	0.00e+00	1.65e-03	NA	0.6479
2. PF	Q0TU56	Putative amino-acid transporter CPF_0377	8.35e-13	3.62e-22	NA	0.5815
2. PF	P94383	Uncharacterized transporter YcgH	0.00e+00	1.72e-16	NA	0.7641
2. PF	A0A0H2VDI7	D-serine/D-alanine/glycine transporter	0.00e+00	5.74e-17	NA	0.7106
2. PF	P44849	Uncharacterized sodium-dependent transporter HI_0736	2.41e-08	3.91e-19	NA	0.5222
2. PF	Q9XT74	Natural resistance-associated macrophage protein 1	9.67e-08	7.25e-03	NA	0.4767
2. PF	Q7TZ67	Uncharacterized transporter Mb2001c	6.79e-11	3.06e-31	NA	0.6817
2. PF	Q8R7S2	Divalent metal cation transporter MntH	3.39e-10	2.86e-02	NA	0.5869
2. PF	P60065	Arginine/agmatine antiporter	0.00e+00	4.41e-23	NA	0.6429
2. PF	P44747	Tyrosine-specific transport protein 2	2.34e-14	4.00e-05	NA	0.6335
2. PF	B4TQE4	Divalent metal cation transporter MntH	6.18e-10	1.37e-04	NA	0.6582
2. PF	P38680	N amino acid transport system protein	3.82e-09	6.63e-03	NA	0.625
2. PF	Q27981	Natural resistance-associated macrophage protein 1	1.14e-07	4.36e-03	NA	0.458
2. PF	Q1CE35	Cation/acetate symporter ActP	7.11e-07	1.63e-03	NA	0.4056
2. PF	Q32DF6	Divalent metal cation transporter MntH	4.36e-10	8.92e-04	NA	0.6127
2. PF	P0AAD5	Tyrosine-specific transport protein	0.00e+00	8.77e-09	NA	0.6809
2. PF	B7LQI2	Threonine/serine transporter TdcC	1.74e-09	6.13e-07	NA	0.6507
2. PF	P18696	Proline-specific permease	1.14e-10	2.91e-11	NA	0.6255
2. PF	P0A770	Divalent metal cation transporter MntH	4.53e-10	5.84e-04	NA	0.6079
2. PF	Q797A7	Methylthioribose transporter	0.00e+00	3.37e-11	NA	0.6682
2. PF	O05087	Uncharacterized membrane protein HI_1728	0.00e+00	6.00e-05	NA	0.6234
2. PF	A7X111	Divalent metal cation transporter MntH	1.39e-08	1.04e-02	NA	0.569
2. PF	A6QFW1	Divalent metal cation transporter MntH	1.46e-08	1.13e-02	NA	0.5981
2. PF	B7LL85	Divalent metal cation transporter MntH	5.36e-10	5.84e-04	NA	0.6261
2. PF	P35865	L-lysine transport protein	2.22e-16	2.26e-29	NA	0.6798
2. PF	A2RNI1	Arginine/ornithine antiporter ArcD2	3.77e-11	3.84e-26	NA	0.6041
2. PF	Q7A0W9	Putative branched-chain amino acid carrier protein MW1297	2.37e-11	9.83e-12	NA	0.6042
2. PF	B7M023	Threonine/serine transporter TdcC	1.37e-09	1.66e-06	NA	0.6552
2. PF	Q5HQ64	Divalent metal cation transporter MntH	5.41e-09	5.83e-03	NA	0.5568
2. PF	A4WD10	Divalent metal cation transporter MntH	4.89e-10	8.65e-04	NA	0.6405
2. PF	O34560	Uncharacterized amino acid permease YecA	2.22e-16	1.59e-16	NA	0.7075
2. PF	P0CK99	Aromatic amino acid transport protein AroP	0.00e+00	3.06e-20	NA	0.7448
2. PF	Q492G8	Divalent metal cation transporter MntH	9.72e-09	1.65e-02	NA	0.6199
2. PF	B2TWY8	Divalent metal cation transporter MntH	5.29e-10	5.84e-04	NA	0.6397
2. PF	C8V329	Purine-cytosine permease fcyB	3.80e-10	1.30e-02	NA	0.45
2. PF	P0A2N4	Inner membrane transporter YjeM	0.00e+00	7.61e-27	NA	0.7141
2. PF	Q255I1	Arginine/agmatine antiporter	8.10e-13	3.69e-22	NA	0.5876
2. PF	O67304	Peptide transporter CstA	3.02e-09	3.00e-04	NA	0.5124
2. PF	Q9Z6M8	Arginine/agmatine antiporter	0.00e+00	6.46e-20	NA	0.6841
2. PF	P27799	Sodium- and chloride-dependent betaine transporter	3.71e-06	7.29e-07	NA	0.5246
2. PF	O34383	Uncharacterized sodium-dependent transporter YocR	4.98e-07	6.01e-11	NA	0.5786
2. PF	B4GVM9	Sodium-dependent nutrient amino acid transporter 1	1.30e-06	6.71e-05	NA	0.5434
2. PF	B1XGT1	Threonine/serine transporter TdcC	1.43e-09	1.36e-06	NA	0.6516
2. PF	O84379	Arginine/agmatine antiporter	3.22e-15	1.94e-21	NA	0.635
2. PF	Q9N1Q4	Large neutral amino acids transporter small subunit 2	1.78e-15	2.48e-11	NA	0.6098
2. PF	C4ZVS8	Divalent metal cation transporter MntH	4.72e-10	5.84e-04	NA	0.6082
2. PF	D4AU27	Swainsonine transporter swnT	0.00e+00	3.97e-09	NA	0.6085
2. PF	P27922	Sodium-dependent dopamine transporter	4.07e-06	1.60e-03	NA	0.5633
2. PF	Q95102	Natural resistance-associated macrophage protein 1	1.01e-07	3.06e-03	NA	0.4786
2. PF	O06005	Amino-acid permease AapA	0.00e+00	5.29e-16	NA	0.7311
2. PF	O32204	Putative arginine/ornithine antiporter	0.00e+00	7.80e-24	NA	0.6787
2. PF	P18275	Arginine/ornithine antiporter	6.73e-12	2.34e-27	NA	0.6133
2. PF	A7ZPK2	Divalent metal cation transporter MntH	6.48e-10	5.84e-04	NA	0.6342
2. PF	Q9XT49	Sodium-dependent serotonin transporter	5.77e-07	9.29e-03	NA	0.5063
2. PF	Q8ZKF8	Cation/acetate symporter ActP	5.64e-07	1.01e-03	NA	0.3426
2. PF	P9WQM6	L-asparagine permease 2	0.00e+00	6.23e-23	NA	0.6509
2. PF	Q9N1R6	b(0,+)-type amino acid transporter 1	3.33e-16	3.37e-11	NA	0.6492
2. PF	Q8CPM6	Divalent metal cation transporter MntH	7.22e-09	5.17e-03	NA	0.5693
2. PF	P0AAE3	Proline-specific permease ProY	0.00e+00	1.17e-21	NA	0.7316
2. PF	P0AA48	Low-affinity putrescine importer PlaP	4.05e-12	4.80e-14	NA	0.6299
2. PF	A1JLC3	Divalent metal cation transporter MntH	1.11e-16	9.76e-03	NA	0.5899
2. PF	Q57JL7	Threonine/serine transporter TdcC	1.19e-09	7.02e-07	NA	0.6416
2. PF	C4ZR30	Threonine/serine transporter TdcC	1.39e-09	1.36e-06	NA	0.6548
2. PF	A6ZTG5	General amino acid permease AGP1	1.50e-11	2.36e-02	NA	0.6126
2. PF	P25185	Branched-chain amino acid transport system 3 carrier protein	9.66e-09	5.67e-11	NA	0.6223
2. PF	Q9RPF2	Divalent metal cation transporter MntH 2	3.86e-12	4.67e-02	NA	0.5132
2. PF	B7UGA0	Divalent metal cation transporter MntH	4.50e-10	4.20e-04	NA	0.608
2. PF	O53092	Arginine/ornithine antiporter	2.44e-15	1.78e-28	NA	0.6544
2. PF	P44614	Tryptophan-specific transport protein	8.36e-12	1.73e-10	NA	0.6597
2. PF	Q8UWF0	High-affinity choline transporter 1	1.78e-06	6.21e-05	NA	0.4368
2. PF	Q5PNF0	Divalent metal cation transporter MntH	4.88e-10	1.37e-04	NA	0.6667
2. PF	B5XVU3	Divalent metal cation transporter MntH	4.77e-10	2.79e-03	NA	0.5983
2. PF	Q8X845	Probable fructoselysine/psicoselysine transporter FrlA	0.00e+00	1.79e-22	NA	0.6995
2. PF	P60064	Arginine/agmatine antiporter	0.00e+00	4.16e-23	NA	0.6391
2. PF	Q822F2	Arginine/agmatine antiporter	9.66e-13	2.03e-18	NA	0.6441
2. PF	Q7VEQ4	L-asparagine permease 1	0.00e+00	1.06e-21	NA	0.6389
2. PF	P60066	Arginine/agmatine antiporter	0.00e+00	4.41e-23	NA	0.6404
2. PF	Q99UZ7	Divalent metal cation transporter MntH	1.46e-08	1.13e-02	NA	0.5692
2. PF	P44768	Putrescine transporter PotE	0.00e+00	1.29e-18	NA	0.7547
2. PF	P19072	Branched-chain amino acid transport system 2 carrier protein	1.24e-08	3.66e-10	NA	0.5124
2. PF	P75463	Uncharacterized protein MG225 homolog	1.28e-13	1.19e-40	NA	0.6625
2. PF	Q57LU5	Divalent metal cation transporter MntH	4.08e-10	1.31e-04	NA	0.6545
2. PF	P44963	Sodium/pantothenate symporter	7.65e-07	4.38e-04	NA	0.3066
2. PF	B7LH53	Threonine/serine transporter TdcC	1.47e-09	1.66e-06	NA	0.6557
2. PF	A5PJX7	Sodium- and chloride-dependent GABA transporter 2	3.81e-06	4.18e-05	NA	0.5737
2. PF	Q8FHG6	Glutamate/gamma-aminobutyrate antiporter	2.78e-12	1.65e-24	NA	0.5909
2. PF	P42087	Putative histidine permease	3.33e-16	4.61e-26	NA	0.6805
2. PF	Q97TN5	Divalent metal cation transporter MntH	2.12e-08	2.67e-04	NA	0.5742
2. PF	A8AQ08	Threonine/serine transporter TdcC	1.51e-09	1.02e-06	NA	0.6376
2. PF	Q8XAF5	Serine transporter	3.66e-11	1.50e-06	NA	0.5748
2. PF	Q6GH01	Putative branched-chain amino acid carrier protein SAR1419	2.72e-08	4.09e-12	NA	0.5909
2. PF	P47468	Uncharacterized protein MG226	0.00e+00	4.96e-31	NA	0.6637
2. PF	Q83QD0	Serine transporter SdaC	6.03e-08	6.07e-05	NA	0.5623
2. PF	Q31Y80	Divalent metal cation transporter MntH	3.38e-12	5.84e-04	NA	0.6307
