Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX55014.1

JCVISYN3A_0879

Magnesium transporter.
M. mycoides homolog: Q6MS72.
TIGRfam Classification: 2=Generic.
Category: Essential.

Statistics

Total GO Annotation: 450
Unique PROST Go: 47
Unique BLAST Go: 70
Unique Foldseek Go: 1

Total Homologs: 518
Unique PROST Homologs: 45
Unique BLAST Homologs: 31
Unique Foldseek Homologs: 0

Literature

Danchin and Fang [1]: divalent ion transporter, ATP-dependent|transports calcium in B. subtilis, likely manganese transporter
Yang and Tsui [2]: Magnesium transporting ATPase, P type 1
Antczak et al. [3]: mgtA; Magnesium-importing P-type ATP-ase mgtA
Zhang et al. [4]: GO:0005391|sodium:potassium-exchanging ATPase activity
Bianchi et al. [5]: Magnesium transporting ATPase

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was O43108 (Calcium-transporting ATPase 1) with a FATCAT P-Value: 0 and RMSD of 3.34 angstrom. The sequence alignment identity is 25.9%.
Structural alignment shown in left. Query protein AVX55014.1 colored as red in alignment, homolog O43108 colored as blue. Query protein AVX55014.1 is also shown in right top, homolog O43108 showed in right bottom. They are colored based on secondary structures.

  AVX55014.1 MFKTKKGNLKSLD-YKKQDYVIKLSNTNSNN--------LESILD---SKI------GL-NNQ--TRQNNISKFGSNQI-------VVKKFLIFKKILET 72
      O43108 -----------MDSHTSTEGV-PLSETNNRSHATPSAQYCQMTVEETCSKLQTNPETGLTSSQEAMHRRDI--HGSNEFAQEEEDSLIKKF--FEQFSEN 84

  AVX55014.1 LIEPFNLLLLFIGILELIIYFLFQRNWITLISAFIIFFMIFLASIVDFIQEYKAYKFNLK-LTKIIENDVFVVNDQIKDFNNLNYQNIKNNLIKEKQSNL 171
      O43108 ---P--LLLLLIG-AAAVSFFMGNHD-----DAISITLAILIVTTVGFVQEYRSEK-SLEALNKLVPPEAHLIRAG-------NSQTV---L----ASTL 158

  AVX55014.1 TIGDVVYLSKGDIIPSDCRIIWSEDLYLDESTLTGESKAIKKQTTN--TKTNFLELE---NILFKETLIVSGNCLAVVININKDNYSNSLLDLIDDEVI- 265
      O43108 VPGDLVEFSVGDRIPADCRIVKAVHLSIDESNLTGETTPVTKD-TNPVTGTPPIGLADRTNTAYMGTLVRDGNGTGIVVGTGSHTAFGAVYDMVSE--IS 255

  AVX55014.1 ---TDYEKGINKVTKILIYLISI-LVFIITFISLLKTGISNWTSSLVFGLSIAVSLTPEALPAIISSNLKLASKRLSKNKVVIKKLSVLQNIGSVNILAT 361
      O43108 TPKTPLQASMDNLGKDL-SLVSFGVIGVICLIGMFQ-G-RDWLEMFTIGVSLAVAAIPEGLPIIVTVTLALGVLRMSRQKAIVRKLPSVETLGSVNVICS 352

  AVX55014.1 DKTGTLT---LDTTNIETYLDINNQKNKLLM---QYFFYN-------AYFQN--NLFDTIDKA--IIDQFK---------TNISDIKLIDHLSF----D- 430
      O43108 DKTGTLTRNHMSCTTCWT-VDMGDLANAVTLKPGQS--HTEADPKAVAALKNSVSLANML-KVGNLCNNSKFNREAGHLVGNATDIALIEVLDYFGLEDT 448

  AVX55014.1 HNFRISSVL-INFNSSN--LL--ITKGSLEEILEITSFINVN--NQVI-NLCDNY-K--------N--M---IIDQVNSYTKKGYKVLVLSYKNSDVIDN 508
      O43108 RETR-KRVAEVPFSSSRKWMLTSTTTGD-----SSTPMISVKGAGEVIAPFCEYYCKKDGKTAPFNDDMRKKVTEIASEMSNDGLRIIAFAYKQGKYEEG 542

  AVX55014.1 -----KNLIYLG-MVVFSDQIRENVKQVIDTFKAYDIDIKVLSGDNLYTCKNVCDQVG--INSNT-SLI-GKQINNLTKEELIKISQSVNIFYKLSPLDK 598
      O43108 SEEAPEGLVFAGLMGLY-DPPRPDVPRAIRRLTTGGVRVVMITGDSAATALSIGRRIGMPLMPGTQSVVEGSKLATMSDQALDECLQTASIFARTSPEDK 641

  AVX55014.1 AKIIDSL-KSNNVVGFLGDGVNDAVALKKADVGISV-NNASSLAKQSADVILLEKD----LNALEHAFIIGRKTFSNAIKYIKITVASNFGILLTLLLAT 692
      O43108 MKIVKGFQRRGDVVAMTGDGVNDAPALKLADIGIAMGQGGTDVAKEAADMILTDDDFATILSAIEE----GKGIFNNIRNFITFQLSTSMAALSIVAVAT 737

  AVX55014.1 SLFKFE-VMSPIQLLIQNLIFD--FANLVFVFDNVDESSIKKPQK-WNIKSIIPFAIFNGL-TQVIISFINFMILYFGFNIK-GL----DTYSIELFQTC 782
      O43108 -IMGLENPLNPMQILWINILMDGPPAQSLGV-EPVDPDVMNKPPRPRNEKVMTPDLVKKCVEAAVII-LVGTMLVYV-TQMQDGVIDKRDT-TM-TF-TC 830

  AVX55014.1 Y-FIECILTHIMI-ILVLR--TDK----LSFFKSIASKQML-------ISMLFFSVVCFMIVFISSSFNS--LGFKMMIGNFNNINLSWWFLILFGLEIL 865
      O43108 FVFYD------MFNALACRSAT-KSVFEIGFF---SNKMFLYACGASIIGQL--AVV--YVPFLQSVFQTEALSVK-------DL-LS---LVLISSSV- 904

