Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX55013.1

JCVISYN3A_0878

Uncharacterized amino acid permease.
M. mycoides homolog: Q6MS71.
TIGRfam Classification: 2=Generic.
Category: Quasiessential.

Statistics

Total GO Annotation: 359
Unique PROST Go: 209
Unique BLAST Go: 16
Unique Foldseek Go: 21

Total Homologs: 948
Unique PROST Homologs: 389
Unique BLAST Homologs: 2
Unique Foldseek Homologs: 169

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: Amino acid permease potE
Antczak et al. [3]: L-type amino acid permease
Zhang et al. [4]: GO:0015370|solute:sodium symporter activity
Bianchi et al. [5]: GabP-like Amino Acid Permease

Structures and Sequence Alignment

The best structural homolog that predicted by 2. PF was P44747 (Tyrosine-specific transport protein 2) with a FATCAT P-Value: 0 and RMSD of 3.11 angstrom. The sequence alignment identity is 22.6%.
Structural alignment shown in left. Query protein AVX55013.1 colored as red in alignment, homolog P44747 colored as blue. Query protein AVX55013.1 is also shown in right top, homolog P44747 showed in right bottom. They are colored based on secondary structures.

  AVX55013.1 M-KNKSRFFEFLTLFMMSVGTIVGSGIYVKNRDILIETHNPIIAIVL---WT---AVGISCIAVVY---LFLEISSSTKN---GTIGSWSRAFFGHKV-G 86
      P44747 MLKNKT-FGSALII----AGTTIGAG-------ML---AMPLTSAGMGFGYTLLLLVGLWAL-LVYSGLLFVEVYQTADQLDDG-VATLAEKYFG--VPG 81

  AVX55013.1 SFFANFQTMFYAPVNQAIFTSALLSYFLNIFDIKLY---GYQYLLIFLLVGAIIILLTNILNVFSIKGSKAVQIFGTGFKFFPLIIALFAG-FILADHFG 182
      P44747 RIFA---TL-------SLL--VLL-YALS----AAYITGG----------GS---LLSGLPTAF---GMEAMSL-KTAIIIFTVVL----GSFVV---VG 140

  AVX55013.1 ALQNNGVDVRGIDATKSWTKHDFDPLLFFRGFGGIL-FAFDGFIYICNSKKRAKHQ------D---VV---PIALVSAMAFAAVFYLIM-SISLILGSPD 268
      P44747 ---TKGVD--GL--TR---------VLF---IGKLIAFAFVLFMML---PKVATDNLMALPLDYAFVVSAAPIFLTS---FG--FHVIMASVNSYLG--- 210

  AVX55013.1 GSIEQLLERVFNNGQPLKTQVNQTVKVMVAIISMIICFL---G-LNAYSYIGMAGLESD-VIDGL-SYIKSVDDKHRFKKIG-LIQGVISYAIFAIFIIV 361
      P44747 GSVDK-FRRAILIG---------TA---IPLAAYLVWQLATHGVLSQSEFVRI--LQADPTLNGLVNATREITGSH-F--MGEVVR------VF------ 280

  AVX55013.1 GASSSISLNQQIEVGSATDSASG-MLYLIQIMSSTCSCLSFAMMASLIVA-ALVNRKTNKVEVKKIKGFV-PL--AIF---GLITFIFFSSMGL----FT 449
      P44747 ---SSLAL---I-----T-SFLGVMLGV------------FEGLGDLFKRYHLPN---NRF-VLTIAAFLPPLVFALFYPEGFITAL--SYAGLLCAFYC 350

  AVX55013.1 FIVPLGVIRNGDSWWTAQHSQGP-L--------F-LLL-MVLGLIFVAI--L--W-YNQNKRLIGGLCLKNDHIQREKR 512
      P44747 LILPISL-----AWRT--RIENPTLPYRVAGGNFALVLALLIGVVIMLIPFLIQWGY---LPVVAG------------- 406

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0022857	transmembrane transporter activity
1. PBF	GO:0015196	L-tryptophan transmembrane transporter activity
1. PBF	GO:0015804	neutral amino acid transport
1. PBF	GO:0089718	amino acid import across plasma membrane
1. PBF	GO:0016021	integral component of membrane
1. PBF	GO:0015173	aromatic amino acid transmembrane transporter activity
1. PBF	GO:0015175	neutral amino acid transmembrane transporter activity
1. PBF	GO:0015171	amino acid transmembrane transporter activity
1. PBF	GO:0006865	amino acid transport
1. PBF	GO:1990184	amino acid transport complex
1. PBF	GO:1903801	L-leucine import across plasma membrane
1. PBF	GO:0042605	peptide antigen binding
1. PBF	GO:0015179	L-amino acid transmembrane transporter activity
1. PBF	GO:1904556	L-tryptophan transmembrane transport
1. PBF	GO:0015190	L-leucine transmembrane transporter activity
2. PF	GO:0015379	potassium:chloride symporter activity
2. PF	GO:0055085	transmembrane transport
2. PF	GO:0097639	L-lysine import across plasma membrane
2. PF	GO:0010940	positive regulation of necrotic cell death
2. PF	GO:0005829	cytosol
2. PF	GO:0009847	spore germination
2. PF	GO:0042940	D-amino acid transport
2. PF	GO:0035524	proline transmembrane transport
2. PF	GO:0015734	taurine transport
2. PF	GO:0043858	arginine:ornithine antiporter activity
2. PF	GO:0003333	amino acid transmembrane transport
2. PF	GO:0042942	D-serine transport
2. PF	GO:1904273	L-alanine import across plasma membrane
2. PF	GO:0015851	nucleobase transport
2. PF	GO:0015658	branched-chain amino acid transmembrane transporter activity
2. PF	GO:0015293	symporter activity
2. PF	GO:0015203	polyamine transmembrane transporter activity
2. PF	GO:0015188	L-isoleucine transmembrane transporter activity
2. PF	GO:0042943	D-amino acid transmembrane transporter activity
2. PF	GO:0005576	extracellular region
2. PF	GO:0005283	amino acid:sodium symporter activity
2. PF	GO:0031402	sodium ion binding
2. PF	GO:0006814	sodium ion transport
2. PF	GO:0015827	tryptophan transport
2. PF	GO:0022889	serine transmembrane transporter activity
2. PF	GO:0015180	L-alanine transmembrane transporter activity
2. PF	GO:0015209	cytosine transmembrane transporter activity
2. PF	GO:0035725	sodium ion transmembrane transport
2. PF	GO:0019858	cytosine metabolic process
2. PF	GO:0005887	integral component of plasma membrane
2. PF	GO:0005886	plasma membrane
2. PF	GO:0015182	L-asparagine transmembrane transporter activity
2. PF	GO:0015824	proline transport
2. PF	GO:0015123	acetate transmembrane transporter activity
2. PF	GO:0071705	nitrogen compound transport
2. PF	GO:0015086	cadmium ion transmembrane transporter activity
2. PF	GO:0015495	gamma-aminobutyric acid:proton symporter activity
2. PF	GO:0031924	vitamin B6 transmembrane transporter activity
2. PF	GO:0015297	antiporter activity
2. PF	GO:0015185	gamma-aminobutyric acid transmembrane transporter activity
2. PF	GO:0071281	cellular response to iron ion
2. PF	GO:0005304	L-valine transmembrane transporter activity
2. PF	GO:0015186	L-glutamine transmembrane transporter activity
2. PF	GO:0005298	proline:sodium symporter activity
2. PF	GO:0015191	L-methionine transmembrane transporter activity
2. PF	GO:0015881	creatine transmembrane transport
2. PF	GO:0006836	neurotransmitter transport
2. PF	GO:0015829	valine transport
2. PF	GO:0046873	metal ion transmembrane transporter activity
2. PF	GO:0005332	gamma-aminobutyric acid:sodium symporter activity
2. PF	GO:0015496	putrescine:ornithine antiporter activity
2. PF	GO:0015233	pantothenate transmembrane transporter activity
2. PF	GO:0005737	cytoplasm
2. PF	GO:0015187	glycine transmembrane transporter activity
2. PF	GO:0015887	pantothenate transmembrane transport
2. PF	GO:0015820	leucine transport
2. PF	GO:0015803	branched-chain amino acid transport
2. PF	GO:0015205	nucleobase transmembrane transporter activity
2. PF	GO:0015565	threonine efflux transmembrane transporter activity
2. PF	GO:0043879	glycolate transmembrane transporter activity
2. PF	GO:0005384	manganese ion transmembrane transporter activity
2. PF	GO:0016323	basolateral plasma membrane
2. PF	GO:0006847	plasma membrane acetate transport
2. PF	GO:1903352	L-ornithine transmembrane transport
2. PF	GO:0015818	isoleucine transport
4. PB	GO:0098713	leucine import across plasma membrane
4. PB	GO:0097449	astrocyte projection
4. PB	GO:0015823	phenylalanine transport
4. PB	GO:1901494	regulation of cysteine metabolic process
4. PB	GO:0021591	ventricular system development
4. PB	GO:0140206	dipeptide import across plasma membrane
4. PB	GO:0150104	transport across blood-brain barrier
4. PB	GO:0015184	L-cystine transmembrane transporter activity
4. PB	GO:0070306	lens fiber cell differentiation
4. PB	GO:0048021	regulation of melanin biosynthetic process
4. PB	GO:1903786	regulation of glutathione biosynthetic process
4. PB	GO:0015811	L-cystine transport
4. PB	GO:0033029	regulation of neutrophil apoptotic process
4. PB	GO:0032740	positive regulation of interleukin-17 production
4. PB	GO:0031528	microvillus membrane
4. PB	GO:0098591	external side of apical plasma membrane
4. PB	GO:0021756	striatum development
4. PB	GO:1904717	regulation of AMPA glutamate receptor clustering
4. PB	GO:0098712	L-glutamate import across plasma membrane
4. PB	GO:0071702	organic substance transport
4. PB	GO:1903204	negative regulation of oxidative stress-induced neuron death
4. PB	GO:0051223	regulation of protein transport
4. PB	GO:0016324	apical plasma membrane
4. PB	GO:0032729	positive regulation of interferon-gamma production
4. PB	GO:0034775	glutathione transmembrane transport
4. PB	GO:2000211	regulation of glutamate metabolic process
4. PB	GO:0032753	positive regulation of interleukin-4 production
4. PB	GO:0015349	thyroid hormone transmembrane transporter activity
4. PB	GO:0042908	xenobiotic transport
4. PB	GO:0009925	basal plasma membrane
4. PB	GO:0070327	thyroid hormone transport
4. PB	GO:0031526	brush border membrane
4. PB	GO:0090461	glutamate homeostasis
5. P	GO:0042910	xenobiotic transmembrane transporter activity
5. P	GO:0090518	L-arginine transmembrane import into vacuole
5. P	GO:0022804	active transmembrane transporter activity
5. P	GO:0140135	mechanosensitive cation channel activity
5. P	GO:0022858	alanine transmembrane transporter activity
5. P	GO:0034228	ethanolamine transmembrane transporter activity
5. P	GO:0043872	lysine:cadaverine antiporter activity
5. P	GO:0015181
5. P	GO:0008028	monocarboxylic acid transmembrane transporter activity
5. P	GO:0051939	gamma-aminobutyric acid import
5. P	GO:0070821	tertiary granule membrane
5. P	GO:1903785	L-valine transmembrane transport
5. P	GO:0009243	O antigen biosynthetic process
5. P	GO:0015847	putrescine transport
5. P	GO:0044853	plasma membrane raft
5. P	GO:0033265	choline binding
5. P	GO:0005634	nucleus
5. P	GO:0090513	L-histidine transmembrane import into vacuole
5. P	GO:0000041	transition metal ion transport
5. P	GO:0015212	cytidine transmembrane transporter activity
5. P	GO:0005774	vacuolar membrane
5. P	GO:1903826	L-arginine transmembrane transport
5. P	GO:0098567	periplasmic side of plasma membrane
5. P	GO:0015489	putrescine transmembrane transporter activity
5. P	GO:0009450	gamma-aminobutyric acid catabolic process
5. P	GO:0032006	regulation of TOR signaling
5. P	GO:0090517	L-lysine transmembrane import into vacuole
5. P	GO:0015816	glycine transport
5. P	GO:0015327	cystine:glutamate antiporter activity
5. P	GO:0015888	thiamine transport
5. P	GO:0090549	response to carbon starvation
5. P	GO:1903714	isoleucine transmembrane transport
5. P	GO:0015220	choline transmembrane transporter activity
5. P	GO:1905803	negative regulation of cellular response to manganese ion
5. P	GO:0005477	pyruvate secondary active transmembrane transporter activity
5. P	GO:0015857	uracil transport
5. P	GO:0034755	iron ion transmembrane transport
5. P	GO:0048002	antigen processing and presentation of peptide antigen
5. P	GO:1901367	response to L-cysteine
5. P	GO:0001762	beta-alanine transport
5. P	GO:0015846	polyamine transport
5. P	GO:0005300	high-affinity tryptophan transmembrane transporter activity
5. P	GO:0015806	S-methylmethionine transport
5. P	GO:0097640	L-ornithine import across plasma membrane
5. P	GO:0005308	creatine transmembrane transporter activity
5. P	GO:1903401	L-lysine transmembrane transport
5. P	GO:1902274	positive regulation of (R)-carnitine transmembrane transport
5. P	GO:0001818	negative regulation of cytokine production
5. P	GO:0042945	D-serine transmembrane transporter activity
5. P	GO:0015821	methionine transport
5. P	GO:0097440	apical dendrite
5. P	GO:0010042	response to manganese ion
5. P	GO:0007035	vacuolar acidification
5. P	GO:0005294	neutral L-amino acid secondary active transmembrane transporter activity
5. P	GO:0031520	plasma membrane of cell tip
5. P	GO:0051936	gamma-aminobutyric acid reuptake
5. P	GO:0015295	solute:proton symporter activity
5. P	GO:0015505	uracil:cation symporter activity
5. P	GO:0042907	xanthine transmembrane transporter activity
5. P	GO:0006876	cellular cadmium ion homeostasis
5. P	GO:0090514	L-tyrosine transmembrane import into vacuole
5. P	GO:0042941	D-alanine transport
5. P	GO:0009093	cysteine catabolic process
5. P	GO:0015195	L-threonine transmembrane transporter activity
5. P	GO:0043005	neuron projection
5. P	GO:1900749	(R)-carnitine transport
5. P	GO:0060586	multicellular organismal iron ion homeostasis
5. P	GO:0005412	glucose:sodium symporter activity
5. P	GO:1903088	5-amino-1-ribofuranosylimidazole-4-carboxamide transmembrane transport
5. P	GO:0015370	solute:sodium symporter activity
5. P	GO:0051938	L-glutamate import
5. P	GO:0051512	positive regulation of unidimensional cell growth
5. P	GO:0015718	monocarboxylic acid transport
5. P	GO:0005291	high-affinity L-histidine transmembrane transporter activity
5. P	GO:1903988	iron ion export across plasma membrane
5. P	GO:0015833	peptide transport
5. P	GO:0006855	xenobiotic transmembrane transport
5. P	GO:0000101	sulfur amino acid transport
5. P	GO:0006879	cellular iron ion homeostasis
5. P	GO:0015193	L-proline transmembrane transporter activity
5. P	GO:0051454	intracellular pH elevation
5. P	GO:0015654	tellurite transmembrane transporter activity
5. P	GO:0016966	nitric oxide reductase activity
5. P	GO:1905647	proline import across plasma membrane
5. P	GO:0005307	choline:sodium symporter activity
5. P	GO:0034216	high-affinity thiamine:proton symporter activity
5. P	GO:0030955	potassium ion binding
5. P	GO:1990822	basic amino acid transmembrane transport
5. P	GO:0002309	T cell proliferation involved in immune response
5. P	GO:0061459	L-arginine transmembrane transporter activity
5. P	GO:0048255	mRNA stabilization
5. P	GO:0005368	taurine transmembrane transporter activity
5. P	GO:0015710	tellurite transport
5. P	GO:0006826	iron ion transport
5. P	GO:0072530	purine-containing compound transmembrane transport
5. P	GO:0015828	tyrosine transport
5. P	GO:0055072	iron ion homeostasis
5. P	GO:0002606	positive regulation of dendritic cell antigen processing and presentation
5. P	GO:0022890	inorganic cation transmembrane transporter activity
5. P	GO:0005313	L-glutamate transmembrane transporter activity
5. P	GO:0009636	response to toxic substance
5. P	GO:0015871	choline transport
5. P	GO:0090515	L-glutamate transmembrane import into vacuole
5. P	GO:0070574	cadmium ion transmembrane transport
5. P	GO:0046915	transition metal ion transmembrane transporter activity
5. P	GO:0019534	toxin transmembrane transporter activity
5. P	GO:0098721	uracil import across plasma membrane
5. P	GO:0000064	L-ornithine transmembrane transporter activity
5. P	GO:0042832	defense response to protozoan
5. P	GO:0015812	gamma-aminobutyric acid transport
5. P	GO:0006877	cellular cobalt ion homeostasis
5. P	GO:0009992	cellular water homeostasis
5. P	GO:1904271	L-proline import across plasma membrane
5. P	GO:0015801	aromatic amino acid transport
5. P	GO:1901281	fructoselysine catabolic process
5. P	GO:0006909	phagocytosis
5. P	GO:0015655	alanine:sodium symporter activity
5. P	GO:0015813	L-glutamate transmembrane transport
5. P	GO:0051180	vitamin transport
5. P	GO:0070470	plasma membrane respirasome
5. P	GO:0097638	L-arginine import across plasma membrane
5. P	GO:0032328	alanine transport
5. P	GO:0009624	response to nematode
5. P	GO:0005302	L-tyrosine transmembrane transporter activity
5. P	GO:0015210	uracil transmembrane transporter activity
5. P	GO:0034229	ethanolamine transport
5. P	GO:0000329	fungal-type vacuole membrane
5. P	GO:0042944	D-alanine transmembrane transporter activity
5. P	GO:0008292	acetylcholine biosynthetic process
5. P	GO:0034257	nicotinamide riboside transmembrane transporter activity
5. P	GO:0034258	nicotinamide riboside transport
5. P	GO:0019333	denitrification pathway
5. P	GO:1901482	L-lysine import into vacuole involved in cellular response to nitrogen starvation
5. P	GO:1902023
5. P	GO:0015707	nitrite transport
5. P	GO:0005783	endoplasmic reticulum
5. P	GO:0005416	amino acid:cation symporter activity
5. P	GO:0002537	nitric oxide production involved in inflammatory response
5. P	GO:1901235	(R)-carnitine transmembrane transporter activity
5. P	GO:0015839	cadaverine transport
5. P	GO:0015856	cytosine transport
5. P	GO:0031669	cellular response to nutrient levels
5. P	GO:1903692	methionine import across plasma membrane
5. P	GO:0070839	metal ion export
5. P	GO:0006811	ion transport
5. P	GO:0015822	ornithine transport
5. P	GO:1901481	L-glutamate import involved in cellular response to nitrogen starvation
5. P	GO:0090516	L-serine transmembrane import into vacuole
5. P	GO:0000102	L-methionine secondary active transmembrane transporter activity
5. P	GO:1903089	5-amino-1-ribofuranosylimidazole-4-carboxamide transmembrane transporter activity
5. P	GO:0015802	basic amino acid transport
5. P	GO:0006828	manganese ion transport
5. P	GO:0007274	neuromuscular synaptic transmission
5. P	GO:0007271	synaptic transmission, cholinergic
5. P	GO:0015192	L-phenylalanine transmembrane transporter activity
5. P	GO:0015690	aluminum cation transport
5. P	GO:0015807	L-amino acid transport
5. P	GO:0000100	S-methylmethionine transmembrane transporter activity
5. P	GO:0022893	low-affinity tryptophan transmembrane transporter activity
5. P	GO:0045334	clathrin-coated endocytic vesicle
5. P	GO:0043030	regulation of macrophage activation
5. P	GO:0006569	tryptophan catabolic process
5. P	GO:0050845	teichuronic acid biosynthetic process
5. P	GO:0030026	cellular manganese ion homeostasis
5. P	GO:0000324	fungal-type vacuole
5. P	GO:0015810	aspartate transmembrane transport
5. P	GO:0042165	neurotransmitter binding
5. P	GO:0045278	plasma membrane respiratory chain complex IV
5. P	GO:0015691	cadmium ion transport
5. P	GO:0042116	macrophage activation
5. P	GO:0051139	metal ion:proton antiporter activity
5. P	GO:0042906	xanthine transport
5. P	GO:0015809
5. P	GO:0006849	plasma membrane pyruvate transport
5. P	GO:0015291	secondary active transmembrane transporter activity
5. P	GO:0015199	amino-acid betaine transmembrane transporter activity
5. P	GO:0015183	L-aspartate transmembrane transporter activity
5. P	GO:0015838	amino-acid betaine transport
5. P	GO:0015101	organic cation transmembrane transporter activity
5. P	GO:0034341	response to interferon-gamma
5. P	GO:0005381	iron ion transmembrane transporter activity
5. P	GO:0005275	amine transmembrane transporter activity
5. P	GO:0001761	beta-alanine transmembrane transporter activity
5. P	GO:0071421	manganese ion transmembrane transport
5. P	GO:0032975	amino acid transmembrane import into vacuole
5. P	GO:0015819	lysine transport
5. P	GO:0045232	S-layer organization
5. P	GO:0045342	MHC class II biosynthetic process
5. P	GO:0000821	regulation of arginine metabolic process
5. P	GO:0015912	short-chain fatty acid transport
5. P	GO:0005290	L-histidine transmembrane transporter activity
5. P	GO:0009267	cellular response to starvation
5. P	GO:0015194	L-serine transmembrane transporter activity
5. P	GO:0030670	phagocytic vesicle membrane
5. P	GO:0140125	thiamine import across plasma membrane
5. P	GO:0071235	cellular response to proline
5. P	GO:0015174	basic amino acid transmembrane transporter activity
5. P	GO:0071944	cell periphery
5. P	GO:0019411	aerobic respiration, using ferrous ions as electron donor
5. P	GO:1903810	L-histidine import across plasma membrane
5. P	GO:0032178	medial membrane band
5. P	GO:0002827	positive regulation of T-helper 1 type immune response
5. P	GO:1902269	positive regulation of polyamine transmembrane transport
5. P	GO:0015083	aluminum ion transmembrane transporter activity
5. P	GO:0015189	L-lysine transmembrane transporter activity
5. P	GO:0045730	respiratory burst
5. P	GO:1902475	L-alpha-amino acid transmembrane transport
5. P	GO:0015861	cytidine transport
5. P	GO:0055071	manganese ion homeostasis
6. F	GO:0015872	dopamine transport
6. F	GO:0044292	dendrite terminus
6. F	GO:0009734	auxin-activated signaling pathway
6. F	GO:0140157	ammonium import across plasma membrane
6. F	GO:0015377	cation:chloride symporter activity
6. F	GO:0006813	potassium ion transport
6. F	GO:0044316	cone cell pedicle
6. F	GO:0046872	metal ion binding
6. F	GO:0005330	dopamine:sodium symporter activity
6. F	GO:0005309	creatine:sodium symporter activity
6. F	GO:0015079	potassium ion transmembrane transporter activity
6. F	GO:0005334	norepinephrine:sodium symporter activity
6. F	GO:0032329	serine transport
6. F	GO:0051583	dopamine uptake involved in synaptic transmission
6. F	GO:0015874	norepinephrine transport
6. F	GO:0006525	arginine metabolic process
6. F	GO:0005369	taurine:sodium symporter activity
6. F	GO:0098659	inorganic cation import across plasma membrane
6. F	GO:0089709	L-histidine transmembrane transport
6. F	GO:0006868	glutamine transport
6. F	GO:0019483	beta-alanine biosynthetic process
7. B	GO:0051775	response to redox state
7. B	GO:0009705	plant-type vacuole membrane
7. B	GO:0008542	visual learning
7. B	GO:0050804	modulation of chemical synaptic transmission
7. B	GO:0060173	limb development
7. B	GO:0035094	response to nicotine
7. B	GO:0014070	response to organic cyclic compound
7. B	GO:0045177	apical part of cell
7. B	GO:0002720	positive regulation of cytokine production involved in immune response
7. B	GO:1900407	regulation of cellular response to oxidative stress
7. B	GO:0050807	regulation of synapse organization
7. B	GO:0030534	adult behavior
7. B	GO:0005791	rough endoplasmic reticulum
7. B	GO:0043231	intracellular membrane-bounded organelle
7. B	GO:0070527	platelet aggregation
7. B	GO:0048286	lung alveolus development