2. PF	Q03D26	Divalent metal cation transporter MntH	1.26e-09	2.72e-02	NA	0.5055
2. PF	O77741	Natural resistance-associated macrophage protein 1	2.91e-08	4.89e-02	NA	0.4554
2. PF	A7ZS06	Threonine/serine transporter TdcC	1.41e-09	1.36e-06	NA	0.6272
2. PF	D0ZE09	Threonine/serine transporter TdcC	1.31e-09	6.11e-06	NA	0.6764
2. PF	Q4G4A7	Threonine/serine transporter TdcC	1.30e-09	6.11e-06	NA	0.6765
2. PF	A7MP48	Divalent metal cation transporter MntH	3.91e-10	8.20e-04	NA	0.6579
2. PF	A8A2P6	Divalent metal cation transporter MntH	3.64e-12	1.34e-03	NA	0.6213
2. PF	P96704	Uncharacterized transporter YdgF	0.00e+00	1.50e-14	NA	0.7213
2. PF	Q00589	Sodium- and chloride-dependent taurine transporter	6.40e-07	5.91e-04	NA	0.5764
2. PF	B5F2E9	Cation/acetate symporter ActP	7.15e-07	1.01e-03	NA	0.4335
2. PF	Q8CP86	Putative branched-chain amino acid carrier protein SE_1090	1.72e-08	2.42e-12	NA	0.591
2. PF	Q8XB33	Low affinity tryptophan permease	0.00e+00	7.30e-13	NA	0.6957
2. PF	B1X9R3	Divalent metal cation transporter MntH	4.40e-10	5.84e-04	NA	0.6365
2. PF	Q610N4	Transmembrane protein 104 homolog	5.21e-11	2.76e-04	NA	0.5613
2. PF	P43059	Lysine/arginine permease	2.50e-11	1.04e-11	NA	0.6006
2. PF	Q2FHX5	Divalent metal cation transporter MntH	1.59e-08	1.13e-02	NA	0.589
2. PF	Q1C5Y6	Divalent metal cation transporter MntH	0.00e+00	1.65e-03	NA	0.655
5. P	A0A1D8PNP3	Amino-acid permease GAP6	1.41e-14	2.00e-13	NA	NA
5. P	Q9FFL1	Polyamine transporter RMV1	0.00e+00	2.68e-06	NA	NA
5. P	Q9C9J0	Lysine histidine transporter-like 5	2.44e-09	1.47e-02	NA	NA
5. P	P54104	Branched-chain amino acid transport system carrier protein	5.02e-08	4.13e-15	NA	NA
5. P	Q8W4K3	Cationic amino acid transporter 4, vacuolar	6.41e-09	1.05e-09	NA	NA
5. P	P31646	Sodium- and chloride-dependent GABA transporter 2	1.13e-06	5.74e-05	NA	NA
5. P	B4TIX1	Threonine/serine transporter TdcC	1.34e-09	7.02e-07	NA	NA
5. P	P0AAD3	Tryptophan-specific transport protein	1.17e-14	4.64e-10	NA	NA
5. P	Q6JWR2	Putative sodium-coupled neutral amino acid transporter 7	5.06e-10	5.83e-03	NA	NA
5. P	P0AAF1	Putrescine transporter PotE	0.00e+00	5.74e-17	NA	NA
5. P	Q63008	Sodium/iodide cotransporter	1.01e-06	5.07e-03	NA	NA
5. P	P40901	Sexual differentiation process putative amino-acid permease isp5	0.00e+00	1.07e-05	NA	NA
5. P	Q9P5N2	Amino acid transporter 1	0.00e+00	9.87e-08	NA	NA
5. P	P9WQM5	Uncharacterized transporter Rv1979c	8.61e-11	2.86e-31	NA	NA
5. P	P67445	Xanthine permease XanQ	2.43e-03	4.10e-03	NA	NA
5. P	B5BP45	Uncharacterized amino-acid permease C460.01c	0.00e+00	1.60e-07	NA	NA
5. P	Q1C0M8	Cation/acetate symporter ActP	1.22e-06	1.63e-03	NA	NA
5. P	Q8VBW1	Sodium- and chloride-dependent creatine transporter 1	6.34e-06	5.12e-03	NA	NA
5. P	P03909	NADH-ubiquinone oxidoreductase chain 4	9.79e-04	1.61e-02	NA	NA
5. P	Q9H1V8	Sodium-dependent neutral amino acid transporter SLC6A17	1.87e-05	2.50e-04	NA	NA
5. P	Q5N5W1	NAD(P)H-quinone oxidoreductase chain 4 1	3.19e-04	3.72e-02	NA	NA
5. P	P49283	Protein Malvolio	1.01e-07	5.22e-03	NA	NA
5. P	B4TRK2	Cation/acetate symporter ActP	2.09e-06	1.01e-03	NA	NA
5. P	P36029	Polyamine transporter TPO5	3.71e-13	6.11e-09	NA	NA
5. P	B1JNK6	Cation/acetate symporter ActP	6.50e-07	1.29e-03	NA	NA
5. P	D4GU68	Probable low-salt glycan biosynthesis flippase Agl15	2.32e-04	4.58e-03	NA	NA
5. P	P0A1W9	Branched-chain amino acid transport system 2 carrier protein	1.54e-08	1.64e-09	NA	NA
5. P	Q8FAZ0	Cation/acetate symporter ActP	5.75e-07	6.36e-04	NA	NA
5. P	Q10Q65	Metal transporter Nramp2	2.62e-10	1.97e-03	NA	NA
5. P	Q6R4Q5	Sodium/glucose cotransporter 5	1.53e-06	3.15e-03	NA	NA
5. P	B6I5T5	Cation/acetate symporter ActP	6.76e-07	9.81e-04	NA	NA
5. P	A4W5I3	Cation/acetate symporter ActP	1.81e-06	8.92e-04	NA	NA
5. P	P0AAD4	Tyrosine-specific transport protein	0.00e+00	8.77e-09	NA	NA
5. P	P28573	Sodium-dependent proline transporter	2.23e-06	2.08e-06	NA	NA
5. P	P28570	Sodium- and chloride-dependent creatine transporter 1	6.52e-06	6.84e-03	NA	NA
5. P	P40074	Vacuolar amino acid transporter 6	1.63e-07	2.47e-05	NA	NA
5. P	Q9ZDE9	Uncharacterized protein RP382	3.10e-04	1.37e-04	NA	NA
5. P	P9WQM7	L-asparagine permease 2	0.00e+00	6.23e-23	NA	NA
5. P	A2RNI5	Arginine/ornithine antiporter ArcD1	3.72e-10	2.07e-27	NA	NA
5. P	A6QID0	Sodium/proline symporter	6.89e-07	1.24e-04	NA	NA
5. P	O32139	Uric acid permease PucJ	9.66e-03	1.12e-03	NA	NA
5. P	Q59I64	Y+L amino acid transporter 2	3.33e-16	1.42e-20	NA	NA
5. P	P31651	Sodium- and chloride-dependent betaine transporter	2.81e-06	7.29e-07	NA	NA
5. P	A7ZUU1	Cation/acetate symporter ActP	6.97e-07	9.81e-04	NA	NA
5. P	P72823	NAD(P)H-quinone oxidoreductase chain 4-2	5.82e-04	2.88e-02	NA	NA
5. P	Q69LA1	Probable proline transporter 2	1.80e-08	4.09e-02	NA	NA
5. P	O14035	Uncharacterized permease C29B12.14c	9.23e-07	1.46e-03	NA	NA
5. P	Q1IS58	NADH-quinone oxidoreductase subunit H 1	1.07e-03	1.75e-02	NA	NA
5. P	Q8BGK6	Y+L amino acid transporter 2	1.11e-15	4.60e-09	NA	NA
5. P	Q5RKI7	Solute carrier family 7 member 13	4.97e-10	2.50e-20	NA	NA
5. P	B7M7Y0	Cation/acetate symporter ActP	1.13e-06	1.70e-03	NA	NA
5. P	Q9RPF3	Divalent metal cation transporter MntH 1	5.81e-08	2.25e-02	NA	NA
5. P	P31448	Uncharacterized symporter YidK	1.09e-06	4.68e-05	NA	NA
5. P	P43548	General amino acid permease AGP3	1.35e-11	5.12e-14	NA	NA
5. P	B3W6P3	Divalent metal cation transporter MntH	7.56e-10	2.41e-02	NA	NA
5. P	Q695T7	Sodium-dependent neutral amino acid transporter B(0)AT1	2.09e-06	1.15e-03	NA	NA
5. P	P23173	Low affinity tryptophan permease	0.00e+00	2.42e-12	NA	NA
5. P	Q9RY44	Probable multidrug resistance protein NorM	3.34e-05	3.52e-02	NA	NA
5. P	O06754	Branched-chain amino acid transport system carrier protein	1.65e-08	2.23e-10	NA	NA
5. P	B4JMC1	Sodium-dependent nutrient amino acid transporter 1	3.12e-06	5.83e-06	NA	NA
5. P	O33683	Uncharacterized protein RA0937	3.05e-04	1.77e-02	NA	NA
5. P	B5XXT7	Cation/acetate symporter ActP	9.05e-07	8.38e-04	NA	NA
5. P	Q7A4Q7	Sodium/proline symporter	1.12e-06	6.87e-05	NA	NA
5. P	P16256	Sodium/pantothenate symporter	2.48e-06	1.15e-03	NA	NA
5. P	F4HW02	GABA transporter 1	1.48e-08	2.32e-02	NA	NA
5. P	D6R8X8	Hydantoin permease	6.97e-07	3.41e-10	NA	NA
5. P	Q9C0Z0	Uncharacterized amino-acid permease PB24D3.02c	1.67e-13	1.82e-13	NA	NA
5. P	Q9NS82	Asc-type amino acid transporter 1	1.33e-15	4.64e-10	NA	NA
5. P	P0A769	Divalent metal cation transporter MntH	4.95e-10	5.84e-04	NA	NA
5. P	P82252	b(0,+)-type amino acid transporter 1	3.33e-16	7.66e-10	NA	NA
5. P	P0AAE2	Proline-specific permease ProY	0.00e+00	1.17e-21	NA	NA
5. P	B5QZ97	Cation/acetate symporter ActP	6.10e-07	6.78e-04	NA	NA
5. P	P0AA83	Cytosine permease	7.42e-08	1.50e-06	NA	NA
5. P	P25376	General amino acid permease AGP1	2.49e-11	2.78e-02	NA	NA
5. P	P41251	Natural resistance-associated macrophage protein 1	4.74e-08	5.89e-03	NA	NA
5. P	Q7N1G0	Probable multidrug resistance protein NorM	1.04e-04	1.79e-02	NA	NA
5. P	Q9H2J7	Sodium-dependent neutral amino acid transporter B(0)AT2	7.33e-06	2.77e-05	NA	NA
5. P	Q9PEL3	Divalent metal cation transporter MntH	1.17e-09	6.44e-03	NA	NA
5. P	Q92367	Amino-acid permease 1	2.64e-14	2.65e-06	NA	NA
5. P	Q9P5N4	Uncharacterized amino-acid permease C359.01	0.00e+00	5.39e-08	NA	NA
5. P	Q5U4D8	Sodium-dependent multivitamin transporter	3.15e-06	1.60e-03	NA	NA