  AVX55014.1 SWIISELIKKIYLIIFK-----NWI---- 885
      O43108 -WILDE-AKKYFL---KSRSTNNYTNSVV 928

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0031090	organelle membrane
1. PBF	GO:0005388	P-type calcium transporter activity
1. PBF	GO:0031673	H zone
1. PBF	GO:0005516	calmodulin binding
1. PBF	GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
1. PBF	GO:0008551	P-type cadmium transporter activity
1. PBF	GO:1902600	proton transmembrane transport
1. PBF	GO:0014832	urinary bladder smooth muscle contraction
1. PBF	GO:0021989	olfactory cortex development
1. PBF	GO:0010882	regulation of cardiac muscle contraction by calcium ion signaling
1. PBF	GO:0002026	regulation of the force of heart contraction
1. PBF	GO:0036126	sperm flagellum
1. PBF	GO:1903243	negative regulation of cardiac muscle hypertrophy in response to stress
1. PBF	GO:0005802	trans-Golgi network
1. PBF	GO:0008217	regulation of blood pressure
1. PBF	GO:1905145	cellular response to acetylcholine
1. PBF	GO:0032471	negative regulation of endoplasmic reticulum calcium ion concentration
1. PBF	GO:0003056	regulation of vascular associated smooth muscle contraction
1. PBF	GO:0140326	ATPase-coupled intramembrane lipid transporter activity
1. PBF	GO:0021764	amygdala development
1. PBF	GO:0032470	positive regulation of endoplasmic reticulum calcium ion concentration
1. PBF	GO:0036376	sodium ion export across plasma membrane
1. PBF	GO:0015413	ABC-type nickel transporter activity
1. PBF	GO:0010751	negative regulation of nitric oxide mediated signal transduction
1. PBF	GO:0046686	response to cadmium ion
1. PBF	GO:0016324	apical plasma membrane
1. PBF	GO:0006984	ER-nucleus signaling pathway
1. PBF	GO:0045823	positive regulation of heart contraction
1. PBF	GO:0031448	positive regulation of fast-twitch skeletal muscle fiber contraction
1. PBF	GO:0001818	negative regulation of cytokine production
1. PBF	GO:1902082	positive regulation of calcium ion import into sarcoplasmic reticulum
1. PBF	GO:0005887	integral component of plasma membrane
1. PBF	GO:0030501	positive regulation of bone mineralization
1. PBF	GO:1990036	calcium ion import into sarcoplasmic reticulum
1. PBF	GO:0090076	relaxation of skeletal muscle
1. PBF	GO:0019829	ATPase-coupled cation transmembrane transporter activity
1. PBF	GO:0015444	P-type magnesium transporter activity
1. PBF	GO:0045332	phospholipid translocation
1. PBF	GO:0106134	positive regulation of cardiac muscle cell contraction
1. PBF	GO:0032468	Golgi calcium ion homeostasis
1. PBF	GO:0045822	negative regulation of heart contraction
1. PBF	GO:0042470	melanosome
1. PBF	GO:0030007	cellular potassium ion homeostasis
1. PBF	GO:1902548	negative regulation of cellular response to vascular endothelial growth factor stimulus
1. PBF	GO:1901896	positive regulation of ATPase-coupled calcium transmembrane transporter activity
1. PBF	GO:0030424	axon
1. PBF	GO:0033017	sarcoplasmic reticulum membrane
1. PBF	GO:0006942	regulation of striated muscle contraction
1. PBF	GO:0006874	cellular calcium ion homeostasis
1. PBF	GO:1903233	regulation of calcium ion-dependent exocytosis of neurotransmitter
1. PBF	GO:0036487	nitric-oxide synthase inhibitor activity
1. PBF	GO:0030955	potassium ion binding
1. PBF	GO:0097470	ribbon synapse
1. PBF	GO:0070588	calcium ion transmembrane transport
1. PBF	GO:0032472	Golgi calcium ion transport
1. PBF	GO:0016323	basolateral plasma membrane
1. PBF	GO:1903515	calcium ion transport from cytosol to endoplasmic reticulum
1. PBF	GO:0002028	regulation of sodium ion transport
1. PBF	GO:0008553	P-type proton-exporting transporter activity
1. PBF	GO:1990573	potassium ion import across plasma membrane
1. PBF	GO:0033292	T-tubule organization
1. PBF	GO:0045989	positive regulation of striated muscle contraction
1. PBF	GO:1900082	negative regulation of arginine catabolic process
1. PBF	GO:0140056	organelle localization by membrane tethering
1. PBF	GO:0016529	sarcoplasmic reticulum
1. PBF	GO:1990456	mitochondrion-endoplasmic reticulum membrane tethering
1. PBF	GO:0051928	positive regulation of calcium ion transport
1. PBF	GO:0005793	endoplasmic reticulum-Golgi intermediate compartment
1. PBF	GO:0006816	calcium ion transport
1. PBF	GO:0140603	obsolete ATP hydrolysis activity
1. PBF	GO:0045988	negative regulation of striated muscle contraction
1. PBF	GO:0010248	establishment or maintenance of transmembrane electrochemical gradient
1. PBF	GO:0046872	metal ion binding
1. PBF	GO:0140146	calcium ion import into vacuole
1. PBF	GO:0050998	nitric-oxide synthase binding
1. PBF	GO:0140581	P-type monovalent copper transporter activity
1. PBF	GO:0001504	neurotransmitter uptake
1. PBF	GO:0042998	positive regulation of Golgi to plasma membrane protein transport
1. PBF	GO:0086009	membrane repolarization
1. PBF	GO:1900076	regulation of cellular response to insulin stimulus
1. PBF	GO:1901660	calcium ion export
1. PBF	GO:0031674	I band
1. PBF	GO:0015410	ABC-type manganese transporter activity
1. PBF	GO:0031402	sodium ion binding
1. PBF	GO:0098629	trans-Golgi network membrane organization
1. PBF	GO:0005783	endoplasmic reticulum
1. PBF	GO:0008544	epidermis development
1. PBF	GO:0032778	P-type cobalt transporter activity
1. PBF	GO:0140613	P-type manganese transporter activity
1. PBF	GO:0008900	P-type potassium:proton transporter activity
1. PBF	GO:0005391	P-type sodium:potassium-exchanging transporter activity
1. PBF	GO:1990239	steroid hormone binding
1. PBF	GO:0016463	P-type zinc transporter activity
1. PBF	GO:0006828	manganese ion transport
1. PBF	GO:0005886	plasma membrane
1. PBF	GO:0098736	negative regulation of the force of heart contraction
1. PBF	GO:0140199	negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process
1. PBF	GO:0005385	zinc ion transmembrane transporter activity
1. PBF	GO:0015086	cadmium ion transmembrane transporter activity
1. PBF	GO:1903416	response to glycoside
1. PBF	GO:1903249	negative regulation of citrulline biosynthetic process
1. PBF	GO:0005890	sodium:potassium-exchanging ATPase complex
1. PBF	GO:0030026	cellular manganese ion homeostasis
1. PBF	GO:0086039	P-type calcium transporter activity involved in regulation of cardiac muscle cell membrane potential
1. PBF	GO:0051481	negative regulation of cytosolic calcium ion concentration
1. PBF	GO:0051480	regulation of cytosolic calcium ion concentration
1. PBF	GO:0051453	regulation of intracellular pH
1. PBF	GO:0005524	ATP binding
1. PBF	GO:0030315	T-tubule
1. PBF	GO:0031947	negative regulation of glucocorticoid biosynthetic process
1. PBF	GO:0030285	integral component of synaptic vesicle membrane
1. PBF	GO:0051659	maintenance of mitochondrion location
1. PBF	GO:0006883	cellular sodium ion homeostasis
1. PBF	GO:2000481	positive regulation of cAMP-dependent protein kinase activity
1. PBF	GO:0000045	autophagosome assembly
1. PBF	GO:0120029	proton export across plasma membrane
1. PBF	GO:0020016	ciliary pocket
1. PBF	GO:0042383	sarcolemma
1. PBF	GO:0051599	response to hydrostatic pressure
1. PBF	GO:0008556	P-type potassium transmembrane transporter activity
1. PBF	GO:0016021	integral component of membrane
1. PBF	GO:0070296	sarcoplasmic reticulum calcium ion transport
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0016240	autophagosome membrane docking
1. PBF	GO:0001772	immunological synapse
1. PBF	GO:0000287	magnesium ion binding
1. PBF	GO:0071383	cellular response to steroid hormone stimulus
1. PBF	GO:1990531	phospholipid-translocating ATPase complex
1. PBF	GO:0033106	cis-Golgi network membrane
1. PBF	GO:0043682	P-type divalent copper transporter activity
1. PBF	GO:0090555	phosphatidylethanolamine flippase activity
2. PF	GO:0090556	phosphatidylserine floppase activity
2. PF	GO:0140346	phosphatidylserine flippase activity
2. PF	GO:0140331	aminophospholipid translocation
2. PF	GO:2001225	regulation of chloride transport
3. BF	GO:0071585	detoxification of cadmium ion
3. BF	GO:0005507	copper ion binding
3. BF	GO:0006825	copper ion transport
3. BF	GO:0015445	P-type silver transporter activity
3. BF	GO:0006824	cobalt ion transport
4. PB	GO:0061180	mammary gland epithelium development
4. PB	GO:0052548	regulation of endopeptidase activity
4. PB	GO:0099520	ion antiporter activity involved in regulation of presynaptic membrane potential
4. PB	GO:0045019	negative regulation of nitric oxide biosynthetic process
4. PB	GO:0021702	cerebellar Purkinje cell differentiation
4. PB	GO:0005829	cytosol
4. PB	GO:0051282	regulation of sequestering of calcium ion
4. PB	GO:0002087	regulation of respiratory gaseous exchange by nervous system process
4. PB	GO:0043209	myelin sheath
4. PB	GO:0008344	adult locomotory behavior
4. PB	GO:1990069	stomatal opening
4. PB	GO:0150104	transport across blood-brain barrier
4. PB	GO:1903170	negative regulation of calcium ion transmembrane transport
4. PB	GO:0071872	cellular response to epinephrine stimulus
4. PB	GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process
4. PB	GO:0051561	positive regulation of mitochondrial calcium ion concentration
4. PB	GO:0021707	cerebellar granule cell differentiation
4. PB	GO:0031901	early endosome membrane
4. PB	GO:1990032	parallel fiber
4. PB	GO:0071305	cellular response to vitamin D
4. PB	GO:0005634	nucleus
4. PB	GO:0014898	cardiac muscle hypertrophy in response to stress
4. PB	GO:0140567	transmembrane protein dislocase activity
4. PB	GO:0003009	skeletal muscle contraction
4. PB	GO:1904714	regulation of chaperone-mediated autophagy
4. PB	GO:0043231	intracellular membrane-bounded organelle
4. PB	GO:0097212	lysosomal membrane organization
4. PB	GO:0005901	caveola
4. PB	GO:0016887	ATP hydrolysis activity
4. PB	GO:0055069	zinc ion homeostasis
4. PB	GO:1903561	extracellular vesicle
4. PB	GO:0044326	dendritic spine neck
4. PB	GO:1902906	proteasome storage granule assembly
4. PB	GO:0043548	phosphatidylinositol 3-kinase binding
4. PB	GO:0060113	inner ear receptor cell differentiation
4. PB	GO:0005576	extracellular region
4. PB	GO:0009566	fertilization
4. PB	GO:0097228	sperm principal piece
4. PB	GO:0006814	sodium ion transport
4. PB	GO:0001662	behavioral fear response
4. PB	GO:0043537	negative regulation of blood vessel endothelial cell migration
4. PB	GO:0010996	response to auditory stimulus
4. PB	GO:0098984	neuron to neuron synapse
4. PB	GO:0040011	locomotion
4. PB	GO:0006996	organelle organization
4. PB	GO:0035725	sodium ion transmembrane transport
4. PB	GO:0033157	regulation of intracellular protein transport
4. PB	GO:0061454	release of sequestered calcium ion into cytosol by Golgi
4. PB	GO:0086037	P-type sodium:potassium-exchanging transporter activity involved in regulation of cardiac muscle cell membrane potential
4. PB	GO:0014883	transition between fast and slow fiber
4. PB	GO:0007630	jump response
4. PB	GO:1904646	cellular response to amyloid-beta
4. PB	GO:0046068	cGMP metabolic process
4. PB	GO:0098655	cation transmembrane transport
4. PB	GO:0060101	negative regulation of phagocytosis, engulfment
4. PB	GO:0016328	lateral plasma membrane
4. PB	GO:0006812	cation transport
4. PB	GO:0005509	calcium ion binding
4. PB	GO:0031532	actin cytoskeleton reorganization
4. PB	GO:1990938	peptidyl-aspartic acid autophosphorylation
4. PB	GO:0042995	cell projection
4. PB	GO:0045299	otolith mineralization
4. PB	GO:0071260	cellular response to mechanical stimulus
4. PB	GO:0098839	postsynaptic density membrane
4. PB	GO:0090534	calcium ion-transporting ATPase complex
4. PB	GO:0015085	calcium ion transmembrane transporter activity
4. PB	GO:0000139	Golgi membrane
4. PB	GO:0045851	pH reduction
4. PB	GO:0015662	P-type ion transporter activity
4. PB	GO:1990034	calcium ion export across plasma membrane
4. PB	GO:0098909	regulation of cardiac muscle cell action potential involved in regulation of contraction
4. PB	GO:0042428	serotonin metabolic process
4. PB	GO:0140220	pathogen-containing vacuole
4. PB	GO:1902047	polyamine transmembrane transport
4. PB	GO:1905165	regulation of lysosomal protein catabolic process