Uniprot GO Annotations

GO	Description
GO:0022857	transmembrane transporter activity
GO:0016020	membrane
GO:0055085	transmembrane transport
GO:0016021	integral component of membrane

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	O34739	Serine/threonine exchanger SteT	2.22e-16	1.02e-23	0.039	0.748
1. PBF	P75472	Uncharacterized protein MPN_308	0.00e+00	1.48e-54	2.35e-14	0.7446
1. PBF	Q9N1R6	b(0,+)-type amino acid transporter 1	1.11e-16	2.73e-09	0.005	0.6749
2. PF	A4TMF6	Divalent metal cation transporter MntH	1.11e-16	1.05e-06	NA	0.63
2. PF	Q93V04	Divalent metal cation transporter MntH	8.45e-10	7.38e-03	NA	0.5842
2. PF	A9N628	Threonine/serine transporter TdcC	1.23e-10	8.08e-08	NA	0.6286
2. PF	P0AAD7	Serine transporter SdaC	1.32e-09	2.57e-06	NA	0.6281
2. PF	Q6G9F4	Putative branched-chain amino acid carrier protein SAS1350	3.24e-11	5.21e-13	NA	0.5582
2. PF	B7MY49	Divalent metal cation transporter MntH	2.45e-12	1.12e-06	NA	0.638
2. PF	Q3YXB3	Threonine/serine transporter TdcC	1.29e-10	2.65e-07	NA	0.6469
2. PF	B7NDA4	Threonine/serine transporter TdcC	1.46e-08	4.04e-07	NA	0.6299
2. PF	P71345	Branched-chain amino acid transport system carrier protein	8.15e-10	3.84e-13	NA	0.5248
2. PF	C0PZC8	Divalent metal cation transporter MntH	5.42e-10	1.51e-07	NA	0.6474
2. PF	B4TIX1	Threonine/serine transporter TdcC	1.80e-10	9.42e-08	NA	0.6326
2. PF	Q0TF69	Divalent metal cation transporter MntH	3.02e-10	1.12e-06	NA	0.6437
2. PF	B5R3U1	Divalent metal cation transporter MntH	2.44e-10	1.56e-07	NA	0.6435
2. PF	O74248	Putative polyamine transporter	1.86e-09	3.58e-12	NA	0.6289
2. PF	P0AAD3	Tryptophan-specific transport protein	0.00e+00	2.66e-13	NA	0.6724
2. PF	P42964	Uncharacterized membrane protein YcsG	9.55e-08	1.52e-09	NA	0.6002
2. PF	A2RI87	Serine permease SerP1	0.00e+00	7.42e-23	NA	0.7107
2. PF	B8DE85	Divalent metal cation transporter MntH	9.99e-09	2.00e-02	NA	0.5372
2. PF	Q46065	Aromatic amino acid transport protein AroP	3.22e-15	5.38e-28	NA	0.6941
2. PF	A2RNZ6	Lysine permease LysP	1.64e-10	2.93e-20	NA	0.6435
2. PF	P0A771	Divalent metal cation transporter MntH	2.34e-12	1.12e-06	NA	0.6437
2. PF	Q49XK9	Putative branched-chain amino acid carrier protein SSP1343	4.30e-11	9.70e-13	NA	0.5414
2. PF	Q9CEY5	Probable agmatine/putrescine antiporter AguD	2.22e-16	3.00e-24	NA	0.709
2. PF	B5F6Q0	Threonine/serine transporter TdcC	2.23e-09	9.42e-08	NA	0.6337
2. PF	Q1C0M8	Cation/acetate symporter ActP	2.03e-06	4.70e-05	NA	0.4452
2. PF	Q931T9	Divalent metal cation transporter MntH	3.91e-08	1.61e-04	NA	0.5475
2. PF	Q3YZE0	Divalent metal cation transporter MntH	9.05e-10	1.12e-06	NA	0.6411
2. PF	O31462	Uncharacterized amino acid permease YbgF	0.00e+00	4.53e-27	NA	0.5834
2. PF	B5RCN6	Divalent metal cation transporter MntH	2.82e-10	1.56e-07	NA	0.6546
2. PF	Q28I47	Putative sodium-coupled neutral amino acid transporter 8	1.00e-13	2.54e-06	NA	0.6182
2. PF	B4TRK2	Cation/acetate symporter ActP	4.76e-07	8.98e-05	NA	0.4465
2. PF	Q7A166	Divalent metal cation transporter MntH	3.62e-08	1.59e-04	NA	0.5855
2. PF	P37460	Proline-specific permease ProY	5.55e-16	1.01e-28	NA	0.709
2. PF	P63342	Inner membrane transport protein YqeG	3.00e-10	2.32e-09	NA	0.6673
2. PF	P0A190	Probable transport protein YifK	2.44e-15	3.62e-26	NA	0.695
2. PF	A7FNG3	Cation/acetate symporter ActP	6.13e-07	2.64e-05	NA	0.4058
2. PF	A4WEU1	Threonine/serine transporter TdcC	5.13e-13	3.53e-07	NA	0.629
2. PF	B5QZS1	Threonine/serine transporter TdcC	1.18e-10	9.42e-08	NA	0.6325
2. PF	A2RMP5	Aromatic amino acid permease FywP	6.99e-15	1.56e-29	NA	0.6255
2. PF	P58229	Glutamate/gamma-aminobutyrate antiporter	0.00e+00	5.06e-21	NA	0.6025
2. PF	Q8FL49	Aromatic amino acid transport protein AroP	0.00e+00	2.55e-27	NA	0.7308
2. PF	B5REJ9	Threonine/serine transporter TdcC	1.08e-10	9.42e-08	NA	0.6273
2. PF	P39137	Amino-acid permease RocE	1.44e-15	3.61e-27	NA	0.6834
2. PF	P63350	Uncharacterized transporter Mb2022c	1.33e-15	5.09e-18	NA	0.663
2. PF	B1JNK6	Cation/acetate symporter ActP	5.13e-07	2.90e-05	NA	0.3992
2. PF	Q668N2	Divalent metal cation transporter MntH	1.18e-09	1.05e-06	NA	0.621
2. PF	Q49WM9	Divalent metal cation transporter MntH	9.57e-09	3.83e-03	NA	0.5794
2. PF	Q8FAZ0	Cation/acetate symporter ActP	4.46e-07	5.63e-05	NA	0.4183
2. PF	Q0T2A8	Divalent metal cation transporter MntH	3.15e-10	8.05e-07	NA	0.6389
2. PF	B6I491	Threonine/serine transporter TdcC	5.20e-09	3.23e-07	NA	0.6467
2. PF	P75462	Uncharacterized protein MG226 homolog	0.00e+00	3.35e-34	NA	0.6732
2. PF	B6I5T5	Cation/acetate symporter ActP	3.82e-07	2.71e-05	NA	0.4196
2. PF	P63236	Glutamate/gamma-aminobutyrate antiporter	0.00e+00	3.63e-21	NA	0.6128
2. PF	P0AAE9	Probable cadaverine/lysine antiporter	1.46e-13	3.69e-26	NA	0.6749
2. PF	O31809	Spore germination protein YndE	0.00e+00	3.40e-03	NA	0.6271
2. PF	A4W5I3	Cation/acetate symporter ActP	4.43e-07	3.21e-05	NA	0.4136
2. PF	Q93N69	Spore germination protein GerLB	5.26e-12	1.07e-04	NA	0.5962
2. PF	B7UJ20	Threonine/serine transporter TdcC	2.64e-09	3.23e-07	NA	0.6356
2. PF	P0AAE4	Proline-specific permease ProY	0.00e+00	5.97e-28	NA	0.7096
2. PF	B7NPS9	Divalent metal cation transporter MntH	5.43e-10	1.12e-06	NA	0.6385
2. PF	Q8Z1R2	Cation/acetate symporter ActP	1.21e-06	7.52e-05	NA	0.4152
2. PF	Q47825	Tyrosine permease	0.00e+00	1.58e-16	NA	0.6772
2. PF	A1WR47	Divalent metal cation transporter MntH	1.33e-09	4.86e-04	NA	0.5498
2. PF	Q45577	Probable amino acid-proton symporter YbeC	3.25e-08	4.98e-24	NA	0.6041
2. PF	Q6GHY0	Divalent metal cation transporter MntH	4.09e-08	7.77e-05	NA	0.5905
2. PF	A2RL65	Aspartate/glutamate permease AcaP	4.89e-13	3.19e-27	NA	0.743
2. PF	A0KG66	Divalent metal cation transporter MntH	1.12e-09	3.76e-05	NA	0.598
2. PF	B1IRJ9	Threonine/serine transporter TdcC	1.19e-10	4.04e-07	NA	0.6304
2. PF	A2RNI5	Arginine/ornithine antiporter ArcD1	2.40e-10	8.59e-37	NA	0.5499
2. PF	P96593	Divalent metal cation transporter MntH	1.13e-11	1.67e-03	NA	0.6307
2. PF	Q2FH31	Putative branched-chain amino acid carrier protein SAUSA300_1300	3.17e-11	5.21e-13	NA	0.5605
2. PF	Q9CG19	Glutamate/gamma-aminobutyrate antiporter	0.00e+00	2.77e-19	NA	0.6762
2. PF	Q5HG12	Putative branched-chain amino acid carrier protein SACOL1443	3.19e-11	5.21e-13	NA	0.5711
2. PF	P54425	Uncharacterized transporter YbxG	4.44e-16	3.47e-27	NA	0.7371
2. PF	B5BB80	Divalent metal cation transporter MntH	5.81e-10	1.36e-07	NA	0.6493
2. PF	P44727	Tyrosine-specific transport protein 1	0.00e+00	2.22e-12	NA	0.6741
2. PF	E1W822	Aromatic amino acid transport protein AroP	0.00e+00	1.21e-26	NA	0.7053
2. PF	B7LMN9	Cation/acetate symporter ActP	1.23e-06	2.41e-05	NA	0.4062
2. PF	P37034	Uncharacterized transporter lpg1691	2.22e-16	4.80e-26	NA	0.7443
2. PF	E9F8M0	Transmembrane transporter swnT	1.35e-13	4.68e-13	NA	0.665
2. PF	Q03DK0	Divalent metal cation transporter MntH	6.88e-08	3.16e-03	NA	0.5694
2. PF	Q8ZCK2	Divalent metal cation transporter MntH	1.13e-09	1.05e-06	NA	0.6266
2. PF	B5BGF7	Threonine/serine transporter TdcC	1.24e-10	9.42e-08	NA	0.6327
2. PF	P94575	Probable allantoin permease	1.70e-07	1.11e-12	NA	0.5138
2. PF	B7M6R1	Divalent metal cation transporter MntH	2.65e-12	1.12e-06	NA	0.6422
2. PF	P0A4W1	L-asparagine permease 2	0.00e+00	9.91e-26	NA	0.6962
2. PF	Q5HGX9	Divalent metal cation transporter MntH	3.81e-08	1.59e-04	NA	0.591
2. PF	P0C217	Putative amino-acid transporter CPE0389	2.88e-09	5.87e-26	NA	0.6344
2. PF	A7ZUU1	Cation/acetate symporter ActP	1.30e-06	2.71e-05	NA	0.4097
2. PF	B5YZU5	Divalent metal cation transporter MntH	4.38e-12	1.12e-06	NA	0.6424
2. PF	Q5EA97	Putative sodium-coupled neutral amino acid transporter 11	9.77e-15	1.16e-03	NA	0.6133
2. PF	B2U0A0	Threonine/serine transporter TdcC	3.44e-09	3.23e-07	NA	0.6355
2. PF	B7LB16	Cation/acetate symporter ActP	4.71e-07	2.71e-05	NA	0.445
2. PF	Q9I703	Probable GABA permease	3.00e-15	4.10e-24	NA	0.6759
2. PF	B2K137	Cation/acetate symporter ActP	5.24e-07	2.90e-05	NA	0.4065
2. PF	B5BJZ5	Cation/acetate symporter ActP	4.06e-07	8.98e-05	NA	0.4154
2. PF	Q1QZ83	Divalent metal cation transporter MntH	1.05e-07	1.36e-03	NA	0.5711
2. PF	P40812	L-asparagine permease	7.77e-16	2.98e-20	NA	0.6537
2. PF	P65545	Divalent metal cation transporter MntH	2.15e-08	4.87e-05	NA	0.5381
2. PF	Q1CJV0	Divalent metal cation transporter MntH	1.11e-16	1.05e-06	NA	0.6291
2. PF	B7M7Y0	Cation/acetate symporter ActP	1.29e-06	5.26e-05	NA	0.4357
2. PF	A9R563	Cation/acetate symporter ActP	6.94e-07	4.70e-05	NA	0.3806
2. PF	Q8X968	Aromatic amino acid transport protein AroP	2.22e-16	2.11e-27	NA	0.6817
2. PF	O32257	Uncharacterized amino acid permease YvbW	2.20e-11	2.70e-28	NA	0.7032
2. PF	B5YS06	Threonine/serine transporter TdcC	1.12e-10	2.65e-07	NA	0.642
2. PF	Q8X5T7	Cation/acetate symporter ActP	4.59e-07	2.41e-05	NA	0.4146
2. PF	A6TAU9	Threonine/serine transporter TdcC	1.30e-10	1.31e-09	NA	0.6207
2. PF	P39570	Spore germination protein B2	0.00e+00	1.73e-06	NA	0.6977
2. PF	P0AAF2	Putrescine transporter PotE	8.19e-13	3.14e-23	NA	0.689
2. PF	A6U0S3	Divalent metal cation transporter MntH	4.01e-09	1.59e-04	NA	0.585
2. PF	C6D930	Cation/acetate symporter ActP	5.39e-07	4.49e-06	NA	0.414
2. PF	Q5L5E6	Arginine/agmatine antiporter	3.83e-11	2.72e-29	NA	0.5871
2. PF	P9WQM8	L-asparagine permease 1	0.00e+00	9.65e-27	NA	0.6997
2. PF	P0A188	Aromatic amino acid transport protein AroP	2.22e-16	1.21e-26	NA	0.7285
2. PF	P34054	Amino-acid permease inda1	7.22e-14	3.61e-07	NA	0.6253
2. PF	Q6D913	Cation/acetate symporter ActP	5.10e-07	3.76e-06	NA	0.4288
2. PF	P0A2N5	Inner membrane transporter YjeM	4.41e-13	1.21e-25	NA	0.6827
2. PF	Q7A0H2	Sodium/proline symporter	1.51e-06	5.89e-05	NA	0.4088
2. PF	P0ADA0	Branched-chain amino acid transport system 2 carrier protein	1.87e-08	1.78e-10	NA	0.5634
2. PF	A9MGK8	Cation/acetate symporter ActP	1.28e-06	6.58e-05	NA	0.4103
2. PF	B4JMC1	Sodium-dependent nutrient amino acid transporter 1	9.43e-07	1.91e-02	NA	0.4458
2. PF	Q46170	Arginine/ornithine antiporter	3.11e-13	1.35e-28	NA	0.602
2. PF	Q32BK1	Threonine/serine transporter TdcC	4.27e-09	3.66e-07	NA	0.6358
2. PF	Q8PKX1	Divalent metal cation transporter MntH	3.76e-09	1.25e-03	NA	0.5413
2. PF	Q1R8X4	Divalent metal cation transporter MntH	2.95e-12	1.12e-06	NA	0.6337
2. PF	Q9PK20	Arginine/agmatine antiporter	1.33e-09	8.68e-34	NA	0.6038
2. PF	B7N0B7	Threonine/serine transporter TdcC	3.65e-09	3.23e-07	NA	0.6364
2. PF	O66504	Uncharacterized protein aq_097	2.40e-12	2.80e-03	NA	0.6405