5. P	Q05998	Thiamine transporter	7.33e-07	2.88e-03	NA	NA
5. P	Q5N892	Auxin transporter-like protein 1	2.10e-09	1.65e-02	NA	NA
5. P	P57263	NADH-quinone oxidoreductase subunit M	1.68e-03	2.80e-02	NA	NA
5. P	Q5HEM0	Sodium/proline symporter	1.27e-06	6.87e-05	NA	NA
5. P	B2TXA0	Cation/acetate symporter ActP	6.84e-07	1.25e-03	NA	NA
5. P	Q9FF99	Probable amino acid permease 7	3.11e-09	2.23e-03	NA	NA
5. P	Q688J2	Auxin transporter-like protein 2	4.26e-09	4.75e-02	NA	NA
5. P	P07117	Sodium/proline symporter	8.36e-07	1.25e-02	NA	NA
5. P	P63116	Asc-type amino acid transporter 1	2.11e-15	5.05e-10	NA	NA
5. P	P94499	Branched-chain amino acid transport system carrier protein BrnQ	3.96e-08	4.08e-09	NA	NA
5. P	O08812	Cationic amino acid transporter 3	2.27e-08	1.26e-07	NA	NA
5. P	P41815	Valine amino-acid permease	6.98e-12	3.41e-06	NA	NA
5. P	Q6DEL1	Putative sodium-coupled neutral amino acid transporter 7	7.04e-09	3.03e-03	NA	NA
5. P	B5D5N9	Cationic amino acid transporter 2	8.43e-09	3.49e-06	NA	NA
5. P	P04817	Arginine permease CAN1	6.07e-14	1.03e-05	NA	NA
5. P	Q9ZU50	Amino-acid permease BAT1	2.08e-14	1.98e-09	NA	NA
5. P	B7MSH6	Cation/acetate symporter ActP	6.59e-07	1.57e-03	NA	NA
5. P	Q8X691	Cytosine permease	7.63e-08	1.68e-06	NA	NA
5. P	P18939	NADH-ubiquinone oxidoreductase chain 4	9.61e-04	2.75e-02	NA	NA
5. P	Q7XBS0	Urea-proton symporter DUR3	1.44e-06	2.38e-02	NA	NA
5. P	O74543	Uncharacterized amino-acid permease C777.04	3.26e-12	6.67e-10	NA	NA
5. P	Q09887	Uncharacterized amino-acid permease C584.13	4.08e-11	2.02e-10	NA	NA
5. P	Q9C0V0	Probable amino-acid permease PB1C11.02	3.59e-11	2.24e-17	NA	NA
5. P	P9WQM9	L-asparagine permease 1	0.00e+00	1.15e-21	NA	NA
5. P	P48055	Sodium- and chloride-dependent betaine transporter	3.40e-06	2.27e-06	NA	NA
5. P	Q8ZJ73	Cation/acetate symporter ActP	6.61e-07	1.63e-03	NA	NA
5. P	P9WIW5	NADH-quinone oxidoreductase subunit M	7.12e-04	1.75e-02	NA	NA
5. P	Q9Y289	Sodium-dependent multivitamin transporter	4.55e-07	5.49e-03	NA	NA
5. P	Q85FU6	Protein translocase subunit SecY	6.22e-03	3.65e-02	NA	NA
5. P	P53099	Vitamin B6 transporter TPN1	1.19e-06	3.49e-05	NA	NA
5. P	P48056	Sodium- and chloride-dependent betaine transporter	4.10e-06	1.58e-06	NA	NA
5. P	P77400	Inner membrane transport protein YbaT	0.00e+00	9.26e-21	NA	NA
5. P	P0AA47	Low-affinity putrescine importer PlaP	3.91e-12	4.80e-14	NA	NA
5. P	A7Y2W8	Sodium- and chloride-dependent glycine transporter 1	1.20e-06	3.60e-03	NA	NA
5. P	Q01959	Sodium-dependent dopamine transporter	1.48e-06	7.47e-03	NA	NA
5. P	Q6NB79	Probable multidrug resistance protein NorM	1.44e-04	1.49e-02	NA	NA
5. P	Q58715	Uncharacterized sodium-dependent transporter MJ1319	5.95e-08	1.43e-17	NA	NA
5. P	B5R937	Cation/acetate symporter ActP	1.77e-06	7.38e-04	NA	NA
5. P	O55192	Sodium-dependent noradrenaline transporter	1.52e-06	5.95e-03	NA	NA
5. P	P48065	Sodium- and chloride-dependent betaine transporter	1.14e-06	3.03e-06	NA	NA
5. P	Q9LH39	Probable polyamine transporter At3g19553	0.00e+00	2.63e-14	NA	NA
5. P	A8I1B9	Sodium/myo-inositol cotransporter 2	1.49e-05	4.89e-02	NA	NA
5. P	Q6G831	Sodium/proline symporter	1.36e-06	6.87e-05	NA	NA
5. P	O76689	Sodium-dependent acetylcholine transporter	2.26e-06	1.18e-02	NA	NA
5. P	B4R4T6	Sodium-dependent nutrient amino acid transporter 1	1.32e-06	4.38e-08	NA	NA
5. P	P31649	Sodium- and chloride-dependent GABA transporter 2	3.16e-06	1.19e-04	NA	NA
5. P	Q22397	Amino acid transporter protein 6	6.66e-16	3.96e-18	NA	NA
5. P	Q84MA5	Cationic amino acid transporter 1	3.10e-10	1.24e-08	NA	NA
5. P	Q28610	Sodium/glucose cotransporter 5	3.41e-05	9.40e-04	NA	NA
5. P	Q2FIC6	Na(+)/H(+) antiporter subunit D1	2.13e-04	2.86e-02	NA	NA
5. P	C5A160	Cation/acetate symporter ActP	1.71e-06	9.81e-04	NA	NA
5. P	Q0T9Y2	Cation/acetate symporter ActP	2.34e-06	1.20e-03	NA	NA
5. P	P38085	Valine/tyrosine/tryptophan amino-acid permease 1	0.00e+00	7.02e-05	NA	NA
5. P	P27837	Probable transport protein YifK	3.22e-15	2.01e-22	NA	NA
5. P	Q9C6B2	Metal transporter Nramp2	1.19e-07	2.83e-02	NA	NA
5. P	B3NV41	Sodium-dependent nutrient amino acid transporter 1	1.37e-06	3.17e-07	NA	NA
5. P	Q9UPY5	Cystine/glutamate transporter	9.99e-16	2.76e-07	NA	NA
5. P	Q9FN18	Metal transporter Nramp4	3.35e-09	9.02e-06	NA	NA
5. P	Q9SAH8	Metal transporter Nramp1	2.06e-10	9.08e-05	NA	NA
5. P	P45174	Sodium/proline symporter	6.58e-07	4.23e-06	NA	NA
5. P	P37660	Inner membrane transport protein YhjV	1.03e-07	1.17e-07	NA	NA
5. P	Q2G2G3	Divalent metal cation transporter MntH	1.76e-08	1.13e-02	NA	NA
5. P	A6NNN8	Putative sodium-coupled neutral amino acid transporter 8	1.23e-11	1.91e-02	NA	NA
5. P	P53388	Dicarboxylic amino acid permease	3.93e-14	9.13e-09	NA	NA
5. P	B5FRF0	Cation/acetate symporter ActP	9.73e-07	6.78e-04	NA	NA
5. P	Q9XT77	Sodium-dependent multivitamin transporter	2.75e-07	9.57e-03	NA	NA
5. P	P45539	Probable fructoselysine/psicoselysine transporter FrlA	0.00e+00	4.32e-23	NA	NA
5. P	Q31HC4	Probable inorganic carbon transporter subunit DabB	3.66e-03	2.82e-03	NA	NA
5. P	E1V6C5	Trk system potassium uptake protein TrkH	2.83e-03	2.57e-02	NA	NA
5. P	Q0T0F2	Threonine/serine transporter TdcC	2.58e-09	1.54e-06	NA	NA
5. P	B4TEB2	Cation/acetate symporter ActP	1.74e-06	1.01e-03	NA	NA
5. P	Q9LZ20	Cationic amino acid transporter 6, chloroplastic	4.16e-09	2.95e-11	NA	NA
5. P	P25527	GABA permease	0.00e+00	6.89e-21	NA	NA
5. P	Q9S9N8	Metal transporter Nramp6	2.64e-10	6.21e-07	NA	NA
5. P	P23977	Sodium-dependent dopamine transporter	1.21e-06	7.85e-03	NA	NA
5. P	B4MEG2	Sodium-dependent nutrient amino acid transporter 1	9.77e-07	4.49e-07	NA	NA
5. P	Q7T384	Sodium-coupled monocarboxylate transporter 2	3.17e-06	1.26e-02	NA	NA
5. P	A0A1D8PPG4	Probable lysine/arginine permease CAN3	1.75e-11	3.23e-14	NA	NA
5. P	Q5SJ79	Cytochrome c oxidase subunit 1	2.06e-04	2.86e-02	NA	NA
5. P	Q3YUR7	Cation/acetate symporter ActP	1.71e-06	2.70e-03	NA	NA
5. P	Q9SHH0	Cationic amino acid transporter 8, vacuolar	1.70e-08	4.13e-09	NA	NA
5. P	P94392	High-affinity proline transporter PutP	2.09e-06	2.08e-06	NA	NA
5. P	A7MBD8	Sodium-coupled monocarboxylate transporter 2	7.78e-07	1.15e-03	NA	NA
5. P	A4TS08	Cation/acetate symporter ActP	9.63e-07	1.63e-03	NA	NA
5. P	Q9Z127	Large neutral amino acids transporter small subunit 1	1.33e-15	7.83e-08	NA	NA
5. P	Q10087	Uncharacterized amino-acid permease C11D3.08c	1.58e-13	3.55e-16	NA	NA
5. P	P65544	Divalent metal cation transporter MntH	3.94e-12	1.87e-03	NA	NA
5. P	Q0D7E4	Metal transporter Nramp1	9.85e-07	1.30e-06	NA	NA
5. P	A8AN31	Cation/acetate symporter ActP	1.54e-06	4.93e-04	NA	NA
5. P	Q1R3J9	Cation/acetate symporter ActP	6.09e-07	1.57e-03	NA	NA
5. P	Q9C6M2	Lysine histidine transporter-like 6	1.20e-07	4.89e-02	NA	NA
5. P	B7UPN5	Cation/acetate symporter ActP	8.49e-07	1.57e-03	NA	NA
5. P	B5Z1C8	Cation/acetate symporter ActP	1.65e-06	7.15e-04	NA	NA
5. P	Q57GV4	Cation/acetate symporter ActP	7.54e-07	9.21e-04	NA	NA
5. P	G5EBN9	Sodium- and chloride-dependent betaine transporter	1.43e-06	3.89e-06	NA	NA
5. P	O59831	Uncharacterized amino-acid permease C965.11c	0.00e+00	1.08e-15	NA	NA
5. P	Q653V6	Metal transporter Nramp3	2.48e-10	9.91e-07	NA	NA
5. P	C0Q552	Cation/acetate symporter ActP	1.17e-06	1.00e-03	NA	NA
5. P	Q5HN32	Sodium/proline symporter	1.28e-06	4.18e-05	NA	NA
5. P	B1XJL9	NAD(P)H-quinone oxidoreductase chain 4 3	3.61e-04	9.85e-03	NA	NA