4. PB	GO:0006937	regulation of muscle contraction
4. PB	GO:0003407	neural retina development
4. PB	GO:0051001	negative regulation of nitric-oxide synthase activity
4. PB	GO:0034220	ion transmembrane transport
4. PB	GO:0061909	autophagosome-lysosome fusion
4. PB	GO:0030173	integral component of Golgi membrane
4. PB	GO:0098688	parallel fiber to Purkinje cell synapse
4. PB	GO:0044325	transmembrane transporter binding
4. PB	GO:0035641	locomotory exploration behavior
4. PB	GO:1903135	cupric ion binding
4. PB	GO:1905123	regulation of glucosylceramidase activity
4. PB	GO:0032469	endoplasmic reticulum calcium ion homeostasis
4. PB	GO:1903078	positive regulation of protein localization to plasma membrane
4. PB	GO:0055085	transmembrane transport
4. PB	GO:0046034	ATP metabolic process
4. PB	GO:0048867	stem cell fate determination
4. PB	GO:0060048	cardiac muscle contraction
4. PB	GO:1905103	integral component of lysosomal membrane
4. PB	GO:0048306	calcium-dependent protein binding
4. PB	GO:0120025	plasma membrane bounded cell projection
4. PB	GO:0070509	calcium ion import
4. PB	GO:0006940	regulation of smooth muscle contraction
4. PB	GO:0071805	potassium ion transmembrane transport
4. PB	GO:0097734	extracellular exosome biogenesis
4. PB	GO:0006813	potassium ion transport
4. PB	GO:0030165	PDZ domain binding
4. PB	GO:0030346	protein phosphatase 2B binding
4. PB	GO:0061831	apical ectoplasmic specialization
4. PB	GO:0086064	cell communication by electrical coupling involved in cardiac conduction
4. PB	GO:1903543	positive regulation of exosomal secretion
4. PB	GO:0055081	anion homeostasis
4. PB	GO:0060342	photoreceptor inner segment membrane
4. PB	GO:0008270	zinc ion binding
4. PB	GO:0032588	trans-Golgi network membrane
4. PB	GO:0048471	perinuclear region of cytoplasm
4. PB	GO:0035158	regulation of tube diameter, open tracheal system
4. PB	GO:0005794	Golgi apparatus
4. PB	GO:0098978	glutamatergic synapse
4. PB	GO:1903710	spermine transmembrane transport
4. PB	GO:0019229	regulation of vasoconstriction
4. PB	GO:0032591	dendritic spine membrane
4. PB	GO:0021692	cerebellar Purkinje cell layer morphogenesis
4. PB	GO:0035235	ionotropic glutamate receptor signaling pathway
4. PB	GO:0043025	neuronal cell body
4. PB	GO:0140569	extraction of mislocalized protein from ER membrane
4. PB	GO:0035254	glutamate receptor binding
4. PB	GO:0030506	ankyrin binding
4. PB	GO:0016525	negative regulation of angiogenesis
4. PB	GO:0006882	cellular zinc ion homeostasis
4. PB	GO:1900180	regulation of protein localization to nucleus
4. PB	GO:0086036	regulation of cardiac muscle cell membrane potential
4. PB	GO:1901691	proton binding
4. PB	GO:0071386	cellular response to corticosterone stimulus
4. PB	GO:0010155	regulation of proton transport
4. PB	GO:0015988	energy coupled proton transmembrane transport, against electrochemical gradient
4. PB	GO:0008637	apoptotic mitochondrial changes
4. PB	GO:0140351	glycosylceramide flippase activity
4. PB	GO:1990530	Cdc50p-Drs2p complex
4. PB	GO:0032580	Golgi cisterna membrane
4. PB	GO:0035094	response to nicotine
4. PB	GO:1903280	negative regulation of calcium:sodium antiporter activity
4. PB	GO:0010023	proanthocyanidin biosynthetic process
4. PB	GO:0051087	chaperone binding
4. PB	GO:0055119	relaxation of cardiac muscle
4. PB	GO:0044327	dendritic spine head
4. PB	GO:0070885	negative regulation of calcineurin-NFAT signaling cascade
4. PB	GO:0043434	response to peptide hormone
4. PB	GO:1990535	neuron projection maintenance
4. PB	GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
4. PB	GO:0009705	plant-type vacuole membrane
4. PB	GO:0055038	recycling endosome membrane
4. PB	GO:0099059	integral component of presynaptic active zone membrane
4. PB	GO:0032809	neuronal cell body membrane
4. PB	GO:0005768	endosome
4. PB	GO:0031775	lutropin-choriogonadotropic hormone receptor binding
4. PB	GO:0097225	sperm midpiece
4. PB	GO:0060081	membrane hyperpolarization
4. PB	GO:0090280	positive regulation of calcium ion import
4. PB	GO:0009898	cytoplasmic side of plasma membrane
4. PB	GO:0005889	potassium:proton exchanging ATPase complex
4. PB	GO:0034976	response to endoplasmic reticulum stress
4. PB	GO:0012506	vesicle membrane
4. PB	GO:1903779	regulation of cardiac conduction
4. PB	GO:1900121	negative regulation of receptor binding
4. PB	GO:0140345	phosphatidylcholine flippase activity
4. PB	GO:0008542	visual learning
4. PB	GO:0015594	ABC-type putrescine transporter activity
4. PB	GO:0016243	regulation of autophagosome size
4. PB	GO:1905037	autophagosome organization
4. PB	GO:2000152	regulation of ubiquitin-specific protease activity
4. PB	GO:0015417	ABC-type polyamine transporter activity
4. PB	GO:0120200	rod photoreceptor outer segment
4. PB	GO:0045121	membrane raft
4. PB	GO:0044548	S100 protein binding
4. PB	GO:0031902	late endosome membrane
4. PB	GO:0051946	regulation of glutamate uptake involved in transmission of nerve impulse
4. PB	GO:0030641	regulation of cellular pH
4. PB	GO:0008554	P-type sodium transporter activity
4. PB	GO:0005789	endoplasmic reticulum membrane
4. PB	GO:0099056	integral component of presynaptic membrane
4. PB	GO:0015917	aminophospholipid transport
4. PB	GO:0042493
4. PB	GO:0097733	photoreceptor cell cilium
4. PB	GO:0014704	intercalated disc
4. PB	GO:0086004	regulation of cardiac muscle cell contraction
4. PB	GO:0098982	GABA-ergic synapse
4. PB	GO:0030317	flagellated sperm motility
4. PB	GO:1905059	P-type calcium transporter activity involved in regulation of postsynaptic cytosolic calcium ion concentration
4. PB	GO:1905056	P-type calcium transporter activity involved in regulation of presynaptic cytosolic calcium ion concentration
4. PB	GO:1902806	regulation of cell cycle G1/S phase transition
4. PB	GO:0030899	calcium-dependent ATPase activity
4. PB	GO:0016020	membrane
4. PB	GO:0071287	cellular response to manganese ion
4. PB	GO:0050910	detection of mechanical stimulus involved in sensory perception of sound
4. PB	GO:0031095	platelet dense tubular network membrane
4. PB	GO:0014801	longitudinal sarcoplasmic reticulum
4. PB	GO:0005338	nucleotide-sugar transmembrane transporter activity
5. P	GO:0043069	negative regulation of programmed cell death
5. P	GO:0140333	glycerophospholipid flippase activity
5. P	GO:0006892	post-Golgi vesicle-mediated transport
5. P	GO:0007605	sensory perception of sound
5. P	GO:0000749	response to pheromone triggering conjugation with cellular fusion
5. P	GO:0032534	regulation of microvillus assembly
5. P	GO:0015721	bile acid and bile salt transport
5. P	GO:0045176	apical protein localization
5. P	GO:1903830	magnesium ion transmembrane transport
5. P	GO:0003011	involuntary skeletal muscle contraction
5. P	GO:0032420	stereocilium
5. P	GO:1901703	protein localization involved in auxin polar transport
5. P	GO:1905279	regulation of retrograde transport, endosome to Golgi
5. P	GO:0007030	Golgi organization
5. P	GO:1903542	negative regulation of exosomal secretion
5. P	GO:0050884	neuromuscular process controlling posture
5. P	GO:2001135	regulation of endocytic recycling
5. P	GO:0030133	transport vesicle
5. P	GO:1903729	regulation of plasma membrane organization
5. P	GO:0034202	glycolipid floppase activity
5. P	GO:1905038	regulation of membrane lipid metabolic process
5. P	GO:0070867	mating projection tip membrane
5. P	GO:0042584	chromaffin granule membrane
5. P	GO:0001917	photoreceptor inner segment
5. P	GO:0006897	endocytosis
5. P	GO:0140327	flippase activity
5. P	GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
5. P	GO:0006855	xenobiotic transmembrane transport
5. P	GO:0021650	vestibulocochlear nerve formation
5. P	GO:0010831	positive regulation of myotube differentiation
5. P	GO:0042472	inner ear morphogenesis
5. P	GO:0005769	early endosome
5. P	GO:0055037	recycling endosome
5. P	GO:0060119	inner ear receptor cell development
5. P	GO:0008206	bile acid metabolic process
5. P	GO:0031004	potassium ion-transporting ATPase complex
5. P	GO:0060088	auditory receptor cell stereocilium organization
5. P	GO:0015711	organic anion transport
5. P	GO:0035577	azurophil granule membrane
5. P	GO:0002329	pre-B cell differentiation
5. P	GO:0008022	protein C-terminus binding
5. P	GO:0060052	neurofilament cytoskeleton organization
5. P	GO:0035579	specific granule membrane
5. P	GO:1903527	positive regulation of membrane tubulation
5. P	GO:0015247	aminophospholipid flippase activity
5. P	GO:1901612	cardiolipin binding
5. P	GO:0061092	positive regulation of phospholipid translocation
6. F	GO:1990794	basolateral part of cell
7. B	GO:0015094	lead ion transmembrane transporter activity
7. B	GO:0051208	sequestering of calcium ion
7. B	GO:0033162	melanosome membrane
7. B	GO:0071280	cellular response to copper ion
7. B	GO:0010119	regulation of stomatal movement
7. B	GO:0018205	peptidyl-lysine modification
7. B	GO:0007595	lactation
7. B	GO:0042421	norepinephrine biosynthetic process
7. B	GO:0010592	positive regulation of lamellipodium assembly
7. B	GO:0010042	response to manganese ion
7. B	GO:0032773	positive regulation of tyrosinase activity
7. B	GO:0035434	copper ion transmembrane transport
7. B	GO:0045914	negative regulation of catecholamine metabolic process
7. B	GO:0005770	late endosome
7. B	GO:0034760	negative regulation of iron ion transmembrane transport
7. B	GO:0006584	catecholamine metabolic process
7. B	GO:0071236	cellular response to antibiotic
7. B	GO:0046688	response to copper ion
7. B	GO:0030140	trans-Golgi network transport vesicle
7. B	GO:0006829	zinc ion transport
7. B	GO:0071279	cellular response to cobalt ion
7. B	GO:0071281	cellular response to iron ion
7. B	GO:0016532	superoxide dismutase copper chaperone activity
7. B	GO:1903136	cuprous ion binding
7. B	GO:0048023	positive regulation of melanin biosynthetic process
7. B	GO:0043588	skin development
7. B	GO:0002082	regulation of oxidative phosphorylation
7. B	GO:0021860	pyramidal neuron development
7. B	GO:0015691	cadmium ion transport
7. B	GO:0010043	response to zinc ion
7. B	GO:0015680	protein maturation by copper ion transfer
7. B	GO:0015692	lead ion transport
7. B	GO:0015677	copper ion import
7. B	GO:0045793	positive regulation of cell size
7. B	GO:0006875	cellular metal ion homeostasis
7. B	GO:0051353	positive regulation of oxidoreductase activity
7. B	GO:0048251	elastic fiber assembly
7. B	GO:0005774	vacuolar membrane
7. B	GO:1903036	positive regulation of response to wounding
7. B	GO:0006570	tyrosine metabolic process
7. B	GO:0070160	tight junction
7. B	GO:1901671	positive regulation of superoxide dismutase activity
7. B	GO:0032767	copper-dependent protein binding
7. B	GO:0030141	secretory granule
7. B	GO:0005375	copper ion transmembrane transporter activity
7. B	GO:1904959	regulation of cytochrome-c oxidase activity
7. B	GO:1904754	positive regulation of vascular associated smooth muscle cell migration
7. B	GO:0042414	epinephrine metabolic process
7. B	GO:0021954	central nervous system neuron development
7. B	GO:0036120	cellular response to platelet-derived growth factor stimulus
7. B	GO:0010041	response to iron(III) ion
7. B	GO:0001974	blood vessel remodeling
7. B	GO:0071292	cellular response to silver ion
7. B	GO:0051542	elastin biosynthetic process
7. B	GO:1904960	positive regulation of cytochrome-c oxidase activity
7. B	GO:0010273	detoxification of copper ion
7. B	GO:0031069	hair follicle morphogenesis
7. B	GO:0014069	postsynaptic density
7. B	GO:0006568	tryptophan metabolic process
7. B	GO:1902601	silver ion transmembrane transport
7. B	GO:0006878	cellular copper ion homeostasis
7. B	GO:0043473	pigmentation
7. B	GO:0007626	locomotory behavior
7. B	GO:0042415	norepinephrine metabolic process
7. B	GO:0042417	dopamine metabolic process
7. B	GO:0071284	cellular response to lead ion
7. B	GO:0015080	silver ion transmembrane transporter activity
7. B	GO:0042093	T-helper cell differentiation
7. B	GO:0048286	lung alveolus development
7. B	GO:0060003	copper ion export