2. PF	B7LCE3	Divalent metal cation transporter MntH	6.00e-10	1.12e-06	NA	0.6334
2. PF	B3TP03	Cationic amino acid transporter 2	1.62e-08	4.93e-06	NA	0.5208
2. PF	Q5RAG7	Cystine/glutamate transporter	5.55e-16	3.67e-05	NA	0.634
2. PF	P63341	Inner membrane transport protein YqeG	3.06e-10	2.32e-09	NA	0.6635
2. PF	B5QZ97	Cation/acetate symporter ActP	4.69e-07	6.58e-05	NA	0.419
2. PF	Q2PG55	Sodium- and chloride-dependent GABA transporter 2	1.08e-06	4.81e-04	NA	0.5124
2. PF	P0AA83	Cytosine permease	9.13e-08	4.48e-08	NA	0.5604
2. PF	Q31TS7	Cation/acetate symporter ActP	4.30e-07	2.86e-05	NA	0.443
2. PF	O59942	Amino-acid permease 2	3.36e-09	3.99e-11	NA	0.6011
2. PF	Q9RPF4	Divalent metal cation transporter MntH	2.88e-10	1.51e-07	NA	0.6493
2. PF	P60063	Arginine/agmatine antiporter	0.00e+00	1.15e-24	NA	0.6229
2. PF	B1JFZ6	Divalent metal cation transporter MntH	1.09e-09	1.05e-06	NA	0.6279
2. PF	Q28I80	Y+L amino acid transporter 2	3.33e-16	1.41e-07	NA	0.6429
2. PF	B0B7U3	Arginine/agmatine antiporter	4.29e-11	1.91e-33	NA	0.6091
2. PF	A2X8M8	Polyamine transporter PUT1	0.00e+00	2.70e-04	NA	0.5779
2. PF	Q9PEL3	Divalent metal cation transporter MntH	2.69e-07	2.48e-04	NA	0.4946
2. PF	A1AG28	Threonine/serine transporter TdcC	1.20e-10	3.23e-07	NA	0.643
2. PF	B5FHX7	Threonine/serine transporter TdcC	1.28e-10	9.42e-08	NA	0.6236
2. PF	O07576	Uncharacterized amino acid permease YhdG	0.00e+00	7.17e-12	NA	0.6869
2. PF	B1LMI9	Divalent metal cation transporter MntH	2.32e-12	1.12e-06	NA	0.6351
2. PF	A2RI86	DL-alanine permease SerP2	4.00e-15	6.75e-23	NA	0.6976
2. PF	P0AAE7	Putative arginine/ornithine antiporter	5.55e-16	7.65e-24	NA	0.7058
2. PF	B7MB46	Threonine/serine transporter TdcC	1.05e-10	4.35e-07	NA	0.6327
2. PF	P46349	GABA permease	4.47e-11	8.75e-31	NA	0.6796
2. PF	P96589	Potassium transporter KimA	4.59e-10	3.92e-02	NA	0.6202
2. PF	A8ADJ8	Divalent metal cation transporter MntH	2.79e-10	9.18e-06	NA	0.6374
2. PF	Q31WR5	Threonine/serine transporter TdcC	1.24e-10	3.23e-07	NA	0.6555
2. PF	Q9RTP8	Divalent metal cation transporter MntH	4.08e-08	2.13e-03	NA	0.5514
2. PF	P9WIZ4	Divalent metal cation transporter MntH	8.62e-12	1.03e-02	NA	0.6132
2. PF	Q874L4	Vitamin B6 transporter TPN1	2.48e-07	1.43e-05	NA	0.4846
2. PF	B1LFL8	Threonine/serine transporter TdcC	1.05e-10	4.04e-07	NA	0.6459
2. PF	Q8ZLW1	Threonine/serine transporter TdcC	1.38e-10	9.42e-08	NA	0.6232
2. PF	Q87EJ9	Divalent metal cation transporter MntH	2.60e-07	4.81e-04	NA	0.515
2. PF	B2TXA0	Cation/acetate symporter ActP	4.80e-07	3.43e-05	NA	0.4195
2. PF	Q7A5N9	Putative branched-chain amino acid carrier protein SA1239	3.13e-11	5.21e-13	NA	0.5611
2. PF	P59737	Aromatic amino acid transport protein AroP	0.00e+00	7.99e-28	NA	0.7399
2. PF	B5XVZ7	Threonine/serine transporter TdcC	3.96e-09	1.31e-09	NA	0.6365
2. PF	C1L2Y0	Divalent metal cation transporter MntH	7.76e-09	2.00e-02	NA	0.545
2. PF	P9WQM4	Uncharacterized transporter MT2031	3.89e-15	3.32e-39	NA	0.6817
2. PF	Q83Q28	Threonine/serine transporter TdcC	2.63e-09	4.04e-07	NA	0.6321
2. PF	Q28039	Sodium- and chloride-dependent glycine transporter 1	4.43e-06	5.33e-03	NA	0.4839
2. PF	P0AAF0	Probable cadaverine/lysine antiporter	1.33e-13	3.69e-26	NA	0.6364
2. PF	Q6GAA9	Divalent metal cation transporter MntH	4.05e-09	1.59e-04	NA	0.5845
2. PF	B7NG10	Cation/acetate symporter ActP	4.15e-07	3.80e-05	NA	0.4385
2. PF	P0A189	Probable transport protein YifK	2.66e-15	3.62e-26	NA	0.6358
2. PF	O07577	Uncharacterized sodium-dependent transporter YhdH	3.17e-07	3.79e-08	NA	0.555
2. PF	Q98I99	Divalent metal cation transporter MntH	2.92e-09	3.81e-04	NA	0.5592
2. PF	O06493	Osmoregulated proline transporter OpuE	1.17e-06	8.86e-06	NA	0.3637
2. PF	P0AAE6	Putative arginine/ornithine antiporter	2.22e-16	7.65e-24	NA	0.7089
2. PF	P0A1W8	Branched-chain amino acid transport system 2 carrier protein	2.82e-09	4.88e-11	NA	0.487
2. PF	C6D9J9	Divalent metal cation transporter MntH	5.43e-10	8.46e-06	NA	0.6268
2. PF	B6I6U2	Divalent metal cation transporter MntH	4.36e-12	1.12e-06	NA	0.6426
2. PF	A0AIM7	Divalent metal cation transporter MntH	1.05e-08	2.42e-02	NA	0.5275
2. PF	Q4L5B9	Divalent metal cation transporter MntH	4.97e-08	1.27e-03	NA	0.5918
2. PF	Q0TCY8	Threonine/serine transporter TdcC	3.54e-09	3.23e-07	NA	0.6296
2. PF	Q7YQK4	Large neutral amino acids transporter small subunit 1	2.22e-16	1.46e-06	NA	0.6681
2. PF	A5IRZ2	Divalent metal cation transporter MntH	4.03e-09	1.59e-04	NA	0.582
2. PF	Q2YX69	Divalent metal cation transporter MntH	3.61e-08	1.52e-04	NA	0.547
2. PF	B0BC08	Arginine/agmatine antiporter	6.13e-10	1.91e-33	NA	0.6224
2. PF	P57864	Uncharacterized protein PM0681	9.15e-08	1.44e-06	NA	0.5604
2. PF	Q53584	Sodium/proline symporter	7.50e-07	1.66e-04	NA	0.4113
2. PF	O34618	Uncharacterized amino acid permease YtnA	1.11e-15	9.24e-28	NA	0.6877
2. PF	Q38UX8	Divalent metal cation transporter MntH	5.27e-09	1.83e-03	NA	0.5933
2. PF	B7MSH6	Cation/acetate symporter ActP	1.38e-06	6.73e-05	NA	0.4094
2. PF	Q5PCA8	Threonine/serine transporter TdcC	1.34e-10	9.42e-08	NA	0.6265
2. PF	P47467	Uncharacterized protein MG225	1.11e-16	2.58e-40	NA	0.6738
2. PF	A7FGC8	Divalent metal cation transporter MntH	1.13e-09	1.05e-06	NA	0.6325
2. PF	O07002	Aspartate-proton symporter	1.11e-15	2.24e-32	NA	0.5923
2. PF	Q8Z4X5	Divalent metal cation transporter MntH	5.82e-10	1.36e-07	NA	0.6508
2. PF	Q3KLY0	Arginine/agmatine antiporter	5.31e-10	2.58e-30	NA	0.605
2. PF	P44615	Serine transporter SdaC	9.90e-09	1.49e-07	NA	0.6706
2. PF	P0AAD9	Threonine/serine transporter TdcC	5.11e-09	2.65e-07	NA	0.6342
2. PF	P39636	Amino-acid permease RocC	3.33e-16	8.20e-27	NA	0.6391
2. PF	A2RI97	Histidine permease HisP	1.09e-10	1.67e-26	NA	0.6443
2. PF	Q8ZJ73	Cation/acetate symporter ActP	5.71e-07	4.70e-05	NA	0.4065
2. PF	B7MH51	Divalent metal cation transporter MntH	3.11e-10	1.12e-06	NA	0.641
2. PF	P48055	Sodium- and chloride-dependent betaine transporter	8.96e-07	7.91e-03	NA	0.5355
2. PF	Q03TH5	Divalent metal cation transporter MntH	8.07e-08	4.19e-03	NA	0.5444
2. PF	Q50103	Divalent metal cation transporter MntH	1.07e-06	1.59e-02	NA	0.557
2. PF	A1JIK1	Cation/acetate symporter ActP	6.27e-07	3.97e-05	NA	0.4373
2. PF	Q7NA72	Cation/acetate symporter ActP	1.90e-06	7.80e-06	NA	0.4187
2. PF	Q1R6L7	Threonine/serine transporter TdcC	1.42e-10	3.23e-07	NA	0.6505
2. PF	A1JIM8	Threonine/serine transporter TdcC	1.02e-10	2.50e-08	NA	0.6376
2. PF	B7NJY3	Threonine/serine transporter TdcC	1.24e-10	2.65e-07	NA	0.6454
2. PF	Q99SY5	Sodium/proline symporter	4.45e-07	5.89e-05	NA	0.4139
2. PF	P9WQM2	Uncharacterized transporter MT2055	1.44e-15	5.09e-18	NA	0.6738
2. PF	A8I499	Cationic amino acid transporter 2	7.28e-09	9.43e-07	NA	0.4701
2. PF	Q2YY11	Putative branched-chain amino acid carrier protein SAB1263c	3.25e-11	1.17e-13	NA	0.578
2. PF	B1IX71	Divalent metal cation transporter MntH	2.89e-10	1.12e-06	NA	0.6362
2. PF	B4TVX7	Threonine/serine transporter TdcC	1.46e-10	9.42e-08	NA	0.6199
2. PF	A1L3M3	Y+L amino acid transporter 2	5.55e-16	4.26e-09	NA	0.6301
2. PF	Q4L6B4	Putative branched-chain amino acid carrier protein SH1502	4.25e-11	1.85e-12	NA	0.5238
2. PF	B7N5Z2	Divalent metal cation transporter MntH	6.84e-12	1.12e-06	NA	0.6412
2. PF	P94369	Putative purine-cytosine permease YxlA	5.37e-09	6.69e-10	NA	0.5361
2. PF	P28785	Low affinity tryptophan permease	0.00e+00	3.93e-14	NA	0.5839
2. PF	B5R937	Cation/acetate symporter ActP	4.42e-07	7.03e-05	NA	0.446
2. PF	P0AAE1	D-serine/D-alanine/glycine transporter	4.44e-16	6.55e-21	NA	0.7311
2. PF	Q5RAE3	Large neutral amino acids transporter small subunit 2	3.33e-16	2.64e-10	NA	0.644
2. PF	Q02DS7	Tryptophan-specific transport protein	0.00e+00	2.21e-13	NA	0.6586
2. PF	B1LPN2	Cation/acetate symporter ActP	4.19e-07	4.81e-05	NA	0.4428
2. PF	Q9X7P0	L-asparagine permease	0.00e+00	2.00e-22	NA	0.6889
2. PF	A7E3U5	Putative sodium-coupled neutral amino acid transporter 7	1.00e-13	3.10e-02	NA	0.6043
2. PF	A9MPR1	Threonine/serine transporter TdcC	1.03e-10	8.73e-08	NA	0.6269
2. PF	C0PZ16	Threonine/serine transporter TdcC	1.20e-10	9.42e-08	NA	0.6232
2. PF	A6TC38	Divalent metal cation transporter MntH	6.49e-10	8.26e-06	NA	0.6423
2. PF	O30417	Glutamate/gamma-aminobutyrate antiporter	1.67e-15	5.53e-19	NA	0.6882
2. PF	A1ADR7	Divalent metal cation transporter MntH	3.18e-10	1.12e-06	NA	0.6427
2. PF	Q6DCE8	Cationic amino acid transporter 2	7.94e-09	1.88e-06	NA	0.5418
2. PF	P39599	Uncharacterized symporter YwcA	3.00e-07	5.20e-05	NA	0.4355
2. PF	B2K911	Divalent metal cation transporter MntH	9.12e-10	1.05e-06	NA	0.628
2. PF	Q6G831	Sodium/proline symporter	4.82e-07	5.89e-05	NA	0.4117
2. PF	Q0TU56	Putative amino-acid transporter CPF_0377	2.17e-09	5.87e-26	NA	0.6326
2. PF	Q5E5M9	Glutamine transporter 2	0.00e+00	2.86e-06	NA	0.7552
2. PF	A5IU69	Sodium/proline symporter	9.94e-07	5.89e-05	NA	0.4101
2. PF	A8A7G7	Cation/acetate symporter ActP	5.26e-07	5.26e-05	NA	0.4416
2. PF	P94383	Uncharacterized transporter YcgH	0.00e+00	1.74e-25	NA	0.7403
2. PF	A8A4S9	Threonine/serine transporter TdcC	3.49e-09	2.65e-07	NA	0.6348
2. PF	A0A0H2VDI7	D-serine/D-alanine/glycine transporter	4.44e-16	4.01e-22	NA	0.7208
2. PF	Q876K6	General amino acid permease AGP1	7.85e-14	4.81e-02	NA	0.5717
2. PF	Q7TZ67	Uncharacterized transporter Mb2001c	3.22e-15	3.09e-39	NA	0.7038
2. PF	Q8R7S2	Divalent metal cation transporter MntH	1.08e-09	5.26e-05	NA	0.5673
2. PF	P60065	Arginine/agmatine antiporter	0.00e+00	1.66e-24	NA	0.6667
2. PF	P44747	Tyrosine-specific transport protein 2	0.00e+00	1.09e-10	NA	0.6802
2. PF	B4TQE4	Divalent metal cation transporter MntH	2.18e-12	1.36e-07	NA	0.6358
2. PF	O87394	Uncharacterized transporter R00093	0.00e+00	2.01e-19	NA	0.6285
2. PF	C5A160	Cation/acetate symporter ActP	4.36e-07	2.71e-05	NA	0.4434
2. PF	Q0T9Y2	Cation/acetate symporter ActP	4.55e-07	4.81e-05	NA	0.4178
2. PF	B7NSM7	Cation/acetate symporter ActP	4.46e-07	4.81e-05	NA	0.3248
2. PF	Q1CE35	Cation/acetate symporter ActP	1.98e-06	4.70e-05	NA	0.4383
2. PF	P45174	Sodium/proline symporter	8.29e-07	2.90e-05	NA	0.4852
2. PF	Q32DF6	Divalent metal cation transporter MntH	2.05e-12	1.90e-06	NA	0.639
2. PF	P0AAD5	Tyrosine-specific transport protein	0.00e+00	2.95e-12	NA	0.7187
2. PF	B7LQI2	Threonine/serine transporter TdcC	9.82e-11	9.72e-09	NA	0.6222
2. PF	P18696	Proline-specific permease	6.77e-15	8.46e-10	NA	0.6047
2. PF	P0A770	Divalent metal cation transporter MntH	2.45e-12	1.12e-06	NA	0.6387