5. P	Q9QXW9	Large neutral amino acids transporter small subunit 2	1.67e-15	3.66e-13	NA	NA
5. P	O94469	Probable urea active transporter 1	2.08e-06	1.26e-02	NA	NA
5. P	Q7XGU4	Auxin transporter-like protein 3	3.36e-12	1.79e-02	NA	NA
5. P	O34745	Uncharacterized symporter YodF	3.36e-07	1.03e-04	NA	NA
5. P	Q4A070	Sodium/proline symporter 1	1.84e-06	2.97e-04	NA	NA
5. P	A8Z2R6	Sodium/proline symporter	1.41e-06	8.31e-05	NA	NA
5. P	B4T1W9	Cation/acetate symporter ActP	2.48e-06	9.70e-04	NA	NA
5. P	Q5HPD5	Putative branched-chain amino acid carrier protein SERP0977	1.75e-08	2.85e-12	NA	NA
5. P	P39277	L-methionine/branched-chain amino acid exporter YjeH	1.96e-09	4.20e-13	NA	NA
5. P	Q2A865	Sodium-dependent neutral amino acid transporter B(0)AT1	1.56e-06	6.87e-05	NA	NA
5. P	Q96N87	Inactive sodium-dependent neutral amino acid transporter B(0)AT3	1.07e-06	3.82e-03	NA	NA
5. P	A0A1D8PPI5	Lysine/arginine permease CAN1	2.17e-11	4.15e-12	NA	NA
5. P	B9EXZ6	Amino-acid permease BAT1 homolog	2.43e-14	4.77e-11	NA	NA
5. P	Q49B93	Sodium-coupled monocarboxylate transporter 2	2.82e-06	1.80e-04	NA	NA
5. P	Q5SWY8	Sodium/glucose cotransporter 5	2.74e-06	1.56e-02	NA	NA
5. P	P0AAE5	Putative arginine/ornithine antiporter	1.33e-15	9.69e-22	NA	NA
5. P	Q49YU6	Sodium/proline symporter 2	1.85e-06	4.90e-05	NA	NA
5. P	B7MJT5	Cation/acetate symporter ActP	1.70e-06	1.57e-03	NA	NA
5. P	Q9SF09	Amino acid transporter ANT1	2.42e-09	6.90e-03	NA	NA
5. P	A9N1R2	Cation/acetate symporter ActP	1.67e-06	1.01e-03	NA	NA
5. P	Q8TFG0	Probable urea active transporter 2	1.41e-07	6.50e-03	NA	NA
5. P	P75712	Putative allantoin permease	9.59e-08	1.07e-10	NA	NA
5. P	Q5FY69	Sodium/glucose cotransporter 5	2.43e-06	5.60e-03	NA	NA
5. P	Q21434	NRAMP-like transporter smf-1	3.64e-08	4.79e-05	NA	NA
5. P	P38734	Low-affinity methionine permease	3.34e-10	3.20e-08	NA	NA
5. P	P96169	Sodium/glucose cotransporter	4.88e-06	8.88e-05	NA	NA
5. P	A8KBL5	Putative sodium-coupled neutral amino acid transporter 11	3.21e-11	4.82e-04	NA	NA
5. P	P9WP46	Peptide transporter CstA	5.34e-07	1.25e-05	NA	NA
5. P	Q12078	Iron transporter SMF3	1.11e-16	1.88e-09	NA	NA
5. P	Q5R6J1	Sodium-dependent neutral amino acid transporter B(0)AT1	1.36e-06	2.88e-03	NA	NA
5. P	Q9HDV2	Uncharacterized amino-acid permease PB2B2.01	6.11e-12	2.62e-07	NA	NA
5. P	A8DQI9	NADH-ubiquinone oxidoreductase chain 4	7.37e-04	4.49e-02	NA	NA
5. P	B1XCV3	Cation/acetate symporter ActP	8.09e-07	9.81e-04	NA	NA
5. P	Q8BGY9	High affinity choline transporter 1	3.00e-06	1.38e-06	NA	NA
5. P	Q9URZ3	Probable proline-specific permease put4	1.92e-11	2.81e-12	NA	NA
5. P	O07556	Uncharacterized symporter YhjB	2.67e-08	4.48e-05	NA	NA
5. P	Q9JMD7	High affinity choline transporter 1	3.46e-06	1.64e-06	NA	NA
5. P	Q63016	Large neutral amino acids transporter small subunit 1	7.77e-16	4.96e-07	NA	NA
5. P	P83740	Putative sodium-dependent multivitamin transporter	6.38e-07	1.03e-04	NA	NA
5. P	Q5QN13	Metal transporter Nramp4	7.94e-08	5.91e-04	NA	NA
5. P	Q58596	Putative amino-acid transporter MJ1196	0.00e+00	2.75e-09	NA	NA
5. P	A7X430	Sodium/proline symporter	1.15e-06	6.87e-05	NA	NA
5. P	P50974	NADH-quinone oxidoreductase subunit M	5.92e-04	2.32e-02	NA	NA
5. P	Q83P94	Cation/acetate symporter ActP	6.52e-07	3.18e-03	NA	NA
5. P	P63235	Glutamate/gamma-aminobutyrate antiporter	3.55e-15	8.89e-25	NA	NA
5. P	Q8BG16	Sodium-dependent neutral amino acid transporter B(0)AT2	8.16e-06	3.31e-04	NA	NA
5. P	B1IUI4	Cation/acetate symporter ActP	8.87e-07	9.81e-04	NA	NA
5. P	P76037	Putrescine importer PuuP	4.25e-14	1.68e-12	NA	NA
5. P	P0AD99	Branched-chain amino acid transport system 2 carrier protein	1.51e-08	3.86e-09	NA	NA
5. P	B7IE18	Lipid II flippase MurJ	2.32e-04	5.83e-03	NA	NA
5. P	A6U307	Sodium/proline symporter	1.24e-06	6.87e-05	NA	NA
5. P	Q1EHB4	Sodium-coupled monocarboxylate transporter 2	6.28e-07	6.16e-04	NA	NA
5. P	Q9UT18	Thiamine transporter thi9	2.83e-10	8.03e-05	NA	NA
5. P	P23975	Sodium-dependent noradrenaline transporter	1.45e-06	8.46e-04	NA	NA
5. P	Q95XG8	NRAMP-like transporter smf-3	7.64e-09	1.22e-02	NA	NA
5. P	P18581	Cationic amino acid transporter 2	4.04e-08	9.45e-06	NA	NA
5. P	P31650	Sodium- and chloride-dependent GABA transporter 3	4.47e-06	8.78e-05	NA	NA
5. P	Q9D687	Sodium-dependent neutral amino acid transporter B(0)AT1	1.59e-06	5.14e-04	NA	NA
5. P	Q8BJI1	Sodium-dependent neutral amino acid transporter SLC6A17	1.26e-05	3.24e-04	NA	NA
5. P	P37555	Uncharacterized membrane protein YabM	4.86e-05	1.13e-02	NA	NA
5. P	O03173	NADH-ubiquinone oxidoreductase chain 4	NA	2.62e-02	NA	NA
5. P	A0PJK1	Sodium/glucose cotransporter 5	2.52e-06	7.85e-03	NA	NA
5. P	Q6GFF5	Sodium/proline symporter	1.25e-06	7.60e-05	NA	NA
5. P	Q8H4H5	Metal transporter Nramp5	4.10e-10	8.11e-06	NA	NA
5. P	Q58467	Uncharacterized membrane protein MJ1068	4.32e-04	2.93e-03	NA	NA
5. P	P32837	GABA-specific permease	7.44e-09	1.76e-06	NA	NA
5. P	P33413	Urea active transporter	8.04e-07	1.31e-02	NA	NA
5. P	Q9WTR6	Cystine/glutamate transporter	5.79e-13	4.02e-09	NA	NA
5. P	Q9C6S5	Probable polyamine transporter At1g31830	0.00e+00	1.24e-07	NA	NA
5. P	P48029	Sodium- and chloride-dependent creatine transporter 1	6.93e-06	8.09e-03	NA	NA
5. P	A7FNG3	Cation/acetate symporter ActP	7.01e-07	1.21e-03	NA	NA
5. P	P39618	Putative purine permease YwdJ	2.08e-04	2.12e-02	NA	NA
5. P	P10502	Sodium/proline symporter	7.17e-07	4.40e-03	NA	NA
5. P	P58229	Glutamate/gamma-aminobutyrate antiporter	0.00e+00	1.75e-24	NA	NA
5. P	P30825	High affinity cationic amino acid transporter 1	2.55e-08	5.76e-07	NA	NA
5. P	Q9ZK47	Peptide transporter CstA	3.28e-07	2.72e-06	NA	NA
5. P	P38967	Tryptophan permease	0.00e+00	4.68e-12	NA	NA
5. P	Q7K4Y6	Sodium-dependent dopamine transporter	1.05e-07	7.33e-03	NA	NA
5. P	Q8CNP2	Sodium/proline symporter	1.44e-06	8.31e-05	NA	NA
5. P	P06775	Histidine permease	2.01e-14	1.08e-07	NA	NA
5. P	Q9URY6	Probable urea active transporter 3	1.05e-06	1.02e-03	NA	NA
5. P	Q9LFE3	Amino acid transporter AVT1H	9.72e-13	3.39e-02	NA	NA
5. P	Q9P6J5	Uncharacterized permease C1683.05	3.84e-07	2.07e-03	NA	NA
5. P	Q08AI6	Putative sodium-coupled neutral amino acid transporter 11	2.29e-08	5.89e-03	NA	NA
5. P	P38778	Manganese transporter SMF2	4.36e-08	2.59e-07	NA	NA
5. P	Q47825	Tyrosine permease	0.00e+00	1.47e-12	NA	NA
5. P	P82251	b(0,+)-type amino acid transporter 1	2.22e-16	2.05e-12	NA	NA
5. P	Q91502	Creatine transporter	2.68e-06	1.41e-05	NA	NA
5. P	Q8BWH0	Putative sodium-coupled neutral amino acid transporter 7	5.15e-09	9.29e-03	NA	NA
5. P	Q5R9F5	Putative sodium-coupled neutral amino acid transporter 7	4.36e-10	4.82e-03	NA	NA
5. P	P60061	Arginine/agmatine antiporter	0.00e+00	4.16e-23	NA	NA
5. P	P32487	Lysine-specific permease	2.27e-13	8.74e-04	NA	NA
5. P	Q59WU0	Probable lysine/arginine permease CAN2	1.60e-11	3.17e-12	NA	NA
5. P	Q03DK0	Divalent metal cation transporter MntH	1.02e-08	6.31e-03	NA	NA
5. P	O43246	Cationic amino acid transporter 4	9.16e-08	3.54e-07	NA	NA
5. P	Q9URZ4	Cationic amino acid transporter 1	0.00e+00	1.35e-06	NA	NA
5. P	Q9NVC3	Putative sodium-coupled neutral amino acid transporter 7	4.61e-09	4.18e-03	NA	NA
5. P	P29925	NADH-quinone oxidoreductase chain 13	4.53e-04	4.84e-02	NA	NA
5. P	Q9UN76	Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)	1.06e-06	6.85e-04	NA	NA
5. P	B7LB16	Cation/acetate symporter ActP	1.72e-06	9.81e-04	NA	NA
5. P	Q62687	Sodium-dependent neutral amino acid transporter B(0)AT3	1.95e-06	5.83e-03	NA	NA