Uniprot GO Annotations

GO	Description
GO:0016021	integral component of membrane
GO:0005886	plasma membrane
GO:0016887	ATP hydrolysis activity
GO:0016020	membrane
GO:1903830	magnesium ion transmembrane transport
GO:0005524	ATP binding
GO:0015693	magnesium ion transport
GO:0016787	hydrolase activity
GO:0015444	P-type magnesium transporter activity
GO:0000166	nucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	O46674	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2	1.80e-12	2.63e-38	5.29e-23	0.6315
1. PBF	P30336	Probable cadmium-transporting ATPase	3.84e-09	4.02e-04	1.89e-17	0.5103
1. PBF	Q08DA1	Sodium/potassium-transporting ATPase subunit alpha-1	1.66e-12	1.47e-36	7.64e-36	0.6267
1. PBF	Q3Z4A6	Potassium-transporting ATPase ATP-binding subunit	3.39e-09	2.21e-25	7.73e-17	0.5473
1. PBF	Q927G0	Potassium-transporting ATPase ATP-binding subunit 1	6.82e-10	1.57e-25	1.05e-18	0.5311
1. PBF	A9MUE0	Potassium-transporting ATPase ATP-binding subunit	3.20e-09	2.27e-26	9.79e-16	0.5484
1. PBF	P54209	Cation-transporting ATPase CA1	2.22e-16	1.12e-35	8.43e-33	0.7968
1. PBF	P78036	Probable cation-transporting P-type ATPase	4.00e-15	5.76e-58	5.08e-49	0.7451
1. PBF	P37279	Probable copper-transporting ATPase PacS	3.85e-09	3.26e-03	4.64e-18	0.5205
1. PBF	O34431	Calcium-transporting ATPase	0.00e+00	3.72e-50	2.52e-50	0.6422
1. PBF	O32219	Cadmium, zinc and cobalt-transporting ATPase	1.16e-09	2.67e-04	1.81e-17	0.5372
1. PBF	P11607	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2	2.57e-12	2.29e-28	2.81e-23	0.6279
1. PBF	P50997	Sodium/potassium-transporting ATPase subunit alpha-1	1.64e-12	2.64e-36	3.19e-35	0.6287
1. PBF	Q8ZD97	Potassium-transporting ATPase ATP-binding subunit	1.95e-09	3.49e-25	1.35e-13	0.5171
1. PBF	P9WPS8	Probable cation-transporting ATPase F	4.77e-15	6.63e-46	1.09e-54	0.6462
1. PBF	Q69HU0	Probable copper-transporting P-type ATPase B	7.73e-09	1.09e-06	4.40e-15	0.5298
1. PBF	P35317	Sodium/potassium-transporting ATPase subunit alpha	5.96e-14	1.53e-32	4.79e-41	0.6323
1. PBF	P9WPT6	Probable cation-transporting P-type ATPase J	3.15e-09	8.80e-12	7.39e-11	0.4728
1. PBF	Q6GIX1	Probable cadmium-transporting ATPase	9.32e-09	4.60e-05	4.35e-17	0.5143
1. PBF	B7HWG1	Potassium-transporting ATPase ATP-binding subunit	3.58e-09	1.03e-28	5.90e-23	0.5128
1. PBF	P27112	Potassium-transporting ATPase alpha chain 1	5.06e-11	1.43e-33	7.75e-43	0.6114
1. PBF	A4TL06	Potassium-transporting ATPase ATP-binding subunit	2.29e-09	3.49e-25	1.35e-13	0.5113
1. PBF	P24798	Sodium/potassium-transporting ATPase subunit alpha-3	2.29e-12	1.62e-36	1.11e-38	0.6381
1. PBF	P58165	Plasma membrane calcium-transporting ATPase 2 (Fragment)	4.84e-14	2.22e-26	1.33e-22	0.7193
1. PBF	Q95JN5	Polyamine-transporting ATPase 13A3	1.01e-11	2.54e-23	1.13e-04	0.6818
1. PBF	B2V2P3	Potassium-transporting ATPase ATP-binding subunit	3.90e-10	4.71e-29	3.27e-17	0.5099
1. PBF	P73867	Potassium-transporting ATPase ATP-binding subunit	1.44e-09	6.30e-24	7.44e-17	0.5424
1. PBF	Q9A7X7	Potassium-transporting ATPase ATP-binding subunit	1.95e-09	2.88e-20	1.79e-13	0.4917
1. PBF	B0R9M0	Potassium-transporting ATPase ATP-binding subunit	1.28e-08	7.57e-23	2.76e-23	0.5088
1. PBF	Q8XU11	Potassium-transporting ATPase ATP-binding subunit	2.69e-09	1.98e-23	3.77e-20	0.4798
1. PBF	O31688	Zinc-transporting ATPase	1.67e-07	1.01e-09	8.17e-11	0.5709
1. PBF	Q0VCY0	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1	7.90e-13	8.07e-38	5.17e-26	0.6367
1. PBF	B4TBA6	Potassium-transporting ATPase ATP-binding subunit	1.97e-09	2.41e-26	1.10e-15	0.5476
1. PBF	B8DAW1	Potassium-transporting ATPase ATP-binding subunit	7.80e-10	6.49e-26	7.10e-18	0.5106
1. PBF	Q9YH26	Sodium/potassium-transporting ATPase subunit alpha-1	1.49e-12	6.06e-32	5.45e-37	0.6254
1. PBF	Q5ZKB7	Probable cation-transporting ATPase 13A4	1.88e-12	1.02e-23	1.96e-12	0.6848
1. PBF	Q8YSD5	Potassium-transporting ATPase ATP-binding subunit 2	8.09e-09	1.73e-23	8.35e-16	0.506
1. PBF	P17326	Sodium/potassium-transporting ATPase subunit alpha-A	2.78e-14	2.05e-39	6.41e-43	0.6242
1. PBF	B7II09	Potassium-transporting ATPase ATP-binding subunit	4.80e-09	7.04e-29	2.40e-22	0.5112
1. PBF	A0R3A7	Probable cobalt/nickel-exporting P-type ATPase	1.32e-08	1.09e-10	2.77e-08	0.5434
1. PBF	Q92126	Potassium-transporting ATPase alpha chain 1	1.02e-13	1.90e-31	8.36e-44	0.6145
1. PBF	P57709	Calcium-transporting ATPase type 2C member 1	2.74e-13	4.76e-44	7.36e-55	0.6646
1. PBF	Q8Y3Z7	Potassium-transporting ATPase ATP-binding subunit	2.01e-10	2.18e-26	4.61e-18	0.5393
1. PBF	B7HDF9	Potassium-transporting ATPase ATP-binding subunit	4.22e-09	8.87e-28	1.90e-22	0.5116
1. PBF	P47317	Probable cation-transporting P-type ATPase	0.00e+00	1.22e-56	7.43e-48	0.7741
1. PBF	Q07421	Plasma membrane ATPase	0.00e+00	1.11e-38	9.58e-49	0.7985
1. PBF	Q8PCM1	Potassium-transporting ATPase ATP-binding subunit	2.58e-09	2.64e-25	1.30e-13	0.5415
1. PBF	Q47H39	Potassium-transporting ATPase ATP-binding subunit	3.53e-08	3.70e-25	5.07e-14	0.5153
1. PBF	P59219	Potassium-transporting ATPase ATP-binding subunit	1.69e-09	1.87e-27	1.31e-14	0.5546
1. PBF	P04191	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1	1.17e-13	2.45e-38	9.70e-26	0.6736
1. PBF	B1X6M8	Potassium-transporting ATPase ATP-binding subunit	2.00e-09	1.77e-24	7.03e-17	0.5319
1. PBF	Q92XJ0	Potassium-transporting ATPase ATP-binding subunit	8.17e-09	3.95e-23	3.33e-13	0.4949
1. PBF	A4W860	Potassium-transporting ATPase ATP-binding subunit	1.05e-08	4.09e-27	4.30e-17	0.5564
1. PBF	C3LF99	Potassium-transporting ATPase ATP-binding subunit	4.38e-09	7.83e-29	3.67e-21	0.5118
1. PBF	A7ZXV8	Potassium-transporting ATPase ATP-binding subunit	3.48e-09	2.00e-25	9.27e-17	0.5365
1. PBF	A7GLG4	Potassium-transporting ATPase ATP-binding subunit	7.97e-08	1.09e-27	2.02e-21	0.5023
1. PBF	Q6G7N3	Potassium-transporting ATPase ATP-binding subunit	1.93e-10	1.40e-27	9.64e-17	0.5509
1. PBF	P28774	Sodium/potassium-transporting ATPase subunit alpha-B	1.22e-15	3.19e-37	7.79e-41	0.6371
1. PBF	Q0TJY9	Potassium-transporting ATPase ATP-binding subunit	2.78e-09	1.01e-25	4.93e-17	0.5402
1. PBF	Q73E41	Calcium-transporting ATPase 1	4.44e-16	6.55e-52	8.05e-74	0.6635
1. PBF	B4TQ22	Potassium-transporting ATPase ATP-binding subunit	2.02e-09	3.84e-26	1.03e-15	0.5524
1. PBF	C1KZN5	Potassium-transporting ATPase ATP-binding subunit	4.82e-10	5.64e-26	6.02e-18	0.5052
1. PBF	B7MPK0	Potassium-transporting ATPase ATP-binding subunit	2.87e-09	8.27e-26	4.72e-17	0.5407
1. PBF	P0A503	Manganese-exporting P-type ATPase	1.30e-10	1.00e-02	3.52e-13	0.4924
1. PBF	O32619	Copper-transporting ATPase	3.88e-08	3.64e-02	1.24e-18	0.5598
1. PBF	Q1C586	Potassium-transporting ATPase ATP-binding subunit	2.21e-09	3.49e-25	1.35e-13	0.5152
1. PBF	Q6GIX4	Probable copper-transporting P-type ATPase B	2.19e-09	4.66e-04	3.95e-15	0.537
1. PBF	B5XZE9	Potassium-transporting ATPase ATP-binding subunit	4.99e-10	1.15e-24	3.57e-16	0.5148
1. PBF	P46839	Copper-exporting P-type ATPase	1.52e-08	8.95e-04	5.13e-06	0.491
1. PBF	P70083	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1	7.26e-13	4.44e-39	9.67e-27	0.6301
1. PBF	Q8R8I6	Potassium-transporting ATPase ATP-binding subunit	1.29e-08	7.06e-28	1.17e-17	0.4927
1. PBF	P07038	Plasma membrane ATPase	0.00e+00	2.84e-37	1.97e-52	0.7912
1. PBF	Q92030	Sodium/potassium-transporting ATPase subunit alpha-1	4.80e-12	8.59e-37	3.67e-35	0.6202
1. PBF	B7JRB8	Potassium-transporting ATPase ATP-binding subunit	4.83e-09	1.14e-28	4.01e-21	0.5073
1. PBF	Q81HQ0	Potassium-transporting ATPase ATP-binding subunit	3.25e-09	6.77e-28	3.42e-22	0.5079
1. PBF	Q9RQB4	Cadmium, zinc and cobalt-transporting ATPase	1.57e-09	8.95e-04	2.00e-16	0.5062
1. PBF	A9R3X3	Potassium-transporting ATPase ATP-binding subunit	2.00e-09	3.49e-25	1.35e-13	0.5521
1. PBF	P58312	Sodium/potassium-transporting ATPase subunit alpha-3	6.52e-12	4.77e-37	1.81e-36	0.6277
1. PBF	Q98GX6	Potassium-transporting ATPase ATP-binding subunit	5.07e-09	1.34e-23	3.23e-15	0.5551
1. PBF	Q71W90	Potassium-transporting ATPase ATP-binding subunit	7.97e-10	5.64e-26	6.02e-18	0.5009
1. PBF	Q93MV5	Potassium-transporting ATPase ATP-binding subunit	3.12e-09	1.73e-24	2.26e-17	0.5332
1. PBF	P09572	Sodium/potassium-transporting ATPase subunit alpha-1	2.03e-12	9.89e-37	5.34e-37	0.6281
1. PBF	Q8X9F9	Potassium-transporting ATPase ATP-binding subunit	2.77e-09	1.39e-25	9.63e-18	0.5194
1. PBF	Q1REM0	Potassium-transporting ATPase ATP-binding subunit	2.65e-09	1.51e-23	5.08e-16	0.5364
1. PBF	P9WPT4	Manganese-exporting P-type ATPase	1.58e-10	1.00e-02	3.52e-13	0.4958
1. PBF	Q7PPA5	Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type	1.41e-13	1.79e-40	8.56e-32	0.6362
1. PBF	A6T6D8	Potassium-transporting ATPase ATP-binding subunit	7.11e-10	4.26e-25	1.76e-16	0.5164
1. PBF	P63684	Potassium-transporting ATPase ATP-binding subunit 2	3.72e-09	5.73e-28	1.19e-16	0.5648
1. PBF	A7FFQ9	Potassium-transporting ATPase ATP-binding subunit	2.55e-08	9.71e-26	1.09e-13	0.4989
1. PBF	B5QWE9	Potassium-transporting ATPase ATP-binding subunit	1.82e-09	2.41e-26	1.10e-15	0.5167