2. PF	Q797A7	Methylthioribose transporter	7.66e-15	1.50e-14	NA	0.6854
2. PF	A2RJ04	Branched-chain amino acid transport system carrier protein	2.32e-08	2.33e-14	NA	0.5044
2. PF	O05087	Uncharacterized membrane protein HI_1728	2.26e-09	2.62e-09	NA	0.6954
2. PF	B5FRF0	Cation/acetate symporter ActP	4.52e-07	6.58e-05	NA	0.419
2. PF	A7X111	Divalent metal cation transporter MntH	3.56e-08	1.61e-04	NA	0.5845
2. PF	Q8FDC3	Threonine/serine transporter TdcC	3.31e-09	3.23e-07	NA	0.6298
2. PF	A6QFW1	Divalent metal cation transporter MntH	4.11e-09	1.59e-04	NA	0.5906
2. PF	Q0T0F2	Threonine/serine transporter TdcC	3.67e-09	4.04e-07	NA	0.6443
2. PF	B4TEB2	Cation/acetate symporter ActP	4.93e-07	8.98e-05	NA	0.4165
2. PF	B7LL85	Divalent metal cation transporter MntH	4.27e-12	1.12e-06	NA	0.6307
2. PF	P35865	L-lysine transport protein	2.22e-16	5.60e-30	NA	0.6389
2. PF	A2RNI1	Arginine/ornithine antiporter ArcD2	3.45e-13	7.86e-33	NA	0.6318
2. PF	Q7A0W9	Putative branched-chain amino acid carrier protein MW1297	3.19e-11	5.21e-13	NA	0.5708
2. PF	A7N307	Divalent metal cation transporter MntH	8.86e-09	9.53e-03	NA	0.6349
2. PF	B7M023	Threonine/serine transporter TdcC	1.30e-10	3.23e-07	NA	0.6431
2. PF	A1AIQ8	Cation/acetate symporter ActP	4.76e-07	6.73e-05	NA	0.4159
2. PF	Q5HQ64	Divalent metal cation transporter MntH	6.06e-08	4.15e-04	NA	0.5943
2. PF	A4WD10	Divalent metal cation transporter MntH	5.28e-10	5.44e-07	NA	0.6444
2. PF	Q5PJ05	Cation/acetate symporter ActP	4.86e-07	8.98e-05	NA	0.3733
2. PF	O34560	Uncharacterized amino acid permease YecA	5.55e-16	3.64e-20	NA	0.7053
2. PF	Q8P8R8	Divalent metal cation transporter MntH	4.51e-09	3.31e-02	NA	0.5157
2. PF	Q3YUR7	Cation/acetate symporter ActP	4.20e-07	5.20e-05	NA	0.4437
2. PF	B2VDY7	Divalent metal cation transporter MntH	3.50e-10	4.49e-06	NA	0.6359
2. PF	P0CK99	Aromatic amino acid transport protein AroP	2.22e-16	1.21e-26	NA	0.7134
2. PF	Q492G8	Divalent metal cation transporter MntH	6.39e-09	1.43e-05	NA	0.6444
2. PF	B2TWY8	Divalent metal cation transporter MntH	2.50e-12	1.12e-06	NA	0.6366
2. PF	P0A2N4	Inner membrane transporter YjeM	5.63e-13	1.21e-25	NA	0.6753
2. PF	Q255I1	Arginine/agmatine antiporter	3.30e-11	3.26e-28	NA	0.6079
2. PF	O67304	Peptide transporter CstA	1.24e-07	8.64e-03	NA	0.5309
2. PF	Q9Z6M8	Arginine/agmatine antiporter	5.55e-16	7.56e-30	NA	0.6047
2. PF	Q8NS49	Monocarboxylic acid transporter	3.42e-07	1.83e-04	NA	0.4992
2. PF	A4TS08	Cation/acetate symporter ActP	5.54e-07	4.70e-05	NA	0.4065
2. PF	O34383	Uncharacterized sodium-dependent transporter YocR	1.20e-07	8.40e-09	NA	0.5485
2. PF	Q0BW85	Divalent metal cation transporter MntH	3.22e-07	2.70e-04	NA	0.5738
2. PF	B1XGT1	Threonine/serine transporter TdcC	1.22e-10	2.65e-07	NA	0.6428
2. PF	O84379	Arginine/agmatine antiporter	6.24e-10	2.58e-30	NA	0.5977
2. PF	Q9N1Q4	Large neutral amino acids transporter small subunit 2	3.33e-16	8.77e-07	NA	0.6333
2. PF	P65544	Divalent metal cation transporter MntH	1.73e-08	4.87e-05	NA	0.5128
2. PF	D4AU27	Swainsonine transporter swnT	2.86e-11	7.58e-10	NA	0.6578
2. PF	C4ZVS8	Divalent metal cation transporter MntH	4.59e-12	1.12e-06	NA	0.6306
2. PF	Q92BT1	Divalent metal cation transporter MntH	7.03e-09	2.62e-02	NA	0.5324
2. PF	O06005	Amino-acid permease AapA	0.00e+00	2.60e-21	NA	0.7123
2. PF	O32204	Putative arginine/ornithine antiporter	0.00e+00	4.92e-30	NA	0.7089
2. PF	A8AN31	Cation/acetate symporter ActP	4.32e-07	3.93e-05	NA	0.4155
2. PF	Q1R3J9	Cation/acetate symporter ActP	4.81e-07	6.73e-05	NA	0.4157
2. PF	P18275	Arginine/ornithine antiporter	3.76e-12	4.71e-29	NA	0.657
2. PF	B7UPN5	Cation/acetate symporter ActP	4.32e-07	6.73e-05	NA	0.4444
2. PF	A7ZPK2	Divalent metal cation transporter MntH	5.10e-12	1.12e-06	NA	0.6362
2. PF	Q8ZKF8	Cation/acetate symporter ActP	4.40e-07	8.98e-05	NA	0.4174
2. PF	B5Z1C8	Cation/acetate symporter ActP	4.50e-07	2.41e-05	NA	0.4423
2. PF	P9WQM6	L-asparagine permease 2	0.00e+00	9.91e-26	NA	0.6916
2. PF	Q2FFJ3	Sodium/proline symporter	1.67e-06	7.44e-05	NA	0.416
2. PF	Q57GV4	Cation/acetate symporter ActP	4.45e-07	1.41e-04	NA	0.4155
2. PF	Q8CPM6	Divalent metal cation transporter MntH	2.76e-07	3.50e-04	NA	0.5908
2. PF	C0Q552	Cation/acetate symporter ActP	3.83e-07	9.28e-05	NA	0.46
2. PF	Q4A070	Sodium/proline symporter 1	6.03e-07	1.18e-04	NA	0.3559
2. PF	B4T1W9	Cation/acetate symporter ActP	4.89e-07	8.22e-05	NA	0.447
2. PF	Q5HPD5	Putative branched-chain amino acid carrier protein SERP0977	2.74e-11	3.37e-15	NA	0.5217
2. PF	P0AAE3	Proline-specific permease ProY	0.00e+00	5.97e-28	NA	0.7091
2. PF	P0AA48	Low-affinity putrescine importer PlaP	5.65e-12	1.33e-19	NA	0.602
2. PF	B4T6B2	Threonine/serine transporter TdcC	1.68e-10	3.89e-08	NA	0.6285
2. PF	A1JLC3	Divalent metal cation transporter MntH	1.04e-09	7.44e-06	NA	0.6377
2. PF	Q57JL7	Threonine/serine transporter TdcC	1.14e-10	9.42e-08	NA	0.6244
2. PF	C4ZR30	Threonine/serine transporter TdcC	1.27e-10	2.65e-07	NA	0.6553
2. PF	P25185	Branched-chain amino acid transport system 3 carrier protein	1.15e-08	7.27e-12	NA	0.5302
2. PF	Q9RPF2	Divalent metal cation transporter MntH 2	3.07e-09	7.42e-04	NA	0.4906
2. PF	B7UGA0	Divalent metal cation transporter MntH	6.07e-12	7.67e-07	NA	0.6379
2. PF	Q49YU6	Sodium/proline symporter 2	8.56e-07	1.51e-05	NA	0.3683
2. PF	O53092	Arginine/ornithine antiporter	2.88e-11	3.88e-30	NA	0.6362
2. PF	P44614	Tryptophan-specific transport protein	0.00e+00	9.57e-14	NA	0.6374
2. PF	B7MJT5	Cation/acetate symporter ActP	4.36e-07	6.73e-05	NA	0.3681
2. PF	Q5PNF0	Divalent metal cation transporter MntH	2.32e-12	1.36e-07	NA	0.6473
2. PF	A9N1R2	Cation/acetate symporter ActP	4.20e-07	8.98e-05	NA	0.4431
2. PF	Q66FN0	Cation/acetate symporter ActP	5.00e-07	2.90e-05	NA	0.4015
2. PF	B5XVU3	Divalent metal cation transporter MntH	2.89e-10	1.12e-05	NA	0.6299
2. PF	Q8X845	Probable fructoselysine/psicoselysine transporter FrlA	0.00e+00	1.14e-25	NA	0.7151
2. PF	Q822F2	Arginine/agmatine antiporter	1.37e-12	1.37e-26	NA	0.5977
2. PF	Q7VEQ4	L-asparagine permease 1	1.55e-15	1.14e-26	NA	0.6847
2. PF	P60066	Arginine/agmatine antiporter	0.00e+00	1.66e-24	NA	0.6325
2. PF	Q71ZP6	Divalent metal cation transporter MntH	9.68e-09	2.00e-02	NA	0.5015
2. PF	Q99UZ7	Divalent metal cation transporter MntH	4.03e-09	1.59e-04	NA	0.5473
2. PF	P44768	Putrescine transporter PotE	9.26e-13	2.26e-23	NA	0.6755
2. PF	P19072	Branched-chain amino acid transport system 2 carrier protein	1.78e-08	1.75e-13	NA	0.4732
2. PF	P75463	Uncharacterized protein MG225 homolog	9.11e-14	3.81e-43	NA	0.6808
2. PF	Q57LU5	Divalent metal cation transporter MntH	2.48e-10	1.51e-07	NA	0.65
2. PF	P44963	Sodium/pantothenate symporter	1.50e-06	7.12e-07	NA	0.4001
2. PF	B7LH53	Threonine/serine transporter TdcC	1.21e-10	3.23e-07	NA	0.6466
2. PF	Q8ZSB0	Divalent metal cation transporter MntH	1.62e-08	2.67e-04	NA	0.5522
2. PF	A5PJX7	Sodium- and chloride-dependent GABA transporter 2	1.19e-06	2.09e-03	NA	0.5338
2. PF	B1XCV3	Cation/acetate symporter ActP	5.10e-07	2.71e-05	NA	0.4152
2. PF	P42087	Putative histidine permease	5.55e-16	7.95e-24	NA	0.6842
2. PF	A8AQ08	Threonine/serine transporter TdcC	1.99e-10	1.96e-07	NA	0.6186
2. PF	Q8XAF5	Serine transporter	0.00e+00	8.29e-08	NA	0.5614
2. PF	Q6GH01	Putative branched-chain amino acid carrier protein SAR1419	3.92e-11	3.78e-13	NA	0.553
2. PF	P47468	Uncharacterized protein MG226	0.00e+00	8.93e-39	NA	0.7101
2. PF	Q83QD0	Serine transporter SdaC	2.08e-09	1.59e-06	NA	0.6304
2. PF	Q8Y773	Divalent metal cation transporter MntH	5.98e-09	2.00e-02	NA	0.5368
2. PF	Q31Y80	Divalent metal cation transporter MntH	5.84e-10	1.12e-06	NA	0.6335
2. PF	P45320	Uncharacterized sodium-dependent transporter HI_1690	7.03e-07	5.03e-08	NA	0.5844
2. PF	A7ZS06	Threonine/serine transporter TdcC	1.32e-10	2.65e-07	NA	0.6553
2. PF	A7X430	Sodium/proline symporter	1.56e-06	5.89e-05	NA	0.4293
2. PF	D0ZE09	Threonine/serine transporter TdcC	1.56e-09	7.78e-08	NA	0.6305
2. PF	Q4G4A7	Threonine/serine transporter TdcC	1.59e-09	1.51e-07	NA	0.6269
2. PF	A7MP48	Divalent metal cation transporter MntH	3.58e-12	5.24e-07	NA	0.6485
2. PF	Q83P94	Cation/acetate symporter ActP	1.24e-06	1.91e-04	NA	0.4178
2. PF	A8A2P6	Divalent metal cation transporter MntH	5.47e-12	2.39e-06	NA	0.6409
2. PF	P96704	Uncharacterized transporter YdgF	0.00e+00	5.52e-20	NA	0.7286
2. PF	B1IUI4	Cation/acetate symporter ActP	1.26e-06	2.71e-05	NA	0.4082
2. PF	B5F2E9	Cation/acetate symporter ActP	3.97e-07	8.98e-05	NA	0.4131
2. PF	Q8CP86	Putative branched-chain amino acid carrier protein SE_1090	2.51e-11	1.54e-14	NA	0.5179
2. PF	Q8XB33	Low affinity tryptophan permease	0.00e+00	5.97e-17	NA	0.6821
2. PF	B1X9R3	Divalent metal cation transporter MntH	3.07e-10	1.12e-06	NA	0.64
2. PF	P07869	Spore germination protein A2	0.00e+00	4.77e-02	NA	0.6719
2. PF	P43059	Lysine/arginine permease	8.77e-10	9.42e-08	NA	0.6006
2. PF	Q2FHX5	Divalent metal cation transporter MntH	4.32e-08	1.59e-04	NA	0.5783
2. PF	Q1C5Y6	Divalent metal cation transporter MntH	2.22e-16	1.05e-06	NA	0.6285
4. PB	Q9QXA6	b(0,+)-type amino acid transporter 1	1.11e-16	2.31e-07	8.19e-04	NA
4. PB	P82251	b(0,+)-type amino acid transporter 1	1.11e-16	2.77e-09	0.002	NA
4. PB	Q9WTR6	Cystine/glutamate transporter	1.22e-15	5.68e-06	7.41e-06	NA
4. PB	Q8W4K3	Cationic amino acid transporter 4, vacuolar	3.26e-09	1.27e-08	0.025	NA
4. PB	Q01650	Large neutral amino acids transporter small subunit 1	1.11e-16	2.71e-07	0.023	NA
4. PB	P82252	b(0,+)-type amino acid transporter 1	1.11e-16	2.85e-07	0.034	NA
5. P	A0A1D8PNP3	Amino-acid permease GAP6	2.68e-14	1.94e-11	NA	NA
5. P	Q9FFL1	Polyamine transporter RMV1	0.00e+00	2.76e-04	NA	NA
5. P	Q9C9J0	Lysine histidine transporter-like 5	1.76e-07	3.50e-03	NA	NA
5. P	P54104	Branched-chain amino acid transport system carrier protein	4.23e-08	5.22e-17	NA	NA
5. P	P31646	Sodium- and chloride-dependent GABA transporter 2	1.14e-06	5.07e-03	NA	NA
5. P	Q7MKP8	Multidrug resistance protein NorM	4.15e-05	3.43e-03	NA	NA
5. P	Q63S57	Probable multidrug resistance protein NorM	3.47e-05	9.62e-03	NA	NA
5. P	Q6JWR2	Putative sodium-coupled neutral amino acid transporter 7	1.58e-08	3.88e-02	NA	NA
5. P	Q0B8F7	Divalent metal cation transporter MntH	3.52e-09	1.02e-02	NA	NA
5. P	P0AAF1	Putrescine transporter PotE	8.35e-13	3.14e-23	NA	NA
5. P	P40901	Sexual differentiation process putative amino-acid permease isp5	8.10e-14	1.22e-03	NA	NA
5. P	Q8UDF5	Probable multidrug resistance protein NorM	8.70e-05	3.46e-04	NA	NA