5. P	P32705	Cation/acetate symporter ActP	1.81e-06	9.81e-04	NA	NA
5. P	O70247	Sodium-dependent multivitamin transporter	8.89e-07	3.60e-03	NA	NA
5. P	B4L7U0	Sodium-dependent nutrient amino acid transporter 1	1.14e-06	2.90e-05	NA	NA
5. P	B5BJZ5	Cation/acetate symporter ActP	1.73e-06	1.01e-03	NA	NA
5. P	P30145	Sodium/proton-dependent alanine carrier protein	5.68e-06	3.18e-06	NA	NA
5. P	Q17598	Transmembrane protein 104 homolog	1.29e-10	3.07e-04	NA	NA
5. P	P49279	Natural resistance-associated macrophage protein 1	1.42e-07	5.49e-03	NA	NA
5. P	Q8XSF6	Divalent metal cation transporter MntH	6.75e-10	6.13e-03	NA	NA
5. P	Q8X5T7	Cation/acetate symporter ActP	1.70e-06	7.15e-04	NA	NA
5. P	D4GYG8	Probable flippase AglR	1.41e-04	2.23e-02	NA	NA
5. P	C6D930	Cation/acetate symporter ActP	6.18e-07	4.06e-04	NA	NA
5. P	O34545	Branched-chain amino acid transport system carrier protein BraB	1.93e-08	1.31e-08	NA	NA
5. P	Q0WQJ3	Amino acid transporter AVT6D	1.69e-09	2.72e-02	NA	NA
5. P	Q9SNV9	Metal transporter Nramp3	4.54e-09	5.55e-05	NA	NA
5. P	Q6D913	Cation/acetate symporter ActP	6.12e-07	2.24e-04	NA	NA
5. P	G5EBM5	Sodium-dependent transporter snf-5	8.18e-06	2.32e-02	NA	NA
5. P	Q7A0H2	Sodium/proline symporter	1.19e-06	6.87e-05	NA	NA
5. P	P30823	High affinity cationic amino acid transporter 1	5.27e-09	1.96e-07	NA	NA
5. P	P19807	Choline transport protein	1.65e-14	7.14e-11	NA	NA
5. P	Q9UHI5	Large neutral amino acids transporter small subunit 2	1.67e-15	1.79e-13	NA	NA
5. P	Q2FYM4	Putative branched-chain amino acid carrier protein SAOUHSC_01411	2.28e-08	9.83e-12	NA	NA
5. P	Q08485	Nicotinamide riboside transporter 1	2.94e-06	9.08e-05	NA	NA
5. P	O05229	Na(+)/H(+) antiporter subunit D	4.10e-04	1.27e-02	NA	NA
5. P	Q9ASS7	Cationic amino acid transporter 2, vacuolar	3.11e-08	4.23e-06	NA	NA
5. P	Q2PG55	Sodium- and chloride-dependent GABA transporter 2	4.02e-06	2.50e-06	NA	NA
5. P	Q31TS7	Cation/acetate symporter ActP	6.23e-07	8.38e-04	NA	NA
5. P	Q9JMA9	Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)	2.05e-07	4.77e-04	NA	NA
5. P	A8DQK9	NADH-ubiquinone oxidoreductase chain 4	8.26e-04	4.84e-02	NA	NA
5. P	P42590	Inner membrane transporter YgjI	9.03e-13	2.11e-27	NA	NA
5. P	P28572	Sodium- and chloride-dependent glycine transporter 1	4.52e-06	6.71e-04	NA	NA
5. P	O32140	Uric acid permease PucK	1.04e-03	3.87e-02	NA	NA
5. P	P15993	Aromatic amino acid transport protein AroP	0.00e+00	4.17e-21	NA	NA
5. P	P38176	Vacuolar amino acid transporter 5	8.97e-08	2.02e-08	NA	NA
5. P	O59813	Uncharacterized amino-acid permease C794.03	1.02e-14	9.65e-11	NA	NA
5. P	Q08986	S-adenosylmethionine permease SAM3	6.18e-14	6.99e-09	NA	NA
5. P	O60113	Uncharacterized amino-acid permease C15C4.04c	0.00e+00	6.29e-08	NA	NA
5. P	O80592	Amino acid permease 8	6.32e-08	2.57e-03	NA	NA
5. P	Q4L7L6	Sodium/proline symporter	1.82e-06	6.14e-05	NA	NA
5. P	Q9NSD5	Sodium- and chloride-dependent GABA transporter 2	3.86e-06	1.37e-05	NA	NA
5. P	Q59WB3	S-adenosylmethionine permease GAP4	1.68e-11	2.68e-03	NA	NA
5. P	O88576	Sodium-dependent neutral amino acid transporter B(0)AT3	1.77e-06	3.49e-03	NA	NA
5. P	P31662	Sodium-dependent neutral amino acid transporter SLC6A17	1.11e-05	4.67e-04	NA	NA
5. P	Q8BLQ7	Cationic amino acid transporter 4	4.63e-08	1.99e-06	NA	NA
5. P	Q12372	S-methylmethionine permease 1	7.86e-14	8.54e-09	NA	NA
5. P	Q08469	Sodium-dependent neutral amino acid transporter B(0)AT2	8.77e-06	1.88e-04	NA	NA
5. P	P31643	Sodium- and chloride-dependent taurine transporter	5.77e-07	4.82e-04	NA	NA
5. P	B5XVZ7	Threonine/serine transporter TdcC	1.51e-09	1.18e-07	NA	NA
5. P	Q9SQZ0	Cationic amino acid transporter 7, chloroplastic	5.19e-09	1.28e-12	NA	NA
5. P	Q92536	Y+L amino acid transporter 2	0.00e+00	5.72e-10	NA	NA
5. P	B7NG10	Cation/acetate symporter ActP	1.73e-06	1.04e-03	NA	NA
5. P	Q2FWY7	Sodium/proline symporter	1.20e-06	6.87e-05	NA	NA
5. P	O06493	Osmoregulated proline transporter OpuE	6.52e-07	9.39e-05	NA	NA
5. P	F4KBM7	Amino acid transporter AVT6B	1.38e-08	3.83e-02	NA	NA
5. P	P0A1W8	Branched-chain amino acid transport system 2 carrier protein	1.61e-08	1.64e-09	NA	NA
5. P	Q9Z1K8	Y+L amino acid transporter 1	1.89e-15	1.33e-09	NA	NA
5. P	P40501	Vacuolar amino acid transporter 7	4.86e-08	1.07e-02	NA	NA
5. P	Q9UM01	Y+L amino acid transporter 1	2.22e-15	2.86e-13	NA	NA
5. P	Q53584	Sodium/proline symporter	1.07e-06	6.64e-04	NA	NA
5. P	Q8L4X4	Probable GABA transporter 2	1.39e-08	4.84e-02	NA	NA
5. P	P41308	NADH-ubiquinone oxidoreductase chain 4	5.47e-04	3.82e-03	NA	NA
5. P	Q8TCU3	Solute carrier family 7 member 13	4.66e-10	3.56e-23	NA	NA
5. P	Q2YU74	Sodium/proline symporter	1.29e-06	1.73e-05	NA	NA
5. P	Q31NA0	NAD(P)H-quinone oxidoreductase chain 4 1	3.04e-04	3.72e-02	NA	NA
5. P	P42086	Xanthine permease	2.52e-04	9.66e-03	NA	NA
5. P	Q3ZMH1	Sodium-coupled monocarboxylate transporter 1	1.88e-07	5.12e-03	NA	NA
5. P	P38925	Manganese transporter SMF1	3.29e-06	4.92e-03	NA	NA
5. P	Q8HXI3	Putative sodium-coupled neutral amino acid transporter 11	8.42e-08	1.23e-02	NA	NA
5. P	A1JIK1	Cation/acetate symporter ActP	6.63e-07	5.91e-04	NA	NA
5. P	Q9R0S5	Y+L amino acid transporter 1	3.55e-15	4.93e-09	NA	NA
5. P	P70423	Cationic amino acid transporter 3	1.98e-08	5.37e-06	NA	NA
5. P	B7NJY3	Threonine/serine transporter TdcC	1.35e-09	1.36e-06	NA	NA
5. P	P0AAE8	Probable cadaverine/lysine antiporter	6.14e-12	2.13e-24	NA	NA
5. P	P38090	General amino acid permease AGP2	6.75e-09	1.58e-05	NA	NA
5. P	Q99SY5	Sodium/proline symporter	1.36e-06	6.87e-05	NA	NA
5. P	A0A1D8PK89	General amino-acid permease GAP2	9.19e-12	1.52e-07	NA	NA
5. P	Q8WY07	Cationic amino acid transporter 3	2.20e-08	5.67e-08	NA	NA
5. P	O88575	Sodium- and chloride-dependent transporter XTRP3B	1.55e-06	2.67e-02	NA	NA
5. P	Q4L6B4	Putative branched-chain amino acid carrier protein SH1502	4.30e-11	4.41e-12	NA	NA
5. P	Q0P9Y2	Peptide transporter CstA	4.49e-07	2.97e-04	NA	NA
5. P	B1LPN2	Cation/acetate symporter ActP	2.22e-06	1.20e-03	NA	NA
5. P	Q869V1	Metal transporter nramp1 homolog	1.76e-08	1.94e-04	NA	NA
5. P	Q10177	Manganese transporter pdt1	2.27e-07	4.82e-03	NA	NA
5. P	O30417	Glutamate/gamma-aminobutyrate antiporter	0.00e+00	9.63e-25	NA	NA
5. P	Q9LYM2	Amino acid transporter AVT6C	0.00e+00	8.38e-04	NA	NA
5. P	A5IU69	Sodium/proline symporter	1.29e-06	6.87e-05	NA	NA
5. P	A8A7G7	Cation/acetate symporter ActP	1.83e-06	1.70e-03	NA	NA
5. P	A8A4S9	Threonine/serine transporter TdcC	3.86e-09	1.36e-06	NA	NA
5. P	P0AAD8	Threonine/serine transporter TdcC	2.92e-09	1.36e-06	NA	NA
5. P	Q9WVR6	Large neutral amino acids transporter small subunit 2	1.78e-15	1.10e-12	NA	NA
5. P	P0AAE0	D-serine/D-alanine/glycine transporter	0.00e+00	1.39e-16	NA	NA
5. P	P25737	Lysine-specific permease	0.00e+00	6.40e-21	NA	NA
5. P	Q00758	Stage V sporulation protein B	3.57e-04	8.20e-04	NA	NA
5. P	Q01650	Large neutral amino acids transporter small subunit 1	8.88e-16	2.06e-07	NA	NA
5. P	Q6PGE7	Sodium-dependent proline transporter	2.03e-06	1.19e-06	NA	NA
5. P	P50276	High-affinity methionine permease	0.00e+00	8.73e-12	NA	NA
5. P	B4PZQ4	Sodium-dependent nutrient amino acid transporter 1	1.49e-06	1.05e-06	NA	NA
5. P	Q6ZG85	Metal transporter NRAT1	1.48e-07	3.74e-08	NA	NA
5. P	O35316	Sodium- and chloride-dependent taurine transporter	7.32e-07	3.89e-04	NA	NA
5. P	P67446	Xanthine permease XanQ	7.42e-04	4.10e-03	NA	NA