1. PBF	Q8YPE9	Potassium-transporting ATPase ATP-binding subunit 1	1.72e-09	4.97e-23	8.91e-21	0.5275
1. PBF	A0RA13	Potassium-transporting ATPase ATP-binding subunit	5.59e-08	7.50e-29	2.56e-21	0.5096
1. PBF	B7LAA4	Potassium-transporting ATPase ATP-binding subunit	3.27e-09	1.21e-25	5.29e-17	0.544
1. PBF	P05025	Sodium/potassium-transporting ATPase subunit alpha	1.43e-12	5.01e-39	7.65e-37	0.6207
1. PBF	B5EZE3	Potassium-transporting ATPase ATP-binding subunit	2.66e-09	6.24e-26	1.36e-15	0.5446
1. PBF	A2VDL6	Sodium/potassium-transporting ATPase subunit alpha-2	2.21e-12	7.00e-38	1.12e-40	0.6238
1. PBF	O32328	Potassium-transporting ATPase ATP-binding subunit	9.26e-09	1.67e-29	5.13e-17	0.5084
1. PBF	A7ZJ80	Potassium-transporting ATPase ATP-binding subunit	2.99e-09	2.04e-25	8.43e-17	0.5454
1. PBF	B1LLE1	Potassium-transporting ATPase ATP-binding subunit	2.90e-09	2.08e-25	9.03e-17	0.5481
1. PBF	Q9RZP0	Potassium-transporting ATPase ATP-binding subunit	1.87e-09	1.91e-24	2.06e-19	0.5179
1. PBF	P9WPU2	Potassium-transporting ATPase ATP-binding subunit	1.25e-09	8.50e-22	2.79e-23	0.486
1. PBF	Q97BF6	Potassium-transporting ATPase ATP-binding subunit	3.76e-09	1.14e-27	1.83e-20	0.5586
1. PBF	Q8ZQW2	Potassium-transporting ATPase ATP-binding subunit	1.89e-09	1.74e-26	8.24e-16	0.5558
1. PBF	Q7N6W6	Potassium-transporting ATPase ATP-binding subunit	2.90e-10	2.30e-25	1.44e-17	0.5116
1. PBF	D3K0R6	Plasma membrane calcium-transporting ATPase 4	2.05e-13	1.64e-17	7.71e-26	0.7339
1. PBF	Q5RCD8	Sodium/potassium-transporting ATPase subunit alpha-2	3.72e-12	6.51e-38	1.98e-39	0.6328
1. PBF	A6QIS1	Potassium-transporting ATPase ATP-binding subunit	2.01e-10	3.62e-28	9.64e-17	0.564
1. PBF	Q6HN78	Potassium-transporting ATPase ATP-binding subunit	2.55e-09	8.34e-29	3.40e-21	0.5133
1. PBF	Q9ZL53	Cadmium, zinc and cobalt-transporting ATPase	4.61e-10	2.71e-05	3.37e-17	0.4996
1. PBF	P20021	Cadmium-transporting ATPase	2.20e-09	5.82e-04	1.83e-15	0.4766
1. PBF	B2TMJ2	Potassium-transporting ATPase ATP-binding subunit	1.04e-09	5.13e-29	8.70e-18	0.5467
1. PBF	P35315	Probable calcium-transporting ATPase	0.00e+00	1.42e-43	3.61e-28	0.8156
1. PBF	P83970	Plasma membrane ATPase	0.00e+00	1.64e-16	5.64e-44	0.8137
1. PBF	Q8NVI2	Potassium-transporting ATPase ATP-binding subunit	3.27e-10	1.40e-27	9.64e-17	0.5553
1. PBF	C4LDL7	Potassium-transporting ATPase ATP-binding subunit	7.59e-10	1.70e-24	1.30e-14	0.5137
1. PBF	P25489	Sodium/potassium-transporting ATPase subunit alpha-1	2.61e-12	3.28e-31	2.00e-33	0.6284
1. PBF	P35597	Probable cation-transporting ATPase exp7	0.00e+00	3.55e-48	7.19e-34	0.7367
1. PBF	B7MFW2	Potassium-transporting ATPase ATP-binding subunit	2.58e-09	1.51e-23	5.08e-16	0.5447
1. PBF	Q95050	Probable cation-transporting ATPase 9	1.20e-14	2.79e-32	3.89e-09	0.643
1. PBF	Q8PPC9	Potassium-transporting ATPase ATP-binding subunit	3.09e-09	9.78e-25	1.93e-15	0.5429
1. PBF	P37278	Calcium-transporting ATPase	5.70e-12	2.00e-53	5.15e-65	0.6415
1. PBF	Q9YGL9	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3	4.86e-12	9.22e-37	3.32e-28	0.6345
1. PBF	D2WKD8	Sodium/potassium-transporting ATPase subunit alpha-2	1.31e-12	1.05e-37	2.41e-40	0.6371
1. PBF	Q8Y8Q5	Calcium-transporting ATPase lmo0841	1.78e-15	1.27e-51	7.97e-55	0.6159
1. PBF	P0ABB9	Magnesium-transporting ATPase, P-type 1	0.00e+00	9.85e-72	2.22e-149	0.8549
1. PBF	P9WPT2	Probable cobalt/nickel-exporting P-type ATPase	2.04e-08	7.08e-11	2.93e-05	0.5208
1. PBF	P12522	Probable proton ATPase 1B	0.00e+00	4.69e-23	1.21e-45	0.7902
1. PBF	A9VFM1	Potassium-transporting ATPase ATP-binding subunit	4.01e-09	1.50e-28	9.78e-23	0.5179
1. PBF	A8GB61	Potassium-transporting ATPase ATP-binding subunit	1.10e-08	2.89e-26	1.81e-15	0.5165
1. PBF	B7M5L3	Potassium-transporting ATPase ATP-binding subunit	2.68e-09	1.21e-25	5.29e-17	0.5481
1. PBF	Q60048	Probable cadmium-transporting ATPase	1.89e-09	1.33e-04	2.51e-16	0.497
1. PBF	P9WPT0	Calcium-transporting ATPase CtpE	3.60e-14	1.26e-35	1.64e-31	0.7285
1. PBF	P54210	Plasma membrane ATPase	0.00e+00	1.65e-09	3.87e-35	0.7939
1. PBF	O77696	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3	1.46e-12	3.04e-38	3.98e-30	0.6283
1. PBF	P18907	Sodium/potassium-transporting ATPase subunit alpha-1	1.98e-12	9.43e-37	8.12e-37	0.6247
1. PBF	Q4LAI2	Potassium-transporting ATPase ATP-binding subunit	1.02e-08	1.19e-23	1.97e-19	0.5176
1. PBF	B5R670	Potassium-transporting ATPase ATP-binding subunit	1.41e-08	1.16e-26	9.83e-16	0.549
1. PBF	Q8FJV4	Potassium-transporting ATPase ATP-binding subunit	3.01e-09	1.01e-25	4.93e-17	0.5426
1. PBF	P22180	Plasma membrane ATPase 1	0.00e+00	8.55e-18	2.94e-43	0.8035
1. PBF	B7LKR7	Potassium-transporting ATPase ATP-binding subunit	2.49e-09	2.08e-25	2.35e-17	0.5527
1. PBF	P23220	Plasma membrane calcium-transporting ATPase 1	1.88e-13	1.06e-16	6.66e-24	0.7249
1. PBF	Q1CKH2	Potassium-transporting ATPase ATP-binding subunit	1.08e-08	3.49e-25	1.35e-13	0.5126
1. PBF	Q0TRT3	Potassium-transporting ATPase ATP-binding subunit	1.15e-09	3.98e-29	3.05e-19	0.512
1. PBF	A0AM16	Potassium-transporting ATPase ATP-binding subunit	1.54e-10	8.35e-25	6.01e-17	0.5497
1. PBF	Q92036	Potassium-transporting ATPase alpha chain 2	9.77e-14	3.51e-37	1.04e-42	0.6191
1. PBF	P05024	Sodium/potassium-transporting ATPase subunit alpha-1	1.24e-12	1.62e-36	2.80e-35	0.6317
1. PBF	P36640	Magnesium-transporting ATPase, P-type 1	0.00e+00	2.55e-69	1.45e-145	0.8878
1. PBF	Q08853	Calcium-transporting ATPase	1.14e-10	3.00e-24	9.42e-24	0.6635
1. PBF	O43108	Calcium-transporting ATPase 1	0.00e+00	3.94e-47	9.07e-56	0.7959
1. PBF	B7UKX6	Potassium-transporting ATPase ATP-binding subunit	2.87e-09	1.01e-25	4.93e-17	0.5391
1. PBF	Q8KU73	Potassium-transporting ATPase ATP-binding subunit	1.52e-10	4.71e-29	1.77e-19	0.5493
1. PBF	Q5PCJ7	Potassium-transporting ATPase ATP-binding subunit	2.94e-09	2.14e-26	1.21e-15	0.5432
1. PBF	Q5HEC4	Potassium-transporting ATPase ATP-binding subunit	2.21e-10	3.62e-28	9.64e-17	0.5591
1. PBF	Q8U9D9	Potassium-transporting ATPase ATP-binding subunit	6.33e-09	3.12e-24	5.35e-12	0.5035
1. PBF	Q667S4	Potassium-transporting ATPase ATP-binding subunit	9.43e-09	9.33e-26	1.01e-13	0.5385
1. PBF	B6HYQ5	Potassium-transporting ATPase ATP-binding subunit	3.78e-09	2.04e-25	8.43e-17	0.5457
1. PBF	Q5HK64	Potassium-transporting ATPase ATP-binding subunit	3.92e-09	3.73e-23	2.03e-18	0.5393
1. PBF	B4U8E4	Potassium-transporting ATPase ATP-binding subunit	1.10e-08	1.42e-25	1.77e-18	0.5103
1. PBF	P58414	Probable cadmium-transporting ATPase	2.75e-09	7.11e-04	1.13e-15	0.5154
1. PBF	B5BCA4	Potassium-transporting ATPase ATP-binding subunit	7.04e-10	2.14e-26	1.21e-15	0.5486
1. PBF	Q04956	Probable cation-transporting ATPase 1	1.22e-01	4.92e-03	1.39e-06	0.3657
1. PBF	O29777	Probable copper-exporting P-type ATPase	3.27e-08	6.47e-04	5.58e-19	0.4401
1. PBF	Q9TV52	Potassium-transporting ATPase alpha chain 2	1.14e-11	1.45e-23	1.55e-41	0.6267
1. PBF	Q64392	Potassium-transporting ATPase alpha chain 2	8.66e-15	7.68e-33	6.72e-45	0.6221
1. PBF	P19156	Potassium-transporting ATPase alpha chain 1	9.21e-13	1.67e-33	3.85e-42	0.6047
1. PBF	P20647	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2	7.58e-12	6.23e-28	4.74e-23	0.626
1. PBF	Q00779	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2	2.98e-12	2.76e-38	5.29e-23	0.6287
1. PBF	P22036	Magnesium-transporting ATPase, P-type 1	0.00e+00	1.71e-73	8.32e-142	0.8838
1. PBF	J9VQQ3	Calcium-transporting ATPase 2	9.05e-12	9.07e-12	1.08e-20	0.6872
1. PBF	P57699	Potassium-transporting ATPase ATP-binding subunit	1.36e-08	7.57e-23	2.76e-23	0.5318
1. PBF	A8YZ02	Probable copper-transporting P-type ATPase B	1.26e-09	3.19e-07	1.78e-16	0.5333
1. PBF	P63686	Probable cobalt/nickel-exporting P-type ATPase	1.84e-08	7.08e-11	2.93e-05	0.5257
1. PBF	Q03669	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2	4.16e-12	3.47e-28	1.45e-25	0.632
1. PBF	Q03194	Plasma membrane ATPase 4	0.00e+00	5.77e-16	8.54e-47	0.8195
1. PBF	A8Z4X9	Potassium-transporting ATPase ATP-binding subunit	1.88e-10	3.62e-28	9.64e-17	0.5586
1. PBF	Q57RN0	Potassium-transporting ATPase ATP-binding subunit	2.43e-09	7.63e-26	6.23e-17	0.5457
1. PBF	Q59465	Cadmium, zinc and cobalt-transporting ATPase	4.68e-09	4.81e-05	1.29e-18	0.4966
1. PBF	A4SZG8	Potassium-transporting ATPase ATP-binding subunit	6.68e-09	1.90e-21	1.98e-13	0.5127
1. PBF	O30085	Copper-exporting P-type ATPase B	3.67e-09	8.31e-03	4.92e-25	0.4945
1. PBF	P28877	Plasma membrane ATPase 1	0.00e+00	5.93e-39	1.04e-55	0.785
1. PBF	Q92105	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1	4.11e-15	3.51e-37	3.49e-27	0.6327
1. PBF	P24797	Sodium/potassium-transporting ATPase subunit alpha-2	1.46e-12	1.51e-36	2.64e-40	0.6374
1. PBF	Q63FR0	Potassium-transporting ATPase ATP-binding subunit	5.77e-09	1.01e-28	1.70e-21	0.508
1. PBF	Q08435	Plasma membrane ATPase 1	0.00e+00	1.07e-17	3.08e-43	0.8144
1. PBF	P04074	Sodium/potassium-transporting ATPase subunit alpha-1	1.46e-12	1.44e-36	5.25e-36	0.6264
1. PBF	Q8CQF7	Probable copper-transporting P-type ATPase B	6.86e-10	1.64e-07	5.99e-18	0.5479