5. P	Q9P5N2	Amino acid transporter 1	5.41e-14	2.96e-06	NA	NA
5. P	Q03583	Putative O-antigen transporter	3.03e-04	7.68e-03	NA	NA
5. P	P9WQM5	Uncharacterized transporter Rv1979c	2.11e-12	3.32e-39	NA	NA
5. P	P67445	Xanthine permease XanQ	9.60e-04	7.90e-04	NA	NA
5. P	B5BP45	Uncharacterized amino-acid permease C460.01c	4.84e-14	1.56e-07	NA	NA
5. P	P9WIZ5	Divalent metal cation transporter MntH	5.21e-07	1.03e-02	NA	NA
5. P	P0AGN0	Xanthine permease XanP	2.20e-03	7.10e-03	NA	NA
5. P	P36029	Polyamine transporter TPO5	1.58e-08	2.64e-05	NA	NA
5. P	Q9WZS2	Probable multidrug resistance protein NorM	1.08e-04	2.82e-02	NA	NA
5. P	Q8UEM1	Divalent metal cation transporter MntH	5.93e-09	1.52e-02	NA	NA
5. P	D4GU68	Probable low-salt glycan biosynthesis flippase Agl15	6.82e-04	9.25e-03	NA	NA
5. P	P0A1W9	Branched-chain amino acid transport system 2 carrier protein	2.75e-09	4.88e-11	NA	NA
5. P	Q6R4Q5	Sodium/glucose cotransporter 5	6.09e-07	3.20e-03	NA	NA
5. P	Q52981	Probable K(+)/H(+) antiporter subunit D	2.20e-04	2.40e-02	NA	NA
5. P	P0AAD4	Tyrosine-specific transport protein	0.00e+00	2.95e-12	NA	NA
5. P	Q12119	Purine-cytosine permease FCY22	9.42e-08	8.14e-03	NA	NA
5. P	P28573	Sodium-dependent proline transporter	2.11e-06	1.80e-02	NA	NA
5. P	Q9ZDE9	Uncharacterized protein RP382	4.92e-05	4.49e-06	NA	NA
5. P	P40074	Vacuolar amino acid transporter 6	3.04e-07	2.86e-05	NA	NA
5. P	P9WQM7	L-asparagine permease 2	0.00e+00	9.91e-26	NA	NA
5. P	A6QID0	Sodium/proline symporter	1.56e-06	8.49e-05	NA	NA
5. P	P49940	Spore germination protein KB	4.23e-08	4.32e-03	NA	NA
5. P	O32139	Uric acid permease PucJ	3.44e-04	1.60e-03	NA	NA
5. P	Q59I64	Y+L amino acid transporter 2	1.11e-16	4.87e-17	NA	NA
5. P	P31651	Sodium- and chloride-dependent betaine transporter	1.26e-06	1.33e-03	NA	NA
5. P	B4NDL8	Sodium-dependent nutrient amino acid transporter 1	8.11e-07	4.86e-04	NA	NA
5. P	Q69LA1	Probable proline transporter 2	3.15e-12	2.18e-02	NA	NA
5. P	Q5E733	N-acetylneuraminate transporter	1.31e-06	2.48e-04	NA	NA
5. P	O14035	Uncharacterized permease C29B12.14c	9.13e-07	1.47e-04	NA	NA
5. P	Q8BGK6	Y+L amino acid transporter 2	2.22e-16	7.04e-07	NA	NA
5. P	P30144	Na(+)-linked D-alanine glycine permease	7.65e-06	4.28e-03	NA	NA
5. P	Q5RKI7	Solute carrier family 7 member 13	6.39e-13	1.31e-17	NA	NA
5. P	Q9RPF3	Divalent metal cation transporter MntH 1	6.94e-09	2.04e-04	NA	NA
5. P	P31448	Uncharacterized symporter YidK	5.15e-07	2.42e-06	NA	NA
5. P	P43548	General amino acid permease AGP3	3.14e-09	2.20e-09	NA	NA
5. P	B3W6P3	Divalent metal cation transporter MntH	5.51e-10	1.08e-03	NA	NA
5. P	Q9HR72	Putative dimethyl sulfoxide reductase membrane subunit C	2.95e-03	8.77e-04	NA	NA
5. P	P23173	Low affinity tryptophan permease	0.00e+00	3.35e-16	NA	NA
5. P	Q9RY44	Probable multidrug resistance protein NorM	5.16e-05	3.13e-02	NA	NA
5. P	O06754	Branched-chain amino acid transport system carrier protein	2.02e-07	2.64e-15	NA	NA
5. P	O33683	Uncharacterized protein RA0937	4.58e-04	2.41e-03	NA	NA
5. P	B5XXT7	Cation/acetate symporter ActP	1.62e-06	1.69e-05	NA	NA
5. P	Q7A4Q7	Sodium/proline symporter	1.53e-06	5.89e-05	NA	NA
5. P	P16256	Sodium/pantothenate symporter	1.32e-06	2.04e-07	NA	NA
5. P	D6R8X8	Hydantoin permease	5.47e-07	7.23e-14	NA	NA
5. P	Q9C0Z0	Uncharacterized amino-acid permease PB24D3.02c	1.45e-09	1.48e-10	NA	NA
5. P	Q9NS82	Asc-type amino acid transporter 1	3.33e-16	1.97e-06	NA	NA
5. P	P0A769	Divalent metal cation transporter MntH	3.05e-10	1.12e-06	NA	NA
5. P	P41006	Uracil permease	1.86e-03	3.61e-04	NA	NA
5. P	P0AAE2	Proline-specific permease ProY	0.00e+00	5.97e-28	NA	NA
5. P	Q9CPL9	Probable uracil permease	2.95e-03	3.71e-02	NA	NA
5. P	Q27946	Natural resistance-associated macrophage protein 1	2.25e-07	4.23e-03	NA	NA
5. P	Q7N1G0	Probable multidrug resistance protein NorM	4.81e-05	4.92e-04	NA	NA
5. P	P41251	Natural resistance-associated macrophage protein 1	1.51e-07	8.98e-03	NA	NA
5. P	Q99U80	Putative branched-chain amino acid carrier protein SAV1407	3.22e-11	5.21e-13	NA	NA
5. P	Q92367	Amino-acid permease 1	2.20e-14	1.81e-03	NA	NA
5. P	Q9P5N4	Uncharacterized amino-acid permease C359.01	1.17e-13	3.00e-06	NA	NA
5. P	Q05998	Thiamine transporter	4.87e-06	1.02e-02	NA	NA
5. P	P0AGM7	Uracil permease	7.56e-04	4.23e-03	NA	NA
5. P	Q5QWR6	Probable multidrug resistance protein NorM	2.10e-05	4.81e-02	NA	NA
5. P	Q5HEM0	Sodium/proline symporter	1.72e-06	5.89e-05	NA	NA
5. P	P0AGN1	Xanthine permease XanP	1.93e-03	7.10e-03	NA	NA
5. P	P07117	Sodium/proline symporter	5.96e-07	7.73e-04	NA	NA
5. P	P63116	Asc-type amino acid transporter 1	2.22e-16	5.62e-06	NA	NA
5. P	P94499	Branched-chain amino acid transport system carrier protein BrnQ	1.83e-08	6.38e-14	NA	NA
5. P	O08812	Cationic amino acid transporter 3	6.51e-08	8.19e-08	NA	NA
5. P	P56436	Natural resistance-associated macrophage protein 1	2.93e-08	3.72e-03	NA	NA
5. P	P41815	Valine amino-acid permease	3.09e-11	1.16e-04	NA	NA
5. P	Q6DEL1	Putative sodium-coupled neutral amino acid transporter 7	9.06e-09	2.10e-02	NA	NA
5. P	B5D5N9	Cationic amino acid transporter 2	1.62e-08	2.57e-06	NA	NA
5. P	P04817	Arginine permease CAN1	1.93e-11	7.73e-04	NA	NA
5. P	Q9ZU50	Amino-acid permease BAT1	6.17e-10	4.74e-11	NA	NA
5. P	Q8X691	Cytosine permease	9.04e-08	2.70e-08	NA	NA
5. P	Q7XBS0	Urea-proton symporter DUR3	8.97e-07	4.86e-02	NA	NA
5. P	O74543	Uncharacterized amino-acid permease C777.04	2.89e-15	5.00e-10	NA	NA
5. P	Q89W72	Probable multidrug resistance protein NorM	6.19e-05	3.04e-02	NA	NA
5. P	Q09887	Uncharacterized amino-acid permease C584.13	7.81e-11	8.40e-11	NA	NA
5. P	Q9C0V0	Probable amino-acid permease PB1C11.02	2.94e-12	2.78e-13	NA	NA
5. P	P9WQM9	L-asparagine permease 1	6.66e-16	9.65e-27	NA	NA
5. P	P53099	Vitamin B6 transporter TPN1	2.27e-07	1.77e-05	NA	NA
5. P	P48056	Sodium- and chloride-dependent betaine transporter	1.39e-06	2.43e-03	NA	NA
5. P	P77400	Inner membrane transport protein YbaT	0.00e+00	1.34e-25	NA	NA
5. P	P0AA47	Low-affinity putrescine importer PlaP	4.99e-12	1.33e-19	NA	NA
5. P	Q9SJP9	Proline transporter 3	2.76e-07	8.07e-04	NA	NA
5. P	P39755	Probable inorganic carbon transporter subunit DabB	2.74e-03	1.16e-03	NA	NA
5. P	Q58715	Uncharacterized sodium-dependent transporter MJ1319	2.54e-07	3.93e-14	NA	NA
5. P	P48065	Sodium- and chloride-dependent betaine transporter	9.65e-07	4.11e-03	NA	NA
5. P	Q9LH39	Probable polyamine transporter At3g19553	0.00e+00	5.21e-13	NA	NA
5. P	B4R4T6	Sodium-dependent nutrient amino acid transporter 1	1.48e-06	4.20e-05	NA	NA
5. P	Q8EIX5	FAD transporter	8.75e-05	2.77e-02	NA	NA
5. P	P44849	Uncharacterized sodium-dependent transporter HI_0736	1.38e-07	4.98e-16	NA	NA
5. P	P31649	Sodium- and chloride-dependent GABA transporter 2	1.03e-06	1.56e-02	NA	NA
5. P	Q7N3V2	Multidrug resistance protein MdtK	3.65e-05	1.59e-02	NA	NA
5. P	Q22397	Amino acid transporter protein 6	1.11e-16	8.30e-12	NA	NA
5. P	Q84MA5	Cationic amino acid transporter 1	1.16e-08	1.09e-06	NA	NA
5. P	Q28610	Sodium/glucose cotransporter 5	5.14e-07	1.29e-04	NA	NA
5. P	P38085	Valine/tyrosine/tryptophan amino-acid permease 1	1.04e-12	1.41e-03	NA	NA
5. P	P27837	Probable transport protein YifK	2.78e-15	2.32e-24	NA	NA
5. P	Q9C6B2	Metal transporter Nramp2	1.13e-07	1.39e-02	NA	NA
5. P	Q9FN18	Metal transporter Nramp4	1.29e-07	5.49e-06	NA	NA
5. P	Q9UPY5	Cystine/glutamate transporter	6.66e-16	4.92e-05	NA	NA
5. P	Q9SAH8	Metal transporter Nramp1	3.88e-08	2.53e-08	NA	NA
5. P	B3NV41	Sodium-dependent nutrient amino acid transporter 1	1.26e-06	4.33e-04	NA	NA
5. P	P37660	Inner membrane transport protein YhjV	9.56e-10	5.71e-09	NA	NA
5. P	Q2IL15	NADH-quinone oxidoreductase subunit H	2.29e-04	3.37e-02	NA	NA
5. P	Q2G2G3	Divalent metal cation transporter MntH	3.99e-09	1.59e-04	NA	NA
5. P	A6NNN8	Putative sodium-coupled neutral amino acid transporter 8	2.81e-11	6.96e-04	NA	NA
5. P	P53388	Dicarboxylic amino acid permease	6.73e-12	5.57e-07	NA	NA
5. P	E1V6C5	Trk system potassium uptake protein TrkH	3.49e-03	4.24e-04	NA	NA
5. P	P45539	Probable fructoselysine/psicoselysine transporter FrlA	0.00e+00	9.63e-28	NA	NA
5. P	Q31HC4	Probable inorganic carbon transporter subunit DabB	2.84e-03	1.58e-03	NA	NA
5. P	P98004	Quinol oxidase subunit 1	1.36e-04	1.50e-04	NA	NA
5. P	Q9LZ20	Cationic amino acid transporter 6, chloroplastic	1.80e-10	4.04e-09	NA	NA
5. P	P25527	GABA permease	1.69e-13	3.89e-32	NA	NA
5. P	Q4L8N9	Multidrug export protein MepA	1.42e-04	6.49e-03	NA	NA
5. P	Q9S9N8	Metal transporter Nramp6	4.64e-08	8.77e-11	NA	NA
5. P	B4MEG2	Sodium-dependent nutrient amino acid transporter 1	9.44e-07	1.26e-02	NA	NA
5. P	A0A1D8PPG4	Probable lysine/arginine permease CAN3	5.44e-10	5.63e-11	NA	NA
5. P	C8V329	Purine-cytosine permease fcyB	8.39e-09	1.98e-04	NA	NA
5. P	Q9SHH0	Cationic amino acid transporter 8, vacuolar	5.27e-09	3.28e-05	NA	NA
5. P	Q7VMB5	Probable multidrug resistance protein NorM	4.21e-05	5.33e-03	NA	NA
5. P	P94392	High-affinity proline transporter PutP	3.32e-07	3.99e-07	NA	NA
5. P	P27799	Sodium- and chloride-dependent betaine transporter	8.69e-07	4.15e-03	NA	NA
5. P	F4JTB3	Protein DETOXIFICATION 35	1.02e-04	1.58e-02	NA	NA
5. P	Q9Z127	Large neutral amino acids transporter small subunit 1	2.22e-16	1.08e-05	NA	NA
5. P	Q10087	Uncharacterized amino-acid permease C11D3.08c	1.76e-09	6.23e-11	NA	NA
5. P	Q0D7E4	Metal transporter Nramp1	1.07e-07	1.63e-09	NA	NA
5. P	Q95102	Natural resistance-associated macrophage protein 1	1.52e-07	2.38e-03	NA	NA
5. P	Q9C6M2	Lysine histidine transporter-like 6	2.53e-07	3.41e-02	NA	NA
5. P	Q99SH9	Potassium-transporting ATPase potassium-binding subunit 1	8.96e-03	4.90e-02	NA	NA
5. P	P0AGM8	Uracil permease	8.12e-04	4.23e-03	NA	NA
5. P	P0AGN2	Xanthine permease XanP	1.19e-03	7.10e-03	NA	NA
5. P	G5EBN9	Sodium- and chloride-dependent betaine transporter	1.75e-06	2.41e-03	NA	NA
5. P	O59831	Uncharacterized amino-acid permease C965.11c	0.00e+00	1.37e-09	NA	NA
5. P	Q653V6	Metal transporter Nramp3	3.45e-10	4.93e-09	NA	NA
5. P	Q5HN32	Sodium/proline symporter	3.91e-06	3.93e-05	NA	NA
5. P	Q9QXW9	Large neutral amino acids transporter small subunit 2	3.33e-16	2.41e-08	NA	NA
5. P	O34745	Uncharacterized symporter YodF	6.44e-07	1.06e-07	NA	NA
5. P	A8Z2R6	Sodium/proline symporter	6.46e-07	7.44e-05	NA	NA
5. P	P15380	Proline-specific permease	1.51e-11	2.02e-02	NA	NA
5. P	P39277	L-methionine/branched-chain amino acid exporter YjeH	1.67e-10	6.95e-19	NA	NA
5. P	Q2A865	Sodium-dependent neutral amino acid transporter B(0)AT1	3.56e-06	9.91e-03	NA	NA