5. P	A0A1D8PN88	Amino-acid permease GAP3	2.51e-14	4.38e-06	NA	NA
5. P	O87394	Uncharacterized transporter R00093	2.44e-15	1.95e-15	NA	NA
5. P	Q64093	Sodium- and chloride-dependent transporter XTRP3	1.56e-06	1.42e-02	NA	NA
5. P	Q5HZH7	Putative sodium-coupled neutral amino acid transporter 8	7.90e-12	1.40e-03	NA	NA
5. P	Q03614	Sodium-dependent dopamine transporter	3.89e-07	4.09e-02	NA	NA
5. P	B7NSM7	Cation/acetate symporter ActP	1.77e-06	1.20e-03	NA	NA
5. P	B2VKE4	Cation/acetate symporter ActP	7.47e-07	2.73e-03	NA	NA
5. P	Q47689	Probable S-methylmethionine permease	6.22e-15	7.41e-23	NA	NA
5. P	A2RJ04	Branched-chain amino acid transport system carrier protein	2.56e-10	1.32e-11	NA	NA
5. P	P63115	Asc-type amino acid transporter 1	2.22e-15	5.05e-10	NA	NA
5. P	Q8FDC3	Threonine/serine transporter TdcC	2.61e-09	1.66e-06	NA	NA
5. P	P39396	Pyruvate/proton symporter BtsT	1.04e-06	1.82e-04	NA	NA
5. P	Q2YUH6	Potassium-transporting ATPase potassium-binding subunit	7.25e-04	4.75e-02	NA	NA
5. P	Q2UPA8	Transporter aclS	6.71e-06	3.49e-03	NA	NA
5. P	Q46821	Uric acid transporter UacT	1.66e-03	1.46e-02	NA	NA
5. P	Q9C5D6	Cationic amino acid transporter 9, chloroplastic	1.86e-09	7.42e-12	NA	NA
5. P	Q08579	Thiamine transporter THI72	3.98e-06	8.29e-04	NA	NA
5. P	P9WQM3	Uncharacterized transporter Rv1999c	3.77e-15	7.64e-12	NA	NA
5. P	A1AIQ8	Cation/acetate symporter ActP	2.76e-06	1.57e-03	NA	NA
5. P	P38084	Leu/Val/Ile amino-acid permease	1.19e-14	4.82e-06	NA	NA
5. P	Q9QXA6	b(0,+)-type amino acid transporter 1	3.33e-16	9.97e-10	NA	NA
5. P	P77610	L-asparagine permease	0.00e+00	1.20e-18	NA	NA
5. P	Q5PJ05	Cation/acetate symporter ActP	1.74e-06	1.01e-03	NA	NA
5. P	Q8P8R8	Divalent metal cation transporter MntH	8.96e-10	4.41e-02	NA	NA
5. P	Q9LHN7	Probable polyamine transporter At3g13620	0.00e+00	2.02e-11	NA	NA
5. P	P31641	Sodium- and chloride-dependent taurine transporter	6.10e-07	9.18e-05	NA	NA
5. P	Q9W4C5	Sodium-dependent nutrient amino acid transporter 1	1.21e-06	2.43e-08	NA	NA
5. P	P0AAD6	Serine transporter SdaC	6.96e-10	7.77e-05	NA	NA
5. P	O64759	Cationic amino acid transporter 5	2.52e-09	1.80e-08	NA	NA
5. P	P53744	7-keto 8-aminopelargonic acid transporter	2.22e-08	1.02e-08	NA	NA
5. P	P38971	Basic amino-acid permease	0.00e+00	1.51e-09	NA	NA
5. P	Q39134	Amino acid permease 3	1.52e-07	1.27e-02	NA	NA
5. P	P24207	Phenylalanine-specific permease	0.00e+00	4.01e-13	NA	NA
5. P	A6TGZ7	Cation/acetate symporter ActP	1.84e-06	8.38e-04	NA	NA
5. P	P9WIW4	NADH-quinone oxidoreductase subunit M	7.83e-04	1.75e-02	NA	NA
5. P	Q91WN3	Solute carrier family 7 member 13	1.33e-15	2.37e-23	NA	NA
5. P	P39282	Inner membrane transporter YjeM	0.00e+00	2.35e-26	NA	NA
5. P	Q9US40	Uncharacterized amino-acid permease C1039.01	0.00e+00	4.77e-11	NA	NA
5. P	O60170	Probable amino-acid permease meu22	0.00e+00	3.61e-09	NA	NA
5. P	Q09143	High affinity cationic amino acid transporter 1	5.54e-09	3.09e-07	NA	NA
5. P	Q8NS49	Monocarboxylic acid transporter	2.72e-07	1.76e-03	NA	NA
5. P	O02228	High-affinity choline transporter 1	3.79e-06	9.18e-05	NA	NA
5. P	Q8GYB4	Cationic amino acid transporter 3, mitochondrial	2.44e-09	3.56e-09	NA	NA
5. P	A0A1D8PMB1	Amino-acid permease GAP5	2.11e-11	1.57e-02	NA	NA
5. P	Q5AG77	Amino-acid permease GAP1	9.44e-10	2.77e-08	NA	NA
5. P	Q58026	Uncharacterized protein MJ0609	0.00e+00	6.76e-21	NA	NA
5. P	P42628	Probable serine transporter	3.00e-11	1.78e-06	NA	NA
5. P	Q5PR34	Cationic amino acid transporter 2	7.79e-09	3.42e-08	NA	NA
5. P	Q2FFJ3	Sodium/proline symporter	1.12e-06	8.31e-05	NA	NA
5. P	O34674	Lipid II flippase MurJ	4.22e-05	3.26e-02	NA	NA
5. P	Q9C6S4	Probable polyamine transporter At1g31820	7.58e-12	4.71e-10	NA	NA
5. P	B4T6B2	Threonine/serine transporter TdcC	1.50e-09	9.79e-07	NA	NA
5. P	O18875	Sodium- and chloride-dependent creatine transporter 1	7.17e-06	3.94e-03	NA	NA
5. P	Q99PN0	Sodium/iodide cotransporter	1.67e-07	2.76e-03	NA	NA
5. P	Q9P768	Uncharacterized amino-acid permease P7G5.06	5.50e-14	1.13e-04	NA	NA
5. P	A0A6L8Q027	Probable inorganic carbon transporter subunit DabB	8.61e-04	7.47e-03	NA	NA
5. P	P0AAD2	Tryptophan-specific transport protein	0.00e+00	4.64e-10	NA	NA
5. P	P75835	Inner membrane transporter YcaM	0.00e+00	4.00e-26	NA	NA
5. P	P63340	Inner membrane transport protein YqeG	1.71e-11	2.72e-07	NA	NA
5. P	Q61327	Sodium-dependent dopamine transporter	1.29e-06	9.95e-03	NA	NA
5. P	P0AA82	Cytosine permease	7.79e-08	1.50e-06	NA	NA
5. P	B3MRS1	Sodium-dependent nutrient amino acid transporter 1	2.03e-06	2.62e-07	NA	NA
5. P	P9WP47	Peptide transporter CstA	7.66e-07	1.45e-04	NA	NA
5. P	P48066	Sodium- and chloride-dependent GABA transporter 3	1.63e-06	5.60e-04	NA	NA
5. P	Q66FN0	Cation/acetate symporter ActP	7.36e-07	1.29e-03	NA	NA
5. P	Q55179	Probable lipid II flippase MurJ	2.76e-04	6.77e-03	NA	NA
5. P	O74327	Vacuolar amino acid transporter 5	1.69e-10	1.10e-03	NA	NA
5. P	Q9ZZY2	NADH-ubiquinone oxidoreductase chain 4	1.05e-03	4.84e-02	NA	NA
5. P	P67444	Xanthine permease XanQ	6.96e-04	4.10e-03	NA	NA
5. P	Q05217	Protein translocase subunit SecY	2.94e-04	3.94e-02	NA	NA
5. P	P52569	Cationic amino acid transporter 2	3.45e-08	1.94e-06	NA	NA
5. P	Q1M7A2	Monocarboxylate transport permease protein	1.55e-07	2.62e-05	NA	NA
5. P	Q9GZV3	High affinity choline transporter 1	1.43e-05	1.12e-06	NA	NA
5. P	P34479	Probable amino acid transporter skat-1	2.04e-09	5.60e-04	NA	NA
5. P	Q8ZSB0	Divalent metal cation transporter MntH	3.23e-10	9.85e-03	NA	NA
5. P	P15078	Peptide transporter CstA	1.88e-07	1.40e-06	NA	NA
5. P	P45320	Uncharacterized sodium-dependent transporter HI_1690	5.55e-07	2.09e-07	NA	NA
5. P	O74537	Uncharacterized amino-acid permease C74.04	0.00e+00	2.14e-14	NA	NA
5. P	P31647	Sodium- and chloride-dependent GABA transporter 3	5.10e-06	9.93e-05	NA	NA
5. P	O67658	Probable lipid II flippase MurJ	1.12e-04	1.59e-02	NA	NA
5. P	P19145	General amino-acid permease GAP1	1.27e-11	7.04e-06	NA	NA
5. P	Q10279	Uracil permease	2.32e-06	4.29e-04	NA	NA
5. P	Q8QL47	Uncharacterized protein 399	NA	6.25e-16	NA	NA
5. P	Q5R9C2	Sodium-dependent neutral amino acid transporter B(0)AT2	7.10e-06	8.68e-05	NA	NA
5. P	Q9MZ34	Sodium- and chloride-dependent taurine transporter	7.37e-07	7.86e-04	NA	NA
5. P	P56190	Peptide transporter CstA	2.64e-07	6.11e-06	NA	NA
5. P	A8Z056	Na(+)/H(+) antiporter subunit D1	2.39e-04	2.86e-02	NA	NA
5. P	Q99884	Sodium-dependent proline transporter	2.24e-06	9.45e-06	NA	NA
5. P	Q8DHX4	NAD(P)H-quinone oxidoreductase chain 4 2	2.58e-04	2.97e-02	NA	NA
5. P	A0A2A5JY22	Nucleobase transporter PlUacP	7.52e-05	1.12e-02	NA	NA
6. F	Q6DIV6	Vesicular inhibitory amino acid transporter	2.22e-16	NA	NA	0.5785
6. F	B4TAY9	Low affinity potassium transport system protein kup	6.18e-07	NA	NA	0.5112
6. F	C4ZZ25	Low affinity potassium transport system protein kup	1.77e-07	NA	NA	0.525
6. F	Q04CF3	Probable potassium transport system protein kup	1.53e-06	NA	NA	0.5284
6. F	Q93LK8	Spore germination protein GerQB	0.00e+00	NA	NA	0.7067
6. F	B4TN48	Low affinity potassium transport system protein kup	1.09e-06	NA	NA	0.5168
6. F	Q5XH90	Sodium-coupled neutral amino acid transporter 2	3.55e-10	NA	NA	0.5473
6. F	A5V804	Probable potassium transport system protein kup 2	7.82e-07	NA	NA	0.5131
6. F	A4WGE0	Low affinity potassium transport system protein kup	7.33e-07	NA	NA	0.4571
6. F	Q5NN77	Probable potassium transport system protein kup	2.36e-07	NA	NA	0.5094