1. PBF	Q9N0Z6	Sodium/potassium-transporting ATPase subunit alpha-1	1.90e-12	5.30e-32	2.03e-37	0.6253
1. PBF	A1JQS2	Potassium-transporting ATPase ATP-binding subunit	1.94e-08	1.45e-25	6.20e-15	0.4986
1. PBF	P57698	Potassium-transporting ATPase ATP-binding subunit	1.94e-09	9.84e-24	4.55e-17	0.5444
1. PBF	Q2YUH7	Potassium-transporting ATPase ATP-binding subunit	4.00e-09	1.65e-27	2.22e-15	0.5688
1. PBF	Q926K7	Potassium-transporting ATPase ATP-binding subunit 2	1.09e-08	2.53e-30	1.84e-23	0.5354
1. PBF	P24545	Plasma membrane ATPase	0.00e+00	7.93e-42	3.61e-51	0.8118
1. PBF	Q5R5K5	Calcium-transporting ATPase type 2C member 1	2.29e-13	4.98e-52	1.28e-56	0.6756
1. PBF	Q292Q0	Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type	1.72e-14	2.58e-42	3.76e-28	0.6283
1. PBF	Q324L0	Potassium-transporting ATPase ATP-binding subunit	4.14e-09	8.78e-26	1.93e-16	0.5103
1. PBF	P63683	Potassium-transporting ATPase ATP-binding subunit 2	1.84e-09	5.73e-28	1.19e-16	0.548
1. PBF	A1A8W1	Potassium-transporting ATPase ATP-binding subunit	3.25e-09	1.51e-23	5.08e-16	0.5462
1. PBF	Q92123	Sodium/potassium-transporting ATPase subunit alpha-1	1.83e-12	8.21e-33	1.36e-34	0.6331
1. PBF	Q42883	Calcium-transporting ATPase, endoplasmic reticulum-type	3.57e-14	1.32e-39	1.06e-31	0.6587
1. PBF	Q6RWA9	Sodium/potassium-transporting ATPase subunit alpha	6.93e-14	1.55e-38	6.20e-38	0.6281
1. PBF	Q6GKN3	Potassium-transporting ATPase ATP-binding subunit 1	1.52e-08	3.73e-23	2.03e-18	0.5113
1. PBF	B7N9U0	Potassium-transporting ATPase ATP-binding subunit	3.25e-09	2.54e-25	1.87e-17	0.5337
1. PBF	C4ZWH3	Potassium-transporting ATPase ATP-binding subunit	1.16e-10	1.77e-24	7.03e-17	0.5313
1. PBF	B2VJK3	Potassium-transporting ATPase ATP-binding subunit	1.55e-08	1.17e-23	9.14e-13	0.5683
1. PBF	B7NMQ0	Potassium-transporting ATPase ATP-binding subunit	3.57e-09	2.25e-25	1.00e-16	0.5431
1. PBF	P0CW78	Cadmium/zinc-transporting ATPase HMA3	2.08e-09	2.59e-09	1.77e-16	0.4841
1. PBF	Q9R6X1	Potassium-transporting ATPase ATP-binding subunit	5.30e-09	5.18e-24	2.35e-18	0.5682
1. PBF	Q5RDR3	Sodium/potassium-transporting ATPase subunit alpha-1	1.99e-12	8.62e-32	1.64e-35	0.6307
1. PBF	P57700	Potassium-transporting ATPase ATP-binding subunit	2.95e-09	2.36e-26	9.16e-22	0.5652
1. PBF	P0A007	Potassium-transporting ATPase ATP-binding subunit 1	1.29e-08	3.73e-23	2.03e-18	0.5278
1. PBF	B5YQN9	Potassium-transporting ATPase ATP-binding subunit	2.74e-09	1.39e-25	9.63e-18	0.5231
1. PBF	Q9CFU9	Calcium-transporting ATPase 1	3.41e-13	7.81e-53	4.40e-53	0.6192
1. PBF	Q98SH2	Plasma membrane calcium-transporting ATPase 1	3.40e-13	7.69e-17	4.78e-23	0.7146
1. PBF	B4SZB1	Potassium-transporting ATPase ATP-binding subunit	6.02e-09	1.42e-26	1.15e-15	0.5484
1. PBF	B2TTJ7	Potassium-transporting ATPase ATP-binding subunit	4.28e-09	3.42e-25	6.47e-18	0.5289
1. PBF	Q9X8Z9	Potassium-transporting ATPase ATP-binding subunit	1.33e-10	2.21e-16	3.14e-18	0.5109
1. PBF	Q6GEZ7	Potassium-transporting ATPase ATP-binding subunit 2	2.06e-09	9.44e-28	3.79e-17	0.5518
1. PBF	P30714	Sodium/potassium-transporting ATPase subunit alpha-1	2.84e-12	2.67e-32	1.11e-34	0.6367
1. PBF	P11718	Probable proton ATPase 1A	0.00e+00	8.43e-24	9.53e-46	0.805
1. PBF	Q4LAB1	Probable copper-transporting P-type ATPase B	1.38e-09	1.47e-07	4.80e-16	0.5329
1. PBF	P63682	Potassium-transporting ATPase ATP-binding subunit	1.25e-10	8.50e-22	2.79e-23	0.4867
1. PBF	Q5ZWR1	Copper-exporting P-type ATPase	2.74e-09	3.19e-02	2.29e-20	0.5067
1. PBF	P37367	Cation-transporting ATPase pma1	0.00e+00	7.19e-53	7.19e-54	0.7318
1. PBF	C1EYK0	Potassium-transporting ATPase ATP-binding subunit	4.09e-09	4.82e-30	5.67e-23	0.5171
1. PBF	B5FNE0	Potassium-transporting ATPase ATP-binding subunit	1.99e-09	2.56e-26	1.10e-15	0.551
1. PBF	B1IY32	Potassium-transporting ATPase ATP-binding subunit	3.33e-09	1.87e-24	6.91e-17	0.5392
1. PBF	P63688	Probable cation-transporting ATPase F	0.00e+00	6.63e-46	1.09e-54	0.6628
1. PBF	P54211	Plasma membrane ATPase	0.00e+00	8.04e-05	5.79e-40	0.7965
1. PBF	P49380	Plasma membrane ATPase	0.00e+00	3.02e-39	7.35e-54	0.7997
1. PBF	P50996	Potassium-transporting ATPase alpha chain 1	7.47e-13	1.25e-33	2.60e-41	0.6106
1. PBF	P0A505	Calcium-transporting ATPase CtpE	2.22e-16	8.87e-36	1.62e-31	0.7645
1. PBF	Q2FKI2	Probable copper-transporting P-type ATPase B	1.62e-09	3.19e-07	1.78e-16	0.5368
1. PBF	P0A008	Potassium-transporting ATPase ATP-binding subunit 1	1.13e-08	3.73e-23	2.03e-18	0.5186
1. PBF	A0R3Y2	Calcium-transporting ATPase CtpE	3.11e-14	2.51e-35	3.49e-37	0.7563
1. PBF	B1JR96	Potassium-transporting ATPase ATP-binding subunit	8.28e-09	9.71e-26	1.09e-13	0.5064
1. PBF	Q00804	Plasma membrane calcium-transporting ATPase 1	1.71e-14	2.25e-16	1.86e-22	0.7266
1. PBF	Q72TM6	Potassium-transporting ATPase ATP-binding subunit	1.26e-09	2.07e-27	2.87e-13	0.5707
1. PBF	B2KA78	Potassium-transporting ATPase ATP-binding subunit	2.03e-09	3.49e-25	1.35e-13	0.5128
1. PBF	Q5HKB0	Probable copper-transporting P-type ATPase B	3.82e-09	2.09e-07	1.26e-16	0.5317
1. PBF	P35316	Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type	2.43e-13	1.37e-41	1.88e-27	0.6193
1. PBF	D0ZTB2	Magnesium-transporting ATPase, P-type 1	0.00e+00	2.55e-69	1.45e-145	0.8465
1. PBF	P13585	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1	3.67e-13	2.45e-38	4.71e-26	0.6331
1. PBF	P73241	Probable copper-transporting ATPase PacS	4.43e-08	2.62e-02	3.01e-23	0.4626
2. PF	A1A4J6	Probable phospholipid-transporting ATPase IIB	9.22e-11	1.26e-18	NA	0.6171
2. PF	Q5BL50	Phospholipid-transporting ATPase IC	4.34e-11	3.16e-15	NA	0.6397
2. PF	Q9N0Z4	Phospholipid-transporting ATPase IF (Fragment)	1.03e-12	8.84e-15	NA	0.6435
2. PF	C7EXK4	Phospholipid-transporting ATPase IB	3.56e-11	4.80e-10	NA	0.5898
2. PF	Q29449	Probable phospholipid-transporting ATPase IA	8.13e-12	1.11e-14	NA	0.6285
3. BF	P07893	Probable copper-transporting ATPase SynA	1.61e-08	NA	1.28e-10	0.5199
3. BF	P05425	Copper-exporting P-type ATPase B	1.37e-06	NA	1.12e-06	0.4341
3. BF	Q8ZR95	Copper-exporting P-type ATPase	1.64e-10	NA	2.92e-12	0.5586
3. BF	P18398	Nitrogen fixation protein FixI	5.36e-09	NA	1.03e-10	0.5397
3. BF	Q2FDV0	Copper-exporting P-type ATPase	6.70e-09	NA	3.89e-21	0.4702
3. BF	P55989	Copper-transporting ATPase	2.30e-10	NA	1.63e-09	0.5072
3. BF	A6U4T8	Copper-exporting P-type ATPase	2.88e-09	NA	7.96e-21	0.4856
3. BF	Q9X5X3	Copper-transporting P-type ATPase	2.08e-09	NA	1.21e-24	0.4917
3. BF	A8Z3F8	Copper-exporting P-type ATPase	4.46e-09	NA	3.89e-21	0.4842
3. BF	Q59998	Zinc-transporting ATPase	1.20e-08	NA	3.73e-11	0.4788
3. BF	O53114	Probable cation-transporting ATPase I	2.67e-12	NA	7.42e-46	0.6534
3. BF	O32220	Copper-exporting P-type ATPase	1.17e-08	NA	3.42e-21	0.4643
3. BF	Q6G6B7	Copper-exporting P-type ATPase	3.14e-09	NA	2.80e-20	0.4844
3. BF	O08462	Copper-transporting ATPase	6.96e-10	NA	1.09e-11	0.4966
3. BF	A6QK47	Copper-exporting P-type ATPase	3.14e-09	NA	3.69e-21	0.4859
3. BF	Q4L970	Copper-exporting P-type ATPase	6.59e-10	NA	3.49e-25	0.4594
3. BF	Q8NUQ9	Copper-exporting P-type ATPase	3.75e-09	NA	2.80e-20	0.4836
3. BF	P37385	Probable copper-transporting ATPase SynA	9.75e-10	NA	1.39e-10	0.449
3. BF	Q8CN02	Copper-exporting P-type ATPase	1.13e-09	NA	5.23e-22	0.4863
3. BF	P63690	Probable cation-transporting ATPase G	6.36e-09	NA	2.45e-07	0.5044
3. BF	P37386	Probable cadmium-transporting ATPase	2.45e-09	NA	1.52e-16	0.4536
3. BF	A7X6S1	Copper-exporting P-type ATPase	2.54e-09	NA	7.96e-21	0.4827
3. BF	O33533	Nitrogen fixation protein FixI	7.30e-11	NA	8.86e-16	0.5021
3. BF	P32113	Probable copper-importing P-type ATPase A	7.51e-10	NA	2.56e-28	0.4716
3. BF	P9WPS2	Probable copper-exporting P-type ATPase V	2.36e-08	NA	1.24e-19	0.524
3. BF	A5IVY3	Copper-exporting P-type ATPase	3.56e-09	NA	7.96e-21	0.4851
3. BF	P9WPS6	Probable cation-transporting ATPase G	8.05e-09	NA	2.45e-07	0.5042
3. BF	Q5HCZ3	Copper-exporting P-type ATPase	4.63e-09	NA	3.69e-21	0.4856
3. BF	P59947	Cation-transporting P-type ATPase B	1.52e-07	NA	4.97e-06	0.4858
3. BF	Q9X5V3	Copper-transporting P-type ATPase	8.42e-09	NA	1.09e-10	0.573
3. BF	Q2YWA3	Copper-exporting P-type ATPase	2.81e-09	NA	9.82e-19	0.4855
3. BF	Q9ZHC7	Silver exporting P-type ATPase	2.12e-09	NA	6.51e-17	0.5763
3. BF	P49015	Copper-transporting ATPase 1 (Fragment)	5.07e-04	NA	1.53e-14	0.4077
3. BF	Q59207	Nitrogen fixation protein FixI	1.13e-06	NA	4.16e-04	0.4728
3. BF	Q9ZM69	Copper-transporting ATPase	4.35e-10	NA	2.17e-12	0.5293
3. BF	Q4A0G1	Copper-exporting P-type ATPase	2.45e-09	NA	1.06e-22	0.4911
3. BF	Q99R80	Copper-exporting P-type ATPase	2.87e-09	NA	7.96e-21	0.4838
3. BF	Q9XT50	Copper-transporting ATPase 2	1.99e-05	NA	4.05e-15	0.4373
3. BF	Q8XD24	Copper-exporting P-type ATPase	1.77e-10	NA	3.23e-12	0.5531
3. BF	Q6GDP1	Copper-exporting P-type ATPase	2.86e-09	NA	1.03e-19	0.4861
3. BF	Q3YW59	Zinc/cadmium/lead-transporting P-type ATPase	1.05e-08	NA	5.98e-18	0.5047
3. BF	P9WPU0	Copper-exporting P-type ATPase	8.11e-09	NA	1.44e-09	0.4944