5. P	Q8DPQ6	Probable multidrug resistance protein NorM	3.59e-05	1.16e-02	NA	NA
5. P	Q96N87	Inactive sodium-dependent neutral amino acid transporter B(0)AT3	4.29e-06	5.33e-03	NA	NA
5. P	A0A1D8PPI5	Lysine/arginine permease CAN1	1.19e-08	1.85e-08	NA	NA
5. P	B9EXZ6	Amino-acid permease BAT1 homolog	6.47e-10	1.64e-12	NA	NA
5. P	Q49B93	Sodium-coupled monocarboxylate transporter 2	4.31e-07	4.86e-02	NA	NA
5. P	Q5SWY8	Sodium/glucose cotransporter 5	1.32e-06	1.35e-04	NA	NA
5. P	P0AAE5	Putative arginine/ornithine antiporter	2.22e-16	7.65e-24	NA	NA
5. P	Q9SF09	Amino acid transporter ANT1	0.00e+00	3.20e-03	NA	NA
5. P	P75712	Putative allantoin permease	1.99e-07	9.88e-14	NA	NA
5. P	Q5FY69	Sodium/glucose cotransporter 5	5.95e-07	4.15e-04	NA	NA
5. P	Q57484	Uncharacterized membrane protein HI_0867	4.59e-05	3.43e-05	NA	NA
5. P	Q21434	NRAMP-like transporter smf-1	1.05e-07	1.70e-03	NA	NA
5. P	P38734	Low-affinity methionine permease	7.46e-10	1.08e-08	NA	NA
5. P	A8KBL5	Putative sodium-coupled neutral amino acid transporter 11	3.57e-11	8.07e-06	NA	NA
5. P	P96169	Sodium/glucose cotransporter	1.01e-05	6.22e-05	NA	NA
5. P	P9WP46	Peptide transporter CstA	7.19e-07	7.86e-07	NA	NA
5. P	Q12078	Iron transporter SMF3	7.02e-10	1.17e-05	NA	NA
5. P	Q9HDV2	Uncharacterized amino-acid permease PB2B2.01	3.88e-12	8.04e-05	NA	NA
5. P	Q9ZFB5	Spore germination protein XB	1.72e-06	2.11e-03	NA	NA
5. P	A0A2A5K1W4	Uracil permease	1.41e-03	4.59e-03	NA	NA
5. P	Q8P4E6	Probable multidrug resistance protein NorM	7.93e-05	1.43e-02	NA	NA
5. P	Q8BGY9	High affinity choline transporter 1	8.04e-06	2.22e-03	NA	NA
5. P	Q9URZ3	Probable proline-specific permease put4	4.28e-12	1.31e-09	NA	NA
5. P	O07556	Uncharacterized symporter YhjB	1.96e-07	2.23e-09	NA	NA
5. P	Q5QN13	Metal transporter Nramp4	2.00e-07	3.85e-06	NA	NA
5. P	Q63016	Large neutral amino acids transporter small subunit 1	1.11e-16	3.04e-06	NA	NA
5. P	Q9JMD7	High affinity choline transporter 1	9.18e-06	2.13e-03	NA	NA
5. P	P83740	Putative sodium-dependent multivitamin transporter	1.37e-06	5.82e-03	NA	NA
5. P	Q58596	Putative amino-acid transporter MJ1196	0.00e+00	8.60e-13	NA	NA
5. P	Q03D26	Divalent metal cation transporter MntH	6.06e-10	1.94e-03	NA	NA
5. P	D9IA43	Cbb3-type cytochrome c oxidase subunit CcoN1	3.64e-04	1.65e-03	NA	NA
5. P	C5BDY7	Multidrug resistance protein MdtK	7.83e-05	1.28e-02	NA	NA
5. P	P63235	Glutamate/gamma-aminobutyrate antiporter	0.00e+00	3.63e-21	NA	NA
5. P	P76037	Putrescine importer PuuP	2.58e-14	9.30e-16	NA	NA
5. P	P0AD99	Branched-chain amino acid transport system 2 carrier protein	1.97e-08	1.78e-10	NA	NA
5. P	B7IE18	Lipid II flippase MurJ	7.89e-05	4.68e-02	NA	NA
5. P	Q38956	Protein DETOXIFICATION 29	1.78e-04	2.47e-02	NA	NA
5. P	A6U307	Sodium/proline symporter	1.50e-06	5.89e-05	NA	NA
5. P	Q9UT18	Thiamine transporter thi9	2.48e-08	3.11e-07	NA	NA
5. P	Q8NVI1	Potassium-transporting ATPase potassium-binding subunit	1.02e-03	4.47e-02	NA	NA
5. P	Q95XG8	NRAMP-like transporter smf-3	2.49e-08	5.07e-04	NA	NA
5. P	P18581	Cationic amino acid transporter 2	1.06e-08	3.76e-06	NA	NA
5. P	Q9D687	Sodium-dependent neutral amino acid transporter B(0)AT1	4.03e-06	3.78e-02	NA	NA
5. P	P37555	Uncharacterized membrane protein YabM	9.39e-05	6.43e-03	NA	NA
5. P	A0PJK1	Sodium/glucose cotransporter 5	1.31e-06	2.48e-03	NA	NA
5. P	Q6GFF5	Sodium/proline symporter	1.67e-06	6.09e-05	NA	NA
5. P	Q8H4H5	Metal transporter Nramp5	2.05e-07	4.04e-09	NA	NA
5. P	P77328	Putative purine permease YbbY	6.30e-04	4.22e-02	NA	NA
5. P	Q58467	Uncharacterized membrane protein MJ1068	1.13e-04	1.89e-02	NA	NA
5. P	P32837	GABA-specific permease	1.38e-08	2.03e-05	NA	NA
5. P	Q9C6S5	Probable polyamine transporter At1g31830	0.00e+00	2.85e-07	NA	NA
5. P	P39618	Putative purine permease YwdJ	3.17e-04	3.42e-04	NA	NA
5. P	P10502	Sodium/proline symporter	8.08e-07	2.53e-04	NA	NA
5. P	P30825	High affinity cationic amino acid transporter 1	5.75e-09	4.93e-09	NA	NA
5. P	Q9ZK47	Peptide transporter CstA	3.71e-07	1.07e-04	NA	NA
5. P	P38967	Tryptophan permease	6.56e-14	3.55e-08	NA	NA
5. P	Q8CNP2	Sodium/proline symporter	4.27e-06	7.27e-05	NA	NA
5. P	P06775	Histidine permease	2.95e-14	4.56e-04	NA	NA
5. P	Q08AI6	Putative sodium-coupled neutral amino acid transporter 11	8.25e-11	2.33e-05	NA	NA
5. P	P38778	Manganese transporter SMF2	2.65e-06	5.07e-09	NA	NA
5. P	Q91502	Creatine transporter	1.28e-06	2.82e-02	NA	NA
5. P	P60062	Arginine/agmatine antiporter	0.00e+00	1.15e-24	NA	NA
5. P	Q92AG2	Probable multidrug resistance protein NorM	1.31e-05	1.02e-02	NA	NA
5. P	Q05347	Putative O-antigen export protein	3.07e-05	3.43e-03	NA	NA
5. P	P60061	Arginine/agmatine antiporter	0.00e+00	1.15e-24	NA	NA
5. P	Q59WU0	Probable lysine/arginine permease CAN2	1.18e-08	2.89e-08	NA	NA
5. P	O43246	Cationic amino acid transporter 4	9.96e-08	7.76e-07	NA	NA
5. P	Q9URZ4	Cationic amino acid transporter 1	1.30e-11	4.40e-05	NA	NA
5. P	Q8ZGS9	Arginine/agmatine antiporter	0.00e+00	4.17e-25	NA	NA
5. P	Q9UN76	Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)	1.31e-06	1.15e-02	NA	NA
5. P	Q62687	Sodium-dependent neutral amino acid transporter B(0)AT3	4.02e-06	4.42e-02	NA	NA
5. P	P32705	Cation/acetate symporter ActP	4.28e-07	2.71e-05	NA	NA
5. P	P30145	Sodium/proton-dependent alanine carrier protein	1.23e-05	1.47e-04	NA	NA
5. P	P49279	Natural resistance-associated macrophage protein 1	3.62e-07	1.00e-02	NA	NA
5. P	Q7A4G4	Potassium-transporting ATPase potassium-binding subunit 1	2.61e-03	4.90e-02	NA	NA
5. P	Q8XSF6	Divalent metal cation transporter MntH	6.94e-08	5.18e-04	NA	NA
5. P	D4GYG8	Probable flippase AglR	5.66e-04	8.24e-04	NA	NA
5. P	O34545	Branched-chain amino acid transport system carrier protein BraB	6.10e-10	4.11e-11	NA	NA
5. P	Q9SNV9	Metal transporter Nramp3	1.34e-07	3.97e-04	NA	NA
5. P	P30823	High affinity cationic amino acid transporter 1	5.01e-08	4.43e-09	NA	NA
5. P	P19807	Choline transport protein	9.22e-09	1.38e-07	NA	NA
5. P	Q9UHI5	Large neutral amino acids transporter small subunit 2	2.22e-16	2.42e-10	NA	NA
5. P	Q8PG07	Probable multidrug resistance protein NorM	5.37e-05	3.16e-02	NA	NA
5. P	Q2FYM4	Putative branched-chain amino acid carrier protein SAOUHSC_01411	3.33e-11	5.21e-13	NA	NA
5. P	Q08485	Nicotinamide riboside transporter 1	2.16e-06	2.32e-04	NA	NA
5. P	O05229	Na(+)/H(+) antiporter subunit D	9.62e-04	2.14e-02	NA	NA
5. P	Q9ASS7	Cationic amino acid transporter 2, vacuolar	4.05e-09	3.85e-06	NA	NA
5. P	Q8GH68	Divalent metal cation transporter MntH	7.71e-08	4.19e-04	NA	NA
5. P	A1B479	NADH-quinone oxidoreductase subunit N	6.71e-04	1.16e-02	NA	NA
5. P	Q9JMA9	Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+)	1.10e-06	9.81e-03	NA	NA
5. P	P42590	Inner membrane transporter YgjI	1.74e-12	1.76e-27	NA	NA
5. P	O32140	Uric acid permease PucK	5.67e-03	8.59e-04	NA	NA
5. P	P15993	Aromatic amino acid transport protein AroP	0.00e+00	1.07e-27	NA	NA
5. P	P38176	Vacuolar amino acid transporter 5	2.47e-08	8.36e-06	NA	NA
5. P	O59813	Uncharacterized amino-acid permease C794.03	1.15e-09	3.24e-08	NA	NA
5. P	Q08986	S-adenosylmethionine permease SAM3	1.29e-11	8.45e-07	NA	NA
5. P	P94532	Peptide transporter CstA	3.90e-06	1.18e-04	NA	NA
5. P	Q8Y654	Probable multidrug resistance protein NorM	1.32e-05	5.33e-03	NA	NA
5. P	O60113	Uncharacterized amino-acid permease C15C4.04c	0.00e+00	1.69e-06	NA	NA
5. P	Q9CNC5	Uncharacterized membrane protein PM0507	6.56e-05	1.14e-02	NA	NA
5. P	Q4L7L6	Sodium/proline symporter	4.89e-07	2.93e-05	NA	NA
5. P	Q9NSD5	Sodium- and chloride-dependent GABA transporter 2	1.15e-06	1.09e-03	NA	NA
5. P	O88576	Sodium-dependent neutral amino acid transporter B(0)AT3	3.82e-06	6.30e-03	NA	NA
5. P	Q59647	Nitric oxide reductase subunit B	2.08e-04	4.15e-02	NA	NA
5. P	Q8BLQ7	Cationic amino acid transporter 4	2.50e-08	1.46e-06	NA	NA
5. P	Q12372	S-methylmethionine permease 1	1.83e-13	1.83e-08	NA	NA
5. P	Q6GEZ6	Potassium-transporting ATPase potassium-binding subunit 1	1.63e-03	4.99e-02	NA	NA
5. P	Q9SQZ0	Cationic amino acid transporter 7, chloroplastic	3.73e-09	2.02e-11	NA	NA
5. P	O32273	Teichuronic acid biosynthesis protein TuaB	3.98e-05	1.40e-02	NA	NA
5. P	Q92536	Y+L amino acid transporter 2	3.33e-16	2.43e-07	NA	NA
5. P	Q2FWY7	Sodium/proline symporter	4.73e-07	5.89e-05	NA	NA
5. P	Q9Z1K8	Y+L amino acid transporter 1	4.44e-16	1.16e-06	NA	NA
5. P	P40501	Vacuolar amino acid transporter 7	3.72e-07	3.07e-02	NA	NA
5. P	Q9UM01	Y+L amino acid transporter 1	4.44e-16	4.24e-10	NA	NA
5. P	Q6Z8D0	Polyamine transporter PUT1	0.00e+00	2.70e-04	NA	NA
5. P	P75683	Putative glycoside/cation symporter YagG	1.28e-04	4.47e-02	NA	NA
5. P	P49280	Natural resistance-associated macrophage protein 1	2.96e-08	2.13e-03	NA	NA
5. P	Q8TCU3	Solute carrier family 7 member 13	5.72e-13	1.15e-22	NA	NA
5. P	Q2YU74	Sodium/proline symporter	7.86e-07	8.56e-06	NA	NA
5. P	P0AGM9	Xanthine permease XanP	1.19e-03	7.10e-03	NA	NA
5. P	P42086	Xanthine permease	4.64e-05	8.24e-04	NA	NA
5. P	P38925	Manganese transporter SMF1	2.16e-06	1.60e-03	NA	NA
5. P	Q8HXI3	Putative sodium-coupled neutral amino acid transporter 11	3.06e-09	1.34e-02	NA	NA
5. P	Q62LW6	Probable multidrug resistance protein NorM	3.32e-05	1.15e-02	NA	NA
5. P	P70423	Cationic amino acid transporter 3	7.08e-09	1.31e-07	NA	NA
5. P	Q9R0S5	Y+L amino acid transporter 1	4.44e-16	6.62e-07	NA	NA
5. P	Q6G7N2	Potassium-transporting ATPase potassium-binding subunit	2.61e-03	4.47e-02	NA	NA
5. P	P0AAE8	Probable cadaverine/lysine antiporter	1.47e-13	3.69e-26	NA	NA
5. P	P38090	General amino acid permease AGP2	1.19e-11	8.15e-04	NA	NA
5. P	A0A1D8PK89	General amino-acid permease GAP2	3.14e-14	6.07e-04	NA	NA
5. P	Q8WY07	Cationic amino acid transporter 3	5.25e-09	3.19e-07	NA	NA
5. P	O88575	Sodium- and chloride-dependent transporter XTRP3B	4.50e-06	2.72e-02	NA	NA
5. P	Q21433	NRAMP-like transporter smf-2	2.12e-08	5.07e-03	NA	NA
5. P	Q0P9Y2	Peptide transporter CstA	2.88e-07	1.13e-04	NA	NA
5. P	P33699	Succinoglycan biosynthesis transport protein ExoT	1.84e-04	1.58e-02	NA	NA
5. P	A5G348	Divalent metal cation transporter MntH	2.31e-09	2.36e-02	NA	NA
5. P	Q869V1	Metal transporter nramp1 homolog	1.82e-08	4.19e-07	NA	NA
5. P	Q10177	Manganese transporter pdt1	2.42e-07	1.14e-02	NA	NA
5. P	Q9LYM2	Amino acid transporter AVT6C	2.35e-09	8.95e-04	NA	NA
5. P	P0AAD8	Threonine/serine transporter TdcC	3.41e-09	2.65e-07	NA	NA
5. P	Q9WVR6	Large neutral amino acids transporter small subunit 2	3.33e-16	3.94e-08	NA	NA
5. P	P9WKX9	Uncharacterized protein Rv3630	1.14e-04	2.82e-02	NA	NA