6. F	Q88SV0	Probable potassium transport system protein kup 2	3.28e-07	NA	NA	0.5094
6. F	Q1MKT5	Probable potassium transport system protein kup 1	2.69e-07	NA	NA	0.5293
6. F	Q5X3H2	Probable potassium transport system protein kup 2	7.03e-07	NA	NA	0.4745
6. F	A2S2B6	Probable potassium transport system protein kup	2.02e-07	NA	NA	0.4544
6. F	Q8PHV1	Probable potassium transport system protein kup	3.45e-07	NA	NA	0.4915
6. F	B7UY17	Probable potassium transport system protein kup	2.27e-06	NA	NA	0.5339
6. F	A1VTR7	Probable potassium transport system protein kup	5.26e-07	NA	NA	0.5193
6. F	Q8XAW9	Low affinity potassium transport system protein kup	7.75e-07	NA	NA	0.4997
6. F	Q2SWD1	Probable potassium transport system protein kup	1.93e-07	NA	NA	0.4277
6. F	B8DE85	Divalent metal cation transporter MntH	5.58e-10	NA	NA	0.4974
6. F	B7LK92	Low affinity potassium transport system protein kup	7.67e-07	NA	NA	0.5193
6. F	Q5E5M9	Glutamine transporter 2	0.00e+00	NA	NA	0.6765
6. F	Q8FZT8	Probable potassium transport system protein kup	4.82e-07	NA	NA	0.5296
6. F	O69443	Divalent metal cation transporter MntH	1.45e-06	NA	NA	0.5271
6. F	A1YG32	Sodium-coupled neutral amino acid transporter 2	1.29e-07	NA	NA	0.5258
6. F	Q7P0J4	Probable potassium transport system protein kup 2	1.38e-07	NA	NA	0.5468
6. F	P55015	Solute carrier family 12 member 1	6.50e-05	NA	NA	0.4971
6. F	Q74LN2	Probable potassium transport system protein kup 2	3.09e-07	NA	NA	0.5334
6. F	Q5RE87	Sodium-coupled neutral amino acid transporter 4	1.78e-07	NA	NA	0.5376
6. F	Q6PCF9	Putative sodium-coupled neutral amino acid transporter 10	1.61e-05	NA	NA	0.5356
6. F	Q48SQ3	Probable potassium transport system protein kup	3.22e-07	NA	NA	0.3707
6. F	B5FN50	Low affinity potassium transport system protein kup	6.26e-07	NA	NA	0.5214
6. F	Q2IPI8	Probable potassium transport system protein kup	5.91e-07	NA	NA	0.4699
6. F	Q876K6	General amino acid permease AGP1	6.07e-14	NA	NA	0.6291
6. F	Q1J5X4	Probable potassium transport system protein kup	2.97e-07	NA	NA	0.3585
6. F	B5EZ13	Low affinity potassium transport system protein kup	2.11e-06	NA	NA	0.5203
6. F	Q60A92	Probable potassium transport system protein kup	6.59e-07	NA	NA	0.5169
6. F	Q07Q80	Probable potassium transport system protein kup 1	8.69e-07	NA	NA	0.5575
6. F	Q8UHH1	Probable potassium transport system protein kup 1	1.29e-07	NA	NA	0.5046
6. F	C3KDR5	Probable potassium transport system protein kup	3.46e-07	NA	NA	0.5529
6. F	B3WA65	Probable potassium transport system protein kup	6.81e-07	NA	NA	0.4581
6. F	Q747C1	Probable potassium transport system protein kup 3	8.38e-10	NA	NA	0.4892
6. F	Q8P0C8	Probable potassium transport system protein kup	2.76e-07	NA	NA	0.406
6. F	Q6N5F2	Probable potassium transport system protein kup 1	8.08e-08	NA	NA	0.5445
6. F	Q8YI23	Probable potassium transport system protein kup	3.80e-07	NA	NA	0.5323
6. F	Q4KL91	Proton-coupled amino acid transporter 4	3.80e-09	NA	NA	0.5201
6. F	Q49WM9	Divalent metal cation transporter MntH	8.51e-09	NA	NA	0.5438
6. F	Q472H9	Probable potassium transport system protein kup	4.70e-07	NA	NA	0.4397
6. F	C0M958	Probable potassium transport system protein kup	3.24e-07	NA	NA	0.3611
6. F	A5G9I7	Probable potassium transport system protein kup	2.03e-07	NA	NA	0.5035
6. F	O31809	Spore germination protein YndE	0.00e+00	NA	NA	0.7043
6. F	Q1BGW2	Probable potassium transport system protein kup	8.31e-07	NA	NA	0.4604
6. F	Q93N69	Spore germination protein GerLB	5.64e-13	NA	NA	0.5894
6. F	Q1JL33	Probable potassium transport system protein kup	3.57e-07	NA	NA	0.3643
6. F	B1LL74	Low affinity potassium transport system protein kup	2.43e-06	NA	NA	0.4915
6. F	Q5RCV1	Transmembrane protein 104	7.77e-08	NA	NA	0.5849
6. F	B3EAP8	Probable potassium transport system protein kup	2.47e-08	NA	NA	0.4837
6. F	A6T3X6	Probable potassium transport system protein kup	3.43e-07	NA	NA	0.4858
6. F	A5IF82	Probable potassium transport system protein kup 3	4.90e-07	NA	NA	0.4694
6. F	Q2NBS1	Probable potassium transport system protein kup	4.94e-07	NA	NA	0.5161
6. F	Q2W906	Probable potassium transport system protein kup 1	3.50e-07	NA	NA	0.5272
6. F	P37520	Uncharacterized protein YyaD	3.72e-09	NA	NA	0.7166
6. F	B2I0Q1	Probable potassium transport system protein kup	3.20e-07	NA	NA	0.459
6. F	C0MCV2	Probable potassium transport system protein kup	2.98e-07	NA	NA	0.371
6. F	P0DB57	Probable potassium transport system protein kup	3.34e-07	NA	NA	0.3718
6. F	Q5BL81	Sodium-coupled monocarboxylate transporter 1	2.28e-07	NA	NA	0.4047
6. F	Q5WUW3	Probable potassium transport system protein kup 2	3.77e-07	NA	NA	0.4617
6. F	Q98KL8	Probable potassium transport system protein kup 1	1.41e-07	NA	NA	0.482
6. F	B8GXM1	Probable potassium transport system protein kup	1.85e-07	NA	NA	0.4636
6. F	Q99Z39	Probable potassium transport system protein kup	3.28e-07	NA	NA	0.4063
6. F	Q3B1C1	Probable potassium transport system protein kup	4.20e-07	NA	NA	0.5174
6. F	Q9F5A5	Probable potassium transport system protein kup	2.83e-07	NA	NA	0.4477
6. F	A7N307	Divalent metal cation transporter MntH	1.35e-07	NA	NA	0.6569
6. F	Q9FEL8	Auxin transporter-like protein 1	5.92e-13	NA	NA	0.554
6. F	P48057	Sodium- and chloride-dependent GABA transporter 1	4.38e-06	NA	NA	0.4406
6. F	Q5F3I6	Transmembrane protein 104	5.51e-08	NA	NA	0.5647
6. F	A6U6M1	Probable potassium transport system protein kup 1	2.28e-07	NA	NA	0.431
6. F	Q95KE2	Vesicular inhibitory amino acid transporter	5.85e-12	NA	NA	0.5806
6. F	B2VDY7	Divalent metal cation transporter MntH	2.98e-08	NA	NA	0.6248
6. F	A5ESW9	Probable potassium transport system protein kup 4	3.94e-07	NA	NA	0.417
6. F	Q9MYX0	Sodium-dependent serotonin transporter	5.27e-07	NA	NA	0.5054
6. F	A5V2F7	Probable potassium transport system protein kup 1	7.58e-07	NA	NA	0.4698
6. F	Q9PC78	Probable potassium transport system protein kup	4.81e-07	NA	NA	0.5083
6. F	A2RDW5	Probable potassium transport system protein kup	3.44e-07	NA	NA	0.3682
6. F	Q89K67	Divalent metal cation transporter MntH	7.00e-12	NA	NA	0.5314
6. F	Q74AK4	Probable potassium transport system protein kup 1	3.25e-06	NA	NA	0.5319
6. F	P39570	Spore germination protein B2	0.00e+00	NA	NA	0.7001
6. F	B7GVI6	Probable potassium transport system protein kup	3.21e-07	NA	NA	0.4682
6. F	Q2KBW4	Probable potassium transport system protein kup 1	4.76e-07	NA	NA	0.4615
6. F	Q5E9S9	Sodium-coupled neutral amino acid transporter 5	7.07e-10	NA	NA	0.5655
6. F	A6UMS8	Probable potassium transport system protein kup 3	2.46e-07	NA	NA	0.5596
6. F	A5VRD1	Probable potassium transport system protein kup	4.15e-07	NA	NA	0.5456
6. F	Q0BW85	Divalent metal cation transporter MntH	9.44e-12	NA	NA	0.5742
6. F	A2SC47	Probable potassium transport system protein kup	3.51e-07	NA	NA	0.5242
6. F	A6UM20	Probable potassium transport system protein kup 2	8.92e-07	NA	NA	0.45
6. F	A3MK60	Probable potassium transport system protein kup	1.89e-07	NA	NA	0.4267
6. F	Q25479	Bumetanide-sensitive sodium-(potassium)-chloride cotransporter	7.99e-08	NA	NA	0.564
6. F	B7N2I6	Low affinity potassium transport system protein kup	5.36e-07	NA	NA	0.52
6. F	B7NR50	Low affinity potassium transport system protein kup	5.26e-07	NA	NA	0.55
6. F	O35899	Sodium-dependent serotonin transporter	4.47e-07	NA	NA	0.516
6. F	C0RE23	Probable potassium transport system protein kup	3.87e-07	NA	NA	0.5233