3. BF	Q9KPZ7	Copper-exporting P-type ATPase	8.14e-07	NA	1.09e-16	0.4745
3. BF	Q59467	Copper-transporting ATPase	1.47e-10	NA	1.18e-12	0.5531
3. BF	P9WPS4	Probable cation-transporting ATPase I	3.82e-09	NA	3.53e-45	0.654
3. BF	P58342	Copper-transporting ATPase 2	1.90e-07	NA	5.03e-23	0.5402
3. BF	P9WPT8	Cation-transporting P-type ATPase B	2.81e-07	NA	4.97e-06	0.4493
3. BF	Q5HL56	Copper-exporting P-type ATPase	9.14e-10	NA	5.23e-22	0.4837
3. BF	P58341	Copper-transporting ATPase 1	2.92e-11	NA	1.64e-20	0.4897
3. BF	Q8ZCA7	Copper-exporting P-type ATPase	3.76e-09	NA	3.22e-12	0.4938
3. BF	P77871	Copper-transporting ATPase	9.13e-10	NA	1.60e-11	0.5554
3. BF	Q8Z8S4	Copper-exporting P-type ATPase	1.68e-10	NA	3.49e-12	0.5597
3. BF	Q7A3E6	Copper-exporting P-type ATPase	2.33e-09	NA	7.96e-21	0.4846
3. BF	P46840	Cation-transporting P-type ATPase B	8.76e-08	NA	7.52e-10	0.4778
4. PB	P54678	Calcium-transporting ATPase PAT1	5.04e-14	1.81e-16	1.11e-32	NA
4. PB	Q5XF89	Polyamine-transporting ATPase 13A3	6.94e-12	2.69e-25	0.001	NA
4. PB	Q9SZW4	Cadmium/zinc-transporting ATPase HMA2	1.37e-08	4.11e-05	2.57e-10	NA
4. PB	Q9XES1	Calcium-transporting ATPase 4, endoplasmic reticulum-type	1.17e-14	4.02e-36	1.55e-30	NA
4. PB	O14022	Cation-transporting ATPase 5	5.00e-15	8.34e-29	5.87e-22	NA
4. PB	P54679	Probable plasma membrane ATPase	0.00e+00	1.04e-21	1.01e-51	NA
4. PB	Q9HD20	Endoplasmic reticulum transmembrane helix translocase	1.17e-13	4.86e-20	2.85e-07	NA
4. PB	P18596	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3	1.25e-12	5.93e-39	1.01e-29	NA
4. PB	P40527	Probable phospholipid-transporting ATPase NEO1	3.04e-12	6.48e-19	0.024	NA
4. PB	Q8K2X1	Phospholipid-transporting ATPase VD	1.88e-05	5.90e-14	8.45e-04	NA
4. PB	P9WPT5	Manganese-exporting P-type ATPase	1.29e-10	1.00e-02	3.52e-13	NA
4. PB	O75185	Calcium-transporting ATPase type 2C member 2	6.66e-16	4.88e-44	4.22e-54	NA
4. PB	Q27533	Probable cation-transporting ATPase W08D2.5	1.29e-12	4.78e-20	3.36e-05	NA
4. PB	P98194	Calcium-transporting ATPase type 2C member 1	4.00e-15	4.58e-52	1.07e-57	NA
4. PB	P22700	Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type	9.07e-13	2.74e-41	1.64e-29	NA
4. PB	P50993	Sodium/potassium-transporting ATPase subunit alpha-2	5.75e-12	4.24e-38	1.49e-40	NA
4. PB	P05023	Sodium/potassium-transporting ATPase subunit alpha-1	2.97e-12	1.86e-31	2.74e-36	NA
4. PB	Q4VNC0	Probable cation-transporting ATPase 13A5	2.22e-16	3.95e-19	8.25e-08	NA
4. PB	Q9SH76	ATPase 6, plasma membrane-type	0.00e+00	1.13e-17	2.08e-47	NA
4. PB	P54708	Potassium-transporting ATPase alpha chain 2	1.04e-13	1.05e-32	1.22e-42	NA
4. PB	O22218	Calcium-transporting ATPase 4, plasma membrane-type	5.33e-15	9.44e-28	2.85e-43	NA
4. PB	P06686	Sodium/potassium-transporting ATPase subunit alpha-2	1.89e-12	6.21e-38	7.96e-40	NA
4. PB	O64806	Putative calcium-transporting ATPase 7, plasma membrane-type	0.00e+00	1.24e-28	6.28e-40	NA
4. PB	Q8RUN1	Calcium-transporting ATPase 1, plasma membrane-type	1.11e-16	3.15e-29	1.14e-39	NA
4. PB	P54707	Potassium-transporting ATPase alpha chain 2	9.05e-14	3.35e-33	9.15e-43	NA
4. PB	P16615	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2	4.56e-12	2.65e-28	1.99e-23	NA
4. PB	Q64566	Calcium-transporting ATPase type 2C member 1	6.69e-14	8.16e-52	1.52e-57	NA
4. PB	Q01896	Sodium transport ATPase 2	0.00e+00	1.51e-35	6.95e-17	NA
4. PB	Q10309	Putative phospholipid-transporting ATPase C6C3.06c	1.29e-13	1.41e-30	0.001	NA
4. PB	Q8VDN2	Sodium/potassium-transporting ATPase subunit alpha-1	6.33e-14	2.21e-31	3.29e-36	NA
4. PB	P11505	Plasma membrane calcium-transporting ATPase 1	3.55e-13	8.51e-17	8.01e-25	NA
4. PB	P11507	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2	5.65e-12	7.83e-28	2.91e-23	NA
4. PB	Q8R429	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1	7.82e-13	7.17e-38	3.31e-26	NA
4. PB	Q9LU41	Calcium-transporting ATPase 9, plasma membrane-type	6.08e-14	8.20e-27	1.65e-32	NA
4. PB	P13587	Sodium transport ATPase 1	0.00e+00	1.29e-35	1.25e-16	NA
4. PB	Q65X71	Probable calcium-transporting ATPase 6, plasma membrane-type	0.00e+00	1.34e-34	8.17e-53	NA
4. PB	Q9HDW7	Calcium-transporting ATPase 2	1.86e-13	6.81e-16	4.80e-27	NA
4. PB	Q9Z1W8	Potassium-transporting ATPase alpha chain 2	1.66e-13	5.49e-33	3.37e-41	NA
4. PB	P20649	ATPase 1, plasma membrane-type	0.00e+00	4.33e-17	3.05e-46	NA
4. PB	Q9CCL1	Manganese-exporting P-type ATPase	2.68e-10	4.22e-02	6.36e-11	NA
4. PB	Q80XR2	Calcium-transporting ATPase type 2C member 1	2.23e-14	1.81e-51	1.83e-55	NA
4. PB	P90747	Probable manganese-transporting ATPase catp-8	2.92e-11	6.17e-24	2.45e-08	NA
4. PB	P13586	Calcium-transporting ATPase 1	0.00e+00	9.57e-51	4.20e-57	NA
4. PB	Q9LF79	Calcium-transporting ATPase 8, plasma membrane-type	3.33e-16	6.41e-27	6.80e-37	NA
4. PB	P22189	Calcium-transporting ATPase 3	0.00e+00	1.56e-33	3.21e-25	NA
4. PB	P11506	Plasma membrane calcium-transporting ATPase 2	1.11e-16	4.36e-15	1.24e-23	NA
4. PB	Q8R4C1	Calcium-transporting ATPase type 2C member 2	7.77e-16	1.13e-43	2.13e-56	NA
4. PB	O55143	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2	3.96e-12	1.09e-27	3.37e-23	NA
4. PB	Q6PIE5	Sodium/potassium-transporting ATPase subunit alpha-2	5.49e-12	6.21e-38	7.96e-40	NA
4. PB	Q9WV27	Sodium/potassium-transporting ATPase subunit alpha-4	7.63e-12	1.82e-35	2.51e-40	NA
4. PB	Q9Y2G3	Phospholipid-transporting ATPase IF	1.64e-12	1.01e-16	6.28e-06	NA
4. PB	P23634	Plasma membrane calcium-transporting ATPase 4	3.04e-13	6.90e-14	1.88e-27	NA
4. PB	Q9H7F0	Polyamine-transporting ATPase 13A3	8.17e-14	1.87e-24	1.13e-04	NA
4. PB	P9WPT1	Calcium-transporting ATPase CtpE	3.87e-14	8.87e-36	1.62e-31	NA
4. PB	P38929	Calcium-transporting ATPase 2	2.62e-13	8.67e-36	1.48e-22	NA
4. PB	Q6DFW5	Phospholipid-transporting ATPase IF	3.09e-11	3.91e-17	3.68e-07	NA
4. PB	Q4VNC1	Probable cation-transporting ATPase 13A4	1.11e-16	2.19e-22	9.04e-14	NA
4. PB	Q5XF90	Probable cation-transporting ATPase 13A4	1.11e-16	8.72e-27	1.24e-11	NA
4. PB	P20431	ATPase 3, plasma membrane-type	0.00e+00	6.07e-17	2.43e-48	NA
4. PB	Q9LIK7	Putative calcium-transporting ATPase 13, plasma membrane-type	2.61e-13	6.61e-34	2.80e-39	NA
4. PB	Q2RAS0	Probable calcium-transporting ATPase 8, plasma membrane-type	0.00e+00	1.98e-34	1.38e-45	NA
4. PB	Q64518	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3	9.30e-13	3.49e-39	1.84e-29	NA
4. PB	O59666	Copper-transporting ATPase ccc2	4.02e-07	8.41e-04	1.21e-14	NA
4. PB	Q37145	Calcium-transporting ATPase 1	1.55e-15	1.99e-31	1.85e-41	NA
4. PB	Q9U280	Phospholipid-transporting ATPase tat-1	3.59e-12	2.45e-09	5.00e-07	NA
4. PB	P09626	Potassium-transporting ATPase alpha chain 1	2.09e-13	6.28e-33	3.65e-42	NA
4. PB	Q9SJB3	ATPase 5, plasma membrane-type	0.00e+00	1.46e-17	1.54e-44	NA
4. PB	P03960	Potassium-transporting ATPase ATP-binding subunit	3.68e-08	1.77e-24	7.03e-17	NA
4. PB	O14072	Endoplasmic reticulum transmembrane helix translocase	0.00e+00	3.26e-23	7.81e-11	NA
4. PB	Q9SU58	ATPase 4, plasma membrane-type	0.00e+00	9.81e-18	7.10e-45	NA
4. PB	Q64436	Potassium-transporting ATPase alpha chain 1	1.31e-13	4.80e-33	1.48e-42	NA
4. PB	Q9M2L4	Putative calcium-transporting ATPase 11, plasma membrane-type	2.11e-15	6.64e-30	4.16e-45	NA
4. PB	P20020	Plasma membrane calcium-transporting ATPase 1	3.79e-13	5.23e-16	7.64e-24	NA
4. PB	Q6PIC6	Sodium/potassium-transporting ATPase subunit alpha-3	2.75e-12	4.63e-36	1.75e-39	NA
4. PB	Q13733	Sodium/potassium-transporting ATPase subunit alpha-4	2.14e-12	2.67e-34	3.47e-39	NA
4. PB	P13607	Sodium/potassium-transporting ATPase subunit alpha	1.89e-15	8.40e-33	5.30e-39	NA
4. PB	P20648	Potassium-transporting ATPase alpha chain 1	4.36e-11	2.56e-33	1.34e-42	NA
4. PB	P57792	Probable phospholipid-transporting ATPase 12	1.48e-11	1.08e-21	0.023	NA
4. PB	Q9R0K7	Plasma membrane calcium-transporting ATPase 2	1.80e-13	7.15e-16	9.84e-24	NA
4. PB	Q9SZR1	Calcium-transporting ATPase 10, plasma membrane-type	0.00e+00	3.02e-29	1.76e-37	NA
4. PB	Q42556	ATPase 9, plasma membrane-type	0.00e+00	3.59e-17	1.89e-46	NA
4. PB	Q21286	Cation-transporting ATPase catp-5	1.11e-16	1.67e-25	2.76e-04	NA
4. PB	Q64542	Plasma membrane calcium-transporting ATPase 4	1.36e-13	3.24e-17	1.32e-26	NA
4. PB	P9WPU3	Potassium-transporting ATPase ATP-binding subunit	9.41e-10	8.50e-22	2.79e-23	NA
4. PB	P05030	Plasma membrane ATPase 1	0.00e+00	2.12e-40	1.03e-54	NA
4. PB	Q2QMX9	Calcium-transporting ATPase 10, plasma membrane-type	2.44e-15	1.25e-31	1.85e-41	NA
4. PB	P0ABB8	Magnesium-transporting ATPase, P-type 1	0.00e+00	9.85e-72	2.22e-149	NA
4. PB	P19456	ATPase 2, plasma membrane-type	0.00e+00	2.31e-17	3.32e-46	NA
4. PB	Q3TYU2	Probable cation-transporting ATPase 13A5	1.11e-16	3.32e-20	5.97e-10	NA
4. PB	O59868	Calcium-transporting ATPase 1	0.00e+00	2.32e-47	3.94e-55	NA
4. PB	Q9P241	Phospholipid-transporting ATPase VD	2.62e-05	5.37e-13	0.002	NA
4. PB	Q64568	Plasma membrane calcium-transporting ATPase 3	7.76e-13	1.48e-13	1.34e-27	NA
4. PB	P06687	Sodium/potassium-transporting ATPase subunit alpha-3	1.60e-12	4.63e-36	1.75e-39	NA