5. P	P59985	Uncharacterized protein Mb3654	1.27e-04	3.85e-02	NA	NA
5. P	P0AAE0	D-serine/D-alanine/glycine transporter	3.33e-16	6.55e-21	NA	NA
5. P	Q9XT74	Natural resistance-associated macrophage protein 1	2.02e-07	3.74e-02	NA	NA
5. P	P25737	Lysine-specific permease	0.00e+00	5.06e-21	NA	NA
5. P	Q00758	Stage V sporulation protein B	1.64e-04	8.77e-04	NA	NA
5. P	Q6PGE7	Sodium-dependent proline transporter	2.16e-06	1.33e-02	NA	NA
5. P	P50276	High-affinity methionine permease	3.52e-14	1.59e-06	NA	NA
5. P	B4PZQ4	Sodium-dependent nutrient amino acid transporter 1	1.29e-06	1.38e-03	NA	NA
5. P	Q6ZG85	Metal transporter NRAT1	4.43e-07	1.80e-07	NA	NA
5. P	P67446	Xanthine permease XanQ	7.23e-04	7.90e-04	NA	NA
5. P	A0A1D8PN88	Amino-acid permease GAP3	8.31e-12	5.63e-05	NA	NA
5. P	Q64093	Sodium- and chloride-dependent transporter XTRP3	3.95e-06	3.67e-02	NA	NA
5. P	Q5HZH7	Putative sodium-coupled neutral amino acid transporter 8	1.45e-11	1.03e-03	NA	NA
5. P	Q27981	Natural resistance-associated macrophage protein 1	2.90e-08	4.23e-03	NA	NA
5. P	Q92PZ0	Probable multidrug resistance protein NorM	6.66e-05	3.64e-02	NA	NA
5. P	B2VKE4	Cation/acetate symporter ActP	5.08e-07	3.06e-05	NA	NA
5. P	P29926	NADH-quinone oxidoreductase subunit 14	4.77e-04	1.16e-02	NA	NA
5. P	Q47689	Probable S-methylmethionine permease	1.03e-10	7.33e-26	NA	NA
5. P	P63115	Asc-type amino acid transporter 1	3.33e-16	5.62e-06	NA	NA
5. P	Q8D9N8	Multidrug resistance protein NorM	4.14e-05	4.54e-03	NA	NA
5. P	P39396	Pyruvate/proton symporter BtsT	3.82e-07	1.89e-04	NA	NA
5. P	Q8CUL5	Probable multidrug resistance protein NorM	4.51e-05	8.07e-03	NA	NA
5. P	Q46821	Uric acid transporter UacT	5.50e-03	6.14e-04	NA	NA
5. P	Q9C5D6	Cationic amino acid transporter 9, chloroplastic	2.91e-09	1.16e-12	NA	NA
5. P	Q08579	Thiamine transporter THI72	8.56e-06	2.52e-02	NA	NA
5. P	P9WQM3	Uncharacterized transporter Rv1999c	8.88e-16	5.09e-18	NA	NA
5. P	P38084	Leu/Val/Ile amino-acid permease	3.91e-14	3.84e-05	NA	NA
5. P	P77610	L-asparagine permease	0.00e+00	6.04e-19	NA	NA
5. P	Q9LHN7	Probable polyamine transporter At3g13620	4.35e-14	5.51e-10	NA	NA
5. P	P0AAD6	Serine transporter SdaC	7.98e-09	2.57e-06	NA	NA
5. P	Q9W4C5	Sodium-dependent nutrient amino acid transporter 1	1.09e-06	1.16e-05	NA	NA
5. P	O64759	Cationic amino acid transporter 5	1.49e-09	8.46e-06	NA	NA
5. P	P70553	Natural resistance-associated macrophage protein 1	7.26e-08	1.95e-02	NA	NA
5. P	P53744	7-keto 8-aminopelargonic acid transporter	1.10e-08	8.23e-10	NA	NA
5. P	P38971	Basic amino-acid permease	8.30e-12	4.38e-06	NA	NA
5. P	P24207	Phenylalanine-specific permease	0.00e+00	8.35e-20	NA	NA
5. P	A6TGZ7	Cation/acetate symporter ActP	4.62e-07	1.69e-05	NA	NA
5. P	O34573	Putative spore germination protein YfkT	4.59e-08	3.01e-03	NA	NA
5. P	Q91WN3	Solute carrier family 7 member 13	2.29e-13	5.46e-18	NA	NA
5. P	P39282	Inner membrane transporter YjeM	5.61e-13	5.08e-24	NA	NA
5. P	Q9US40	Uncharacterized amino-acid permease C1039.01	6.20e-11	1.54e-09	NA	NA
5. P	Q09143	High affinity cationic amino acid transporter 1	8.96e-08	7.36e-09	NA	NA
5. P	O60170	Probable amino-acid permease meu22	0.00e+00	1.20e-05	NA	NA
5. P	P28303	DNA damage-inducible protein F	2.47e-04	2.10e-02	NA	NA
5. P	O02228	High-affinity choline transporter 1	1.68e-06	2.11e-04	NA	NA
5. P	Q8GYB4	Cationic amino acid transporter 3, mitochondrial	9.63e-09	8.08e-08	NA	NA
5. P	A0A1D8PMB1	Amino-acid permease GAP5	1.22e-11	8.47e-03	NA	NA
5. P	Q5AG77	Amino-acid permease GAP1	1.13e-11	3.03e-05	NA	NA
5. P	Q58026	Uncharacterized protein MJ0609	0.00e+00	1.42e-24	NA	NA
5. P	Q9I3Y3	Multidrug resistance protein PmpM	4.31e-05	4.18e-02	NA	NA
5. P	P42628	Probable serine transporter	0.00e+00	2.17e-07	NA	NA
5. P	P98008	Nitric oxide reductase subunit B	2.66e-04	5.88e-03	NA	NA
5. P	Q5PR34	Cationic amino acid transporter 2	2.02e-09	2.40e-07	NA	NA
5. P	Q71YH0	Probable multidrug resistance protein NorM	1.35e-05	4.07e-03	NA	NA
5. P	Q9C6S4	Probable polyamine transporter At1g31820	7.52e-14	1.01e-06	NA	NA
5. P	Q65SY9	Probable multidrug resistance protein NorM	5.11e-05	3.01e-02	NA	NA
5. P	Q9F5N7	Multidrug resistance protein NorM	6.04e-05	3.44e-02	NA	NA
5. P	P37746	Putative O-antigen transporter	2.27e-04	1.17e-03	NA	NA
5. P	A0A6L8Q027	Probable inorganic carbon transporter subunit DabB	3.05e-03	3.39e-04	NA	NA
5. P	Q9P768	Uncharacterized amino-acid permease P7G5.06	2.02e-11	1.65e-03	NA	NA
5. P	P0AAD2	Tryptophan-specific transport protein	0.00e+00	2.66e-13	NA	NA
5. P	P75835	Inner membrane transporter YcaM	0.00e+00	6.94e-24	NA	NA
5. P	P63340	Inner membrane transport protein YqeG	3.17e-10	2.32e-09	NA	NA
5. P	P0AA82	Cytosine permease	9.33e-08	4.48e-08	NA	NA
5. P	B3MRS1	Sodium-dependent nutrient amino acid transporter 1	1.53e-06	1.46e-04	NA	NA
5. P	P9WP47	Peptide transporter CstA	3.79e-07	2.45e-06	NA	NA
5. P	O74327	Vacuolar amino acid transporter 5	4.85e-08	7.68e-03	NA	NA
5. P	P60064	Arginine/agmatine antiporter	0.00e+00	1.15e-24	NA	NA
5. P	P92962	Proline transporter 2	4.88e-09	3.46e-03	NA	NA
5. P	P67444	Xanthine permease XanQ	6.96e-04	7.90e-04	NA	NA
5. P	P52569	Cationic amino acid transporter 2	9.50e-09	1.50e-06	NA	NA
5. P	Q1M7A2	Monocarboxylate transport permease protein	1.12e-06	1.60e-07	NA	NA
5. P	E1V6K4	Trk system potassium uptake protein TrkI	1.65e-03	8.24e-04	NA	NA
5. P	Q9GZV3	High affinity choline transporter 1	1.08e-05	2.80e-03	NA	NA
5. P	P34479	Probable amino acid transporter skat-1	6.81e-09	1.95e-02	NA	NA
5. P	P71399	Lsg locus putative protein 1	5.42e-05	2.58e-03	NA	NA
5. P	Q8FHG6	Glutamate/gamma-aminobutyrate antiporter	0.00e+00	2.07e-20	NA	NA
5. P	Q97TN5	Divalent metal cation transporter MntH	2.49e-07	1.95e-04	NA	NA
5. P	Q97QN5	Probable multidrug resistance protein NorM	3.29e-05	2.18e-02	NA	NA
5. P	P15078	Peptide transporter CstA	1.71e-07	6.80e-05	NA	NA
5. P	O77741	Natural resistance-associated macrophage protein 1	1.28e-07	6.62e-03	NA	NA
5. P	O74537	Uncharacterized amino-acid permease C74.04	5.22e-11	8.65e-11	NA	NA
5. P	P17064	Purine-cytosine permease FCY2	7.99e-08	1.79e-02	NA	NA
5. P	Q9SN36	Metal transporter Nramp5	1.75e-08	1.99e-02	NA	NA
5. P	P19145	General amino-acid permease GAP1	2.49e-11	7.73e-04	NA	NA
5. P	Q6GJ44	Putative antiporter subunit mnhD2	9.25e-04	2.54e-02	NA	NA
5. P	Q10279	Uracil permease	1.00e-06	9.43e-04	NA	NA
5. P	Q8QL47	Uncharacterized protein 399	NA	4.97e-19	NA	NA
5. P	P56190	Peptide transporter CstA	3.67e-07	2.79e-04	NA	NA
5. P	Q2QN30	Metal transporter Nramp6	7.00e-08	3.99e-02	NA	NA
5. P	P9WKX8	Uncharacterized protein MT3732	1.26e-04	3.85e-02	NA	NA
5. P	Q99884	Sodium-dependent proline transporter	2.10e-06	3.22e-02	NA	NA
5. P	A0A2A5JY22	Nucleobase transporter PlUacP	2.01e-04	1.46e-03	NA	NA
6. F	B4TAY9	Low affinity potassium transport system protein kup	7.34e-08	NA	NA	0.4818
6. F	C4ZZ25	Low affinity potassium transport system protein kup	8.23e-08	NA	NA	0.4783
6. F	A5IB85	Probable potassium transport system protein kup 1	3.40e-07	NA	NA	0.4347
6. F	Q04CF3	Probable potassium transport system protein kup	1.27e-06	NA	NA	0.4733
6. F	Q93LK8	Spore germination protein GerQB	0.00e+00	NA	NA	0.6746
6. F	Q5XH90	Sodium-coupled neutral amino acid transporter 2	2.73e-10	NA	NA	0.5593
6. F	A5V804	Probable potassium transport system protein kup 2	8.26e-07	NA	NA	0.5313
6. F	A4WGE0	Low affinity potassium transport system protein kup	7.81e-08	NA	NA	0.4645
6. F	Q5NN77	Probable potassium transport system protein kup	4.89e-07	NA	NA	0.533
6. F	Q88SV0	Probable potassium transport system protein kup 2	5.09e-07	NA	NA	0.5048
6. F	Q5X3H2	Probable potassium transport system protein kup 2	1.67e-07	NA	NA	0.5115
6. F	A2S2B6	Probable potassium transport system protein kup	7.92e-07	NA	NA	0.4587
6. F	Q8PHV1	Probable potassium transport system protein kup	4.70e-07	NA	NA	0.4886
6. F	Q89NN6	Probable potassium transport system protein kup 1	1.93e-07	NA	NA	0.5174
6. F	Q8XAW9	Low affinity potassium transport system protein kup	9.12e-07	NA	NA	0.4692
6. F	B7LK92	Low affinity potassium transport system protein kup	1.11e-07	NA	NA	0.4886
6. F	Q8FZT8	Probable potassium transport system protein kup	5.90e-07	NA	NA	0.478
6. F	Q1CNU1	Low affinity potassium transport system protein kup	8.03e-07	NA	NA	0.4756
6. F	Q66GH5	Low affinity potassium transport system protein kup	3.48e-07	NA	NA	0.496
6. F	O69443	Divalent metal cation transporter MntH	1.13e-05	NA	NA	0.4901
6. F	P55015	Solute carrier family 12 member 1	7.01e-04	NA	NA	0.4867
6. F	Q5RE87	Sodium-coupled neutral amino acid transporter 4	1.75e-08	NA	NA	0.5271
6. F	Q6PCF9	Putative sodium-coupled neutral amino acid transporter 10	1.54e-07	NA	NA	0.5867
6. F	Q5H2A5	Probable potassium transport system protein kup	5.19e-07	NA	NA	0.4878
6. F	B5FN50	Low affinity potassium transport system protein kup	9.79e-08	NA	NA	0.4888
6. F	A1JHR6	Low affinity potassium transport system protein kup	1.19e-07	NA	NA	0.4912
6. F	Q2IPI8	Probable potassium transport system protein kup	1.66e-07	NA	NA	0.4849
6. F	Q6DFE7	Putative sodium-coupled neutral amino acid transporter 7	3.26e-11	NA	NA	0.5891
6. F	Q60A92	Probable potassium transport system protein kup	4.87e-07	NA	NA	0.5256
6. F	Q07Q80	Probable potassium transport system protein kup 1	5.82e-07	NA	NA	0.511
6. F	Q6N5F2	Probable potassium transport system protein kup 1	3.44e-07	NA	NA	0.4396
6. F	P38680	N amino acid transport system protein	1.28e-13	NA	NA	0.5891
6. F	Q8YI23	Probable potassium transport system protein kup	4.97e-07	NA	NA	0.4769
6. F	B1X9X4	Low affinity potassium transport system protein kup	1.12e-07	NA	NA	0.4881
6. F	Q4KL91	Proton-coupled amino acid transporter 4	4.58e-08	NA	NA	0.4716
6. F	Q29GB8	Sodium-dependent nutrient amino acid transporter 1	1.60e-06	NA	NA	0.4971
6. F	Q0VGW6	Solute carrier family 12 member 9	1.58e-08	NA	NA	0.5139
6. F	Q8NSG3	Probable potassium transport system protein kup	5.90e-07	NA	NA	0.4739
6. F	B7L897	Low affinity potassium transport system protein kup	9.73e-08	NA	NA	0.4826
6. F	Q5FQL0	Probable potassium transport system protein kup	6.94e-07	NA	NA	0.4822
6. F	Q9FEL7	Auxin transporter-like protein 2	4.12e-09	NA	NA	0.5495
6. F	B1LL74	Low affinity potassium transport system protein kup	9.16e-07	NA	NA	0.4841
6. F	Q5RCV1	Transmembrane protein 104	6.06e-07	NA	NA	0.5368
6. F	Q2NBS1	Probable potassium transport system protein kup	6.52e-07	NA	NA	0.5206
6. F	Q216N0	Probable potassium transport system protein kup 2	1.85e-07	NA	NA	0.4902