6. F	Q3YVL0	Low affinity potassium transport system protein kup	3.46e-07	NA	NA	0.5121
6. F	Q92BT1	Divalent metal cation transporter MntH	8.09e-09	NA	NA	0.5035
6. F	Q7YRU6	Solute carrier family 12 member 7	7.62e-06	NA	NA	0.5151
6. F	A4TSH8	Low affinity potassium transport system protein kup	4.23e-07	NA	NA	0.4884
6. F	Q9CHU4	Probable potassium transport system protein kup 2	3.70e-07	NA	NA	0.4989
6. F	Q1R4I5	Low affinity potassium transport system protein kup	5.46e-07	NA	NA	0.5202
6. F	Q5FLF5	Probable potassium transport system protein kup 2	1.15e-06	NA	NA	0.5085
6. F	O66504	Uncharacterized protein aq_097	7.38e-13	NA	NA	0.6703
6. F	B5BIQ1	Low affinity potassium transport system protein kup	3.56e-07	NA	NA	0.5032
6. F	Q0SU39	Probable potassium transport system protein kup	5.12e-07	NA	NA	0.5105
6. F	Q8TL61	Probable potassium transport system protein kup	1.89e-07	NA	NA	0.495
6. F	Q9ABT9	Probable potassium transport system protein kup	2.27e-07	NA	NA	0.4382
6. F	Q3SH71	Probable potassium transport system protein kup	8.03e-07	NA	NA	0.5347
6. F	Q3K107	Probable potassium transport system protein kup	3.12e-07	NA	NA	0.3989
6. F	Q47A46	Probable potassium transport system protein kup 3	3.78e-07	NA	NA	0.5076
6. F	B5XM58	Probable potassium transport system protein kup	3.44e-07	NA	NA	0.408
6. F	A2X8M8	Polyamine transporter PUT1	0.00e+00	NA	NA	0.5753
6. F	A9M640	Probable potassium transport system protein kup	3.42e-07	NA	NA	0.529
6. F	A8A6L0	Low affinity potassium transport system protein kup	4.30e-07	NA	NA	0.5207
6. F	Q89NN5	Probable potassium transport system protein kup 2	8.80e-07	NA	NA	0.4505
6. F	A3NVV6	Probable potassium transport system protein kup	1.99e-07	NA	NA	0.4272
6. F	Q2YQM9	Probable potassium transport system protein kup	5.70e-07	NA	NA	0.5239
6. F	P96589	Potassium transporter KimA	5.70e-11	NA	NA	0.6075
6. F	Q0BEY0	Probable potassium transport system protein kup	2.40e-07	NA	NA	0.4872
6. F	Q6DB92	Low affinity potassium transport system protein kup	3.78e-07	NA	NA	0.5029
6. F	Q9RTP8	Divalent metal cation transporter MntH	2.20e-07	NA	NA	0.5525
6. F	P9WIZ4	Divalent metal cation transporter MntH	1.00e-11	NA	NA	0.5868
6. F	Q1WSN8	Probable potassium transport system protein kup	2.85e-07	NA	NA	0.4956
6. F	Q1JG56	Probable potassium transport system protein kup	2.90e-07	NA	NA	0.3643
6. F	A4SLX1	Probable potassium transport system protein kup	6.81e-07	NA	NA	0.4641
6. F	Q2IX43	Probable potassium transport system protein kup	1.98e-07	NA	NA	0.5623
6. F	Q6A4L1	Solute carrier family 12 member 8	3.24e-08	NA	NA	0.5937
6. F	Q8E575	Probable potassium transport system protein kup	2.80e-07	NA	NA	0.3818
6. F	A0LJ91	Probable potassium transport system protein kup 1	3.05e-07	NA	NA	0.4797
6. F	Q87EJ9	Divalent metal cation transporter MntH	8.06e-10	NA	NA	0.5001
6. F	Q2K2I9	Probable potassium transport system protein kup 3	2.76e-07	NA	NA	0.4772
6. F	Q5RC98	Putative sodium-coupled neutral amino acid transporter 10	7.85e-06	NA	NA	0.5636
6. F	Q8DZL1	Probable potassium transport system protein kup	3.11e-07	NA	NA	0.4951
6. F	Q03S07	Probable potassium transport system protein kup	1.75e-06	NA	NA	0.5513
6. F	Q4KHA4	Probable potassium transport system protein kup	1.83e-07	NA	NA	0.5086
6. F	C1L2Y0	Divalent metal cation transporter MntH	5.44e-12	NA	NA	0.5036
6. F	A2VE31	Sodium-coupled neutral amino acid transporter 2	2.42e-08	NA	NA	0.5358
6. F	Q92RN0	Probable potassium transport system protein kup 1	1.88e-07	NA	NA	0.5015
6. F	B6I3Y4	Low affinity potassium transport system protein kup	5.37e-07	NA	NA	0.5009
6. F	Q8D1U8	Low affinity potassium transport system protein kup	1.06e-06	NA	NA	0.5132
6. F	Q71ZP6	Divalent metal cation transporter MntH	4.59e-12	NA	NA	0.4948
6. F	B0CHH0	Probable potassium transport system protein kup	3.89e-07	NA	NA	0.5282
6. F	Q0SYU9	Low affinity potassium transport system protein kup	3.56e-07	NA	NA	0.531
6. F	Q046Q7	Probable potassium transport system protein kup	3.46e-07	NA	NA	0.5389
6. F	Q465T0	Probable potassium transport system protein kup	1.89e-07	NA	NA	0.5163
6. F	P0DB56	Probable potassium transport system protein kup	2.80e-07	NA	NA	0.4814
6. F	Q5ZSY2	Probable potassium transport system protein kup 3	4.02e-07	NA	NA	0.4675
6. F	Q92Y93	Probable potassium transport system protein kup 2	2.77e-07	NA	NA	0.528
6. F	A5IDR5	Probable potassium transport system protein kup 2	7.86e-07	NA	NA	0.506
6. F	Q6N5G6	Probable potassium transport system protein kup 2	5.09e-07	NA	NA	0.4554
6. F	Q5XB99	Probable potassium transport system protein kup	3.43e-07	NA	NA	0.38
6. F	Q6DFK0	Sodium-coupled neutral amino acid transporter 9	2.38e-09	NA	NA	0.5466
6. F	P55013	Solute carrier family 12 member 2	4.33e-05	NA	NA	0.5083
6. F	Q28677	Solute carrier family 12 member 4	5.61e-06	NA	NA	0.4999
6. F	C6D9J9	Divalent metal cation transporter MntH	6.38e-10	NA	NA	0.6435
6. F	Q5R443	Sodium-coupled neutral amino acid transporter 1	4.05e-08	NA	NA	0.549
6. F	A0AIM7	Divalent metal cation transporter MntH	6.92e-09	NA	NA	0.4998
6. F	B5RFU8	Low affinity potassium transport system protein kup	3.44e-07	NA	NA	0.4985
6. F	Q5M7S0	Sodium-coupled neutral amino acid transporter 9	2.21e-09	NA	NA	0.5141
6. F	B7NF63	Low affinity potassium transport system protein kup	5.68e-07	NA	NA	0.5224
6. F	Q83PJ2	Low affinity potassium transport system protein kup	1.73e-07	NA	NA	0.5259
6. F	Q4L5B9	Divalent metal cation transporter MntH	6.63e-10	NA	NA	0.5564
6. F	Q5X2E7	Probable potassium transport system protein kup 3	2.97e-07	NA	NA	0.4377
6. F	B2K7I6	Low affinity potassium transport system protein kup	7.44e-07	NA	NA	0.5052
6. F	B0KTK9	Probable potassium transport system protein kup	2.11e-07	NA	NA	0.5043
6. F	Q0TRQ9	Probable potassium transport system protein kup	8.46e-08	NA	NA	0.4658
6. F	Q57CC4	Probable potassium transport system protein kup	3.46e-07	NA	NA	0.5192
6. F	Q13X42	Probable potassium transport system protein kup	1.86e-07	NA	NA	0.429
6. F	A6WZX3	Probable potassium transport system protein kup	3.77e-07	NA	NA	0.5304
6. F	Q8Y773	Divalent metal cation transporter MntH	7.77e-10	NA	NA	0.5056
6. F	Q8L884	Auxin transporter-like protein 4	6.76e-13	NA	NA	0.562
6. F	Q1CC44	Low affinity potassium transport system protein kup	7.59e-07	NA	NA	0.5139
6. F	Q8L883	Auxin transporter-like protein 5	1.35e-12	NA	NA	0.5733
6. F	A0KJR8	Probable potassium transport system protein kup 1	6.55e-07	NA	NA	0.447
6. F	Q0TAW2	Low affinity potassium transport system protein kup	5.87e-07	NA	NA	0.5036
6. F	Q5F468	Sodium-coupled neutral amino acid transporter 2	2.19e-08	NA	NA	0.5819
6. F	A0JNI9	Probable cationic amino acid transporter	6.98e-09	NA	NA	0.481
6. F	Q03TH5	Divalent metal cation transporter MntH	5.61e-09	NA	NA	0.4896
6. F	Q3KH21	Probable potassium transport system protein kup	3.66e-07	NA	NA	0.4931
6. F	Q8UJL0	Probable potassium transport system protein kup 2	1.53e-07	NA	NA	0.5588
6. F	Q1MEX2	Probable potassium transport system protein kup 2	9.21e-08	NA	NA	0.4352
6. F	B2S6K8	Probable potassium transport system protein kup	3.17e-07	NA	NA	0.5268
6. F	Q135T0	Probable potassium transport system protein kup 2	4.45e-07	NA	NA	0.5435
6. F	B2TU32	Low affinity potassium transport system protein kup	1.43e-07	NA	NA	0.4602
6. F	P55019	Solute carrier family 12 member 3	1.01e-05	NA	NA	0.5329
6. F	Q28HE5	Probable sodium-coupled neutral amino acid transporter 6	8.90e-10	NA	NA	0.559