4. PB	Q9LY32	ATPase 7, plasma membrane-type	0.00e+00	2.14e-18	4.17e-45	NA
4. PB	P9WPT7	Probable cation-transporting P-type ATPase J	7.55e-09	8.80e-12	7.39e-11	NA
4. PB	Q7XPY2	Plasma membrane ATPase	0.00e+00	2.14e-16	9.40e-46	NA
4. PB	O14983	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1	4.14e-13	4.03e-39	6.70e-26	NA
4. PB	Q9LT02	Probable manganese-transporting ATPase PDR2	3.24e-13	5.96e-25	9.99e-17	NA
4. PB	P9WPT3	Probable cobalt/nickel-exporting P-type ATPase	1.94e-08	7.08e-11	2.93e-05	NA
4. PB	Q7X8B5	Calcium-transporting ATPase 5, plasma membrane-type	1.67e-15	1.45e-25	2.71e-29	NA
4. PB	Q08436	Plasma membrane ATPase 3	NA	3.25e-18	2.89e-43	NA
4. PB	Q9EPE9	Endoplasmic reticulum transmembrane helix translocase	2.73e-14	1.20e-18	2.72e-07	NA
4. PB	Q58623	Putative cation-transporting ATPase MJ1226	0.00e+00	6.70e-59	5.95e-60	NA
4. PB	Q8Z8E5	Putative potassium-transporting ATPase ATP-binding subunit	1.75e-07	2.35e-23	1.58e-07	NA
4. PB	O81108	Calcium-transporting ATPase 2, plasma membrane-type	3.33e-16	2.53e-31	2.49e-42	NA
4. PB	P09627	Plasma membrane ATPase 1	0.00e+00	1.91e-33	4.85e-51	NA
4. PB	P9WPS9	Probable cation-transporting ATPase F	0.00e+00	6.63e-46	1.09e-54	NA
4. PB	G5EBH1	Probable phospholipid-transporting ATPase tat-5	5.74e-13	4.91e-27	0.002	NA
4. PB	Q9CTG6	Polyamine-transporting ATPase 13A2	3.33e-14	7.89e-22	3.52e-12	NA
4. PB	Q9M2A0	ATPase 8, plasma membrane-type	0.00e+00	5.22e-17	1.19e-45	NA
4. PB	Q64541	Sodium/potassium-transporting ATPase subunit alpha-4	2.46e-12	8.31e-35	7.84e-42	NA
4. PB	O23087	Calcium-transporting ATPase 2, endoplasmic reticulum-type	1.29e-13	9.60e-39	4.12e-33	NA
4. PB	O94823	Phospholipid-transporting ATPase VB	1.40e-09	6.56e-12	0.010	NA
4. PB	P77868	Probable cation-transporting ATPase HI_0290	NA	2.57e-02	2.23e-19	NA
4. PB	P28876	Plasma membrane ATPase 2	0.00e+00	8.19e-22	6.26e-49	NA
4. PB	P13637	Sodium/potassium-transporting ATPase subunit alpha-3	1.51e-12	5.32e-36	7.14e-40	NA
4. PB	P39524	Probable phospholipid-transporting ATPase DRS2	1.37e-09	2.11e-08	2.13e-04	NA
4. PB	Q9NQ11	Polyamine-transporting ATPase 13A2	0.00e+00	1.02e-23	9.76e-13	NA
4. PB	Q2QY12	Probable calcium-transporting ATPase 9, plasma membrane-type	2.46e-14	5.36e-30	4.78e-44	NA
4. PB	Q9SY55	Calcium-transporting ATPase 3, endoplasmic reticulum-type	1.44e-15	2.48e-39	4.41e-30	NA
4. PB	P06685	Sodium/potassium-transporting ATPase subunit alpha-1	1.45e-12	2.58e-31	2.28e-36	NA
4. PB	A7L9Z8	Calcium-transporting ATPase type 2C member 2	6.66e-16	2.33e-44	3.94e-53	NA
4. PB	Q16720	Plasma membrane calcium-transporting ATPase 3	2.89e-13	4.82e-16	3.27e-27	NA
4. PB	Q93084	Sarcoplasmic/endoplasmic reticulum calcium ATPase 3	2.55e-12	8.31e-39	2.62e-29	NA
4. PB	Q01814	Plasma membrane calcium-transporting ATPase 2	1.11e-16	3.26e-15	5.63e-24	NA
4. PB	P92939	Calcium-transporting ATPase 1, endoplasmic reticulum-type	1.03e-12	3.05e-37	1.33e-29	NA
4. PB	Q6ATV4	Calcium-transporting ATPase 3, plasma membrane-type	0.00e+00	3.70e-25	1.81e-39	NA
4. PB	Q12691	Sodium transport ATPase 5	0.00e+00	1.12e-35	8.68e-17	NA
4. PB	Q12697	Vacuolar cation-transporting ATPase YPK9	3.37e-11	5.18e-04	4.33e-08	NA
4. PB	O74431	Probable cation-transporting ATPase C1672.11c	2.15e-13	9.20e-12	1.26e-05	NA
4. PB	Q6Q477	Plasma membrane calcium-transporting ATPase 4	2.89e-15	3.86e-18	6.84e-27	NA
4. PB	Q64578	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1	1.02e-14	9.53e-38	3.73e-26	NA
4. PB	Q9T0E0	Putative ATPase, plasma membrane-like	0.00e+00	5.48e-30	1.47e-17	NA
4. PB	Q43128	ATPase 10, plasma membrane-type	0.00e+00	2.58e-20	2.00e-48	NA
4. PB	P19657	Plasma membrane ATPase 2	0.00e+00	5.39e-34	2.78e-54	NA
4. PB	G5E829	Plasma membrane calcium-transporting ATPase 1	1.89e-13	1.08e-16	9.04e-25	NA
4. PB	A3FIN4	Phospholipid-transporting ATPase FetA	3.85e-11	2.05e-17	0.038	NA
4. PB	Q7XEK4	Calcium-transporting ATPase 7, plasma membrane-type	5.11e-15	3.94e-28	1.37e-38	NA
4. PB	Q9LY77	Calcium-transporting ATPase 12, plasma membrane-type	2.78e-15	3.72e-32	2.03e-36	NA
4. PB	Q9LV11	ATPase 11, plasma membrane-type	0.00e+00	4.26e-17	3.39e-43	NA
5. P	Q9Y2Q0	Phospholipid-transporting ATPase IA	3.66e-11	1.13e-15	NA	NA
5. P	O36028	Putative phospholipid-transporting ATPase C4F10.16c	2.31e-10	1.12e-13	NA	NA
5. P	Q9LI83	Phospholipid-transporting ATPase 10	2.00e-11	2.70e-22	NA	NA
5. P	Q8NB49	Phospholipid-transporting ATPase IG	3.05e-12	2.85e-21	NA	NA
5. P	D4ABB8	Probable phospholipid-transporting ATPase IIB	7.03e-10	1.48e-23	NA	NA
5. P	Q09891	Putative phospholipid-transporting ATPase C24B11.12c	8.98e-10	8.55e-12	NA	NA
5. P	Q12767	Transmembrane protein 94	5.64e-03	3.59e-17	NA	NA
5. P	O75110	Probable phospholipid-transporting ATPase IIA	5.92e-13	1.13e-30	NA	NA
5. P	Q9SX33	Putative phospholipid-transporting ATPase 9	2.22e-11	4.67e-22	NA	NA
5. P	O43520	Phospholipid-transporting ATPase IC	3.50e-11	9.15e-16	NA	NA
5. P	P98204	Phospholipid-transporting ATPase 1	4.54e-12	3.19e-17	NA	NA
5. P	B1AWN4	Phospholipid-transporting ATPase VB	1.51e-05	4.11e-11	NA	NA
5. P	P98199	Phospholipid-transporting ATPase ID	4.62e-11	1.17e-13	NA	NA
5. P	D4AA47	Phospholipid-transporting ATPase IC	4.78e-11	9.00e-16	NA	NA
5. P	P39986	Endoplasmic reticulum transmembrane helix translocase	7.63e-14	3.14e-22	NA	NA
5. P	Q9NTI2	Phospholipid-transporting ATPase IB	7.31e-11	6.28e-12	NA	NA
5. P	P98197	Phospholipid-transporting ATPase IH	1.15e-12	1.84e-14	NA	NA
5. P	Q9QZW0	Phospholipid-transporting ATPase 11C	5.10e-12	8.16e-21	NA	NA
5. P	Q9UT43	Putative phospholipid-transporting ATPase C821.13c	5.99e-08	7.78e-08	NA	NA
5. P	P98205	Phospholipid-transporting ATPase 2	0.00e+00	1.92e-13	NA	NA
5. P	P98195	Probable phospholipid-transporting ATPase IIB	1.27e-10	1.01e-22	NA	NA
5. P	Q9SLK6	Phospholipid-transporting ATPase 6	2.15e-10	1.59e-19	NA	NA
5. P	Q9LVK9	Probable phospholipid-transporting ATPase 7	2.11e-12	4.02e-19	NA	NA
5. P	P70704	Phospholipid-transporting ATPase IA	1.28e-10	9.77e-16	NA	NA
5. P	Q12674	Probable phospholipid-transporting ATPase DNF3	5.27e-06	4.59e-14	NA	NA
5. P	F1Q4S1	Probable phospholipid-transporting ATPase IIB	4.62e-10	2.59e-23	NA	NA
5. P	Q9SAF5	Probable phospholipid-transporting ATPase 11	3.05e-11	1.93e-21	NA	NA
5. P	O70228	Probable phospholipid-transporting ATPase IIA	7.58e-13	9.54e-31	NA	NA
5. P	P98196	Phospholipid-transporting ATPase IH	6.35e-13	5.15e-21	NA	NA
5. P	Q9LK90	Probable phospholipid-transporting ATPase 8	1.44e-10	8.78e-21	NA	NA
5. P	Q7TSH8	Transmembrane protein 94	2.57e-03	1.34e-17	NA	NA
5. P	Q148W0	Phospholipid-transporting ATPase IC	4.97e-11	5.49e-17	NA	NA
5. P	O43861	Probable phospholipid-transporting ATPase IIB	5.02e-10	3.14e-22	NA	NA
5. P	Q8TF62	Probable phospholipid-transporting ATPase IM	1.55e-11	4.61e-09	NA	NA
5. P	P98198	Phospholipid-transporting ATPase ID	5.92e-11	1.78e-13	NA	NA
5. P	P32660	Phospholipid-transporting ATPase DNF1	6.15e-09	1.28e-09	NA	NA
5. P	O60423	Phospholipid-transporting ATPase IK	5.16e-11	3.10e-14	NA	NA
5. P	O54827	Phospholipid-transporting ATPase VA	9.80e-05	8.89e-11	NA	NA
5. P	P98200	Phospholipid-transporting ATPase IB	8.13e-13	5.83e-10	NA	NA
5. P	Q9XIE6	Phospholipid-transporting ATPase 3	1.29e-11	1.65e-15	NA	NA
5. P	Q12675	Phospholipid-transporting ATPase DNF2	1.10e-08	1.83e-10	NA	NA
5. P	O60312	Phospholipid-transporting ATPase VA	4.03e-06	1.63e-08	NA	NA
5. P	O94296	Probable phospholipid-transporting ATPase C887.12	1.83e-11	4.66e-16	NA	NA
5. P	Q9LNQ4	Probable phospholipid-transporting ATPase 4	3.08e-11	1.38e-18	NA	NA
5. P	Q9SGG3	Probable phospholipid-transporting ATPase 5	6.75e-11	2.98e-17	NA	NA
7. B	P9WPS3	Probable copper-exporting P-type ATPase V	3.06e-08	NA	1.24e-19	NA
7. B	P23980	Plasma membrane ATPase 2 (Fragment)	0.00e+00	NA	1.48e-33	NA
7. B	P15718	Putative Pol polyprotein from transposon element Bs1	1.80e-02	NA	0.046	NA
7. B	Q9M3H5	Probable cadmium/zinc-transporting ATPase HMA1, chloroplastic	2.19e-08	NA	2.00e-09	NA
7. B	P9WPT9	Cation-transporting P-type ATPase B	3.84e-08	NA	4.93e-06	NA
7. B	O64474	Putative cadmium/zinc-transporting ATPase HMA4	1.63e-07	NA	2.74e-14	NA
7. B	A0A0P0X004	Cation-transporting ATPase HMA5	3.24e-09	NA	1.83e-22	NA
7. B	P0CW77	Putative inactive cadmium/zinc-transporting ATPase HMA3	5.15e-08	NA	0.034	NA
7. B	P38360	P-type cation-transporting ATPase	2.03e-05	NA	1.78e-10	NA
7. B	Q64535	Copper-transporting ATPase 2	8.14e-06	NA	2.30e-13	NA
7. B	Q2FV64	Copper-exporting P-type ATPase	5.81e-09	NA	3.69e-21	NA
7. B	P9WPU1	Copper-exporting P-type ATPase	8.46e-09	NA	1.44e-09	NA
7. B	B9DFX7	Copper-transporting ATPase PAA2, chloroplastic	8.44e-07	NA	7.10e-13	NA
7. B	P37617	Zinc/cadmium/lead-transporting P-type ATPase	5.08e-09	NA	5.54e-18	NA
7. B	A3AWA4	Copper-transporting ATPase HMA5	3.42e-07	NA	2.75e-25	NA
7. B	P9WPS7	Probable cation-transporting ATPase G	8.08e-09	NA	2.45e-07	NA
7. B	Q8H384	Cadmium/zinc-transporting ATPase HMA3	1.00e-07	NA	7.49e-04	NA
7. B	Q6H7M3	Copper-transporting ATPase HMA4	8.82e-08	NA	1.99e-18	NA
7. B	P38995	Copper-transporting ATPase	2.29e-08	NA	3.11e-14	NA
7. B	Q64446	Copper-transporting ATPase 2	5.39e-06	NA	