6. F	Q2W906	Probable potassium transport system protein kup 1	7.27e-07	NA	NA	0.459
6. F	P37520	Uncharacterized protein YyaD	2.92e-07	NA	NA	0.6792
6. F	Q5R9F5	Putative sodium-coupled neutral amino acid transporter 7	2.51e-09	NA	NA	0.5754
6. F	Q2NQ98	Low affinity potassium transport system protein kup	1.18e-07	NA	NA	0.5285
6. F	A7H902	Probable potassium transport system protein kup	8.79e-07	NA	NA	0.499
6. F	A4QC57	Probable potassium transport system protein kup	7.08e-07	NA	NA	0.4919
6. F	Q1GBZ5	Probable potassium transport system protein kup	1.01e-06	NA	NA	0.4866
6. F	Q5BL81	Sodium-coupled monocarboxylate transporter 1	6.32e-07	NA	NA	0.4937
6. F	C4L981	Probable potassium transport system protein kup	5.44e-07	NA	NA	0.504
6. F	Q5WUW3	Probable potassium transport system protein kup 2	3.46e-07	NA	NA	0.448
6. F	Q98KL8	Probable potassium transport system protein kup 1	3.37e-07	NA	NA	0.482
6. F	Q6N893	Probable potassium transport system protein kup 3	1.48e-07	NA	NA	0.4712
6. F	Q5WXA2	Probable potassium transport system protein kup 1	4.39e-07	NA	NA	0.5003
6. F	A1V4I6	Probable potassium transport system protein kup	1.17e-06	NA	NA	0.4402
6. F	Q9FEL8	Auxin transporter-like protein 1	5.41e-09	NA	NA	0.5266
6. F	P31661	Sodium- and chloride-dependent creatine transporter 1	5.08e-07	NA	NA	0.5162
6. F	Q5F3I6	Transmembrane protein 104	7.75e-07	NA	NA	0.5317
6. F	A5EHA3	Probable potassium transport system protein kup 1	1.73e-08	NA	NA	0.4583
6. F	A6U6M1	Probable potassium transport system protein kup 1	2.82e-07	NA	NA	0.4366
6. F	Q95KE2	Vesicular inhibitory amino acid transporter	1.13e-09	NA	NA	0.5822
6. F	A4GA77	Probable potassium transport system protein kup	1.38e-07	NA	NA	0.4488
6. F	Q4UXL9	Probable potassium transport system protein kup	4.41e-07	NA	NA	0.4375
6. F	B4L7U0	Sodium-dependent nutrient amino acid transporter 1	1.02e-06	NA	NA	0.4365
6. F	Q837G9	Probable potassium transport system protein kup	3.38e-07	NA	NA	0.4803
6. F	B7MGG7	Low affinity potassium transport system protein kup	8.48e-08	NA	NA	0.4816
6. F	Q07Q28	Probable potassium transport system protein kup 2	6.60e-07	NA	NA	0.4947
6. F	Q3BQF3	Probable potassium transport system protein kup	5.13e-07	NA	NA	0.4879
6. F	Q8P6E6	Probable potassium transport system protein kup	5.26e-07	NA	NA	0.4461
6. F	Q89K67	Divalent metal cation transporter MntH	7.33e-09	NA	NA	0.5497
6. F	Q3ST91	Probable potassium transport system protein kup	2.56e-07	NA	NA	0.4942
6. F	Q5E9S9	Sodium-coupled neutral amino acid transporter 5	3.22e-08	NA	NA	0.4886
6. F	B7UML2	Low affinity potassium transport system protein kup	9.12e-08	NA	NA	0.4912
6. F	B4GVM9	Sodium-dependent nutrient amino acid transporter 1	1.80e-06	NA	NA	0.5085
6. F	A5VRD1	Probable potassium transport system protein kup	4.76e-07	NA	NA	0.4767
6. F	A2SC47	Probable potassium transport system protein kup	6.70e-07	NA	NA	0.4791
6. F	Q1I6D2	Probable potassium transport system protein kup	4.28e-07	NA	NA	0.5062
6. F	P27922	Sodium-dependent dopamine transporter	4.95e-06	NA	NA	0.4991
6. F	Q5ZW98	Probable potassium transport system protein kup 1	4.34e-07	NA	NA	0.5097
6. F	Q25479	Bumetanide-sensitive sodium-(potassium)-chloride cotransporter	9.23e-08	NA	NA	0.5145
6. F	B7N2I6	Low affinity potassium transport system protein kup	8.12e-08	NA	NA	0.4874
6. F	A4SYW3	Probable potassium transport system protein kup	1.49e-07	NA	NA	0.4168
6. F	C0RE23	Probable potassium transport system protein kup	5.19e-07	NA	NA	0.4858
6. F	Q3YVL0	Low affinity potassium transport system protein kup	5.23e-07	NA	NA	0.4864
6. F	B7NR50	Low affinity potassium transport system protein kup	8.77e-08	NA	NA	0.4898
6. F	Q31UM6	Low affinity potassium transport system protein kup	8.95e-08	NA	NA	0.4888
6. F	Q7YRU6	Solute carrier family 12 member 7	5.21e-06	NA	NA	0.4636
6. F	A4TSH8	Low affinity potassium transport system protein kup	3.72e-07	NA	NA	0.4985
6. F	A4YWY9	Probable potassium transport system protein kup 3	6.83e-07	NA	NA	0.512
6. F	Q9CHU4	Probable potassium transport system protein kup 2	3.57e-07	NA	NA	0.5156
6. F	Q1R4I5	Low affinity potassium transport system protein kup	1.29e-07	NA	NA	0.4848
6. F	Q5FLF5	Probable potassium transport system protein kup 2	1.21e-06	NA	NA	0.4911
6. F	B1JR26	Low affinity potassium transport system protein kup	4.66e-07	NA	NA	0.4593
6. F	B5BIQ1	Low affinity potassium transport system protein kup	3.81e-07	NA	NA	0.4842
6. F	A7MMV3	Low affinity potassium transport system protein kup	9.70e-08	NA	NA	0.5134
6. F	Q3K107	Probable potassium transport system protein kup	9.34e-07	NA	NA	0.5054
6. F	A8ACQ3	Low affinity potassium transport system protein kup	8.01e-07	NA	NA	0.4868
6. F	Q87D01	Probable potassium transport system protein kup	5.03e-07	NA	NA	0.4232
6. F	Q47A46	Probable potassium transport system protein kup 3	1.18e-07	NA	NA	0.4607
6. F	A9M640	Probable potassium transport system protein kup	5.47e-07	NA	NA	0.4909
6. F	Q217M1	Probable potassium transport system protein kup 1	5.02e-07	NA	NA	0.491
6. F	Q89NN5	Probable potassium transport system protein kup 2	1.42e-07	NA	NA	0.5348
6. F	Q88Z42	Probable potassium transport system protein kup 1	6.42e-07	NA	NA	0.5086
6. F	A4YWY8	Probable potassium transport system protein kup 2	4.52e-07	NA	NA	0.5066
6. F	B4SYE8	Low affinity potassium transport system protein kup	1.22e-07	NA	NA	0.5003
6. F	Q2YQM9	Probable potassium transport system protein kup	5.11e-07	NA	NA	0.4964
6. F	Q0AIM8	Probable potassium transport system protein kup	2.29e-07	NA	NA	0.4728
6. F	Q0BEY0	Probable potassium transport system protein kup	1.21e-06	NA	NA	0.4557
6. F	Q6DB92	Low affinity potassium transport system protein kup	1.11e-07	NA	NA	0.4998
6. F	A6ZTG5	General amino acid permease AGP1	2.38e-11	NA	NA	0.5812
6. F	A4SLX1	Probable potassium transport system protein kup	4.46e-07	NA	NA	0.5073
6. F	A5FAI5	Probable potassium transport system protein kup	5.05e-07	NA	NA	0.496
6. F	Q9CHU5	Probable potassium transport system protein kup 1	1.16e-06	NA	NA	0.5007
6. F	Q6A4L1	Solute carrier family 12 member 8	8.12e-07	NA	NA	0.5413
6. F	Q98KL7	Probable potassium transport system protein kup 2	7.54e-07	NA	NA	0.4783
6. F	A5EHG1	Probable potassium transport system protein kup 2	3.75e-07	NA	NA	0.519
6. F	Q2K2I9	Probable potassium transport system protein kup 3	3.60e-07	NA	NA	0.4805
6. F	Q5RC98	Putative sodium-coupled neutral amino acid transporter 10	1.77e-08	NA	NA	0.6226
6. F	Q92RN0	Probable potassium transport system protein kup 1	4.10e-07	NA	NA	0.4785
6. F	B6I3Y4	Low affinity potassium transport system protein kup	8.01e-08	NA	NA	0.4845
6. F	Q6FDF6	Osmo-independent choline transporter BetT1	1.26e-05	NA	NA	0.4796
6. F	A0KL61	Probable potassium transport system protein kup 2	7.70e-07	NA	NA	0.5077
6. F	B5YY05	Low affinity potassium transport system protein kup	7.77e-08	NA	NA	0.4889
6. F	B0CHH0	Probable potassium transport system protein kup	5.46e-07	NA	NA	0.4866
6. F	Q0SYU9	Low affinity potassium transport system protein kup	3.93e-07	NA	NA	0.4904
6. F	A1AHS7	Low affinity potassium transport system protein kup	6.52e-07	NA	NA	0.4814
6. F	Q5ZSY2	Probable potassium transport system protein kup 3	6.09e-07	NA	NA	0.446
6. F	A1K7T4	Probable potassium transport system protein kup	6.20e-07	NA	NA	0.499
6. F	A5IDR5	Probable potassium transport system protein kup 2	3.52e-07	NA	NA	0.4593
6. F	Q8XYY5	Probable potassium transport system protein kup 2	1.36e-06	NA	NA	0.4446
6. F	Q6DFK0	Sodium-coupled neutral amino acid transporter 9	2.46e-07	NA	NA	0.5217
6. F	P55013	Solute carrier family 12 member 2	3.80e-03	NA	NA	0.5046
6. F	Q28677	Solute carrier family 12 member 4	4.80e-06	NA	NA	0.4833
6. F	B1IWZ1	Low affinity potassium transport system protein kup	1.25e-07	NA	NA	0.4819
6. F	Q5R443	Sodium-coupled neutral amino acid transporter 1	4.50e-07	NA	NA	0.5438
6. F	Q57HW3	Low affinity potassium transport system protein kup	1.20e-07	NA	NA	0.4819
6. F	Q7SYH5	Sodium-coupled monocarboxylate transporter 1	2.73e-06	NA	NA	0.4399
6. F	B2K7I6	Low affinity potassium transport system protein kup	1.66e-07	NA	NA	0.4594
6. F	B0KTK9	Probable potassium transport system protein kup	9.10e-07	NA	NA	0.4963
6. F	Q8ZJT0	Low affinity potassium transport system protein kup	7.52e-07	NA	NA	0.475
6. F	Q57CC4	Probable potassium transport system protein kup	4.94e-07	NA	NA	0.4944
6. F	Q8DHB0	Probable potassium transport system protein kup	3.99e-07	NA	NA	0.4896
6. F	A6WZX3	Probable potassium transport system protein kup	5.20e-07	NA	NA	0.4623
6. F	B5XZK9	Low affinity potassium transport system protein kup	8.44e-08	NA	NA	0.4858
6. F	A1BHB7	Probable potassium transport system protein kup	2.25e-07	NA	NA	0.5203
6. F	C6DJF7	Low affinity potassium transport system protein kup	9.78e-07	NA	NA	0.3969
6. F	Q8L884	Auxin transporter-like protein 4	4.96e-09	NA	NA	0.4828
6. F	Q1CC44	Low affinity potassium transport system protein kup	8.46e-07	NA	NA	0.4994
6. F	Q8L883	Auxin transporter-like protein 5	1.64e-10	NA	NA	0.5387
6. F	P45335	Uncharacterized transporter HI_1706	1.31e-06	NA	NA	0.3559
6. F	A0KJR8	Probable potassium transport system protein kup 1	8.37e-07	NA	NA	0.4923
6. F	Q0TAW2	Low affinity potassium transport system protein kup	1.36e-07	NA	NA	0.4721
6. F	Q88NK7	Probable potassium transport system protein kup	1.08e-06	NA	NA	0.466
6. F	A0JNI9	Probable cationic amino acid transporter	9.28e-07	NA	NA	0.611
6. F	Q3KH21	Probable potassium transport system protein kup	8.18e-07	NA	NA	0.4854
6. F	Q00589	Sodium- and chloride-dependent taurine transporter	1.19e-06	NA	NA	0.491
6. F	P63184	Low affinity potassium transport system protein kup	3.76e-07	NA	NA	0.4727
6. F	B2S6K8	Probable potassium transport system protein kup	5.06e-07	NA	NA	0.4939
6. F	Q135T0	Probable potassium transport system protein kup 2	3.85e-07	NA	NA	0.4761
6. F	B2TU32	Low affinity potassium transport system protein kup	5.74e-07	NA	NA	0.4765
6. F	P55019	Solute carrier family 12 member 3	1.17e-05	NA	NA	0.5309
6. F	Q28HE5	Probable sodium-coupled neutral amino acid transporter 6	7.78e-09	NA	NA	0.6252
6. F	A9QYG6	Low affinity potassium transport system protein kup	4.30e-07	NA	NA	0.4703
6. F	Q610N4	Transmembrane protein 104 homolog	1.76e-10	NA	NA	0.5783
6. F	Q39ZN5	Probable potassium transport system protein kup 2	4.04e-07	NA	NA	0.5391
7. B	P75597	Uncharacterized protein MPN_095	4.59e-10	NA	0.011	NA
7. B	Q8MH63	Putative L-type amino acid transporter 1-like protein MLAS	1.69e-04	NA	0.011	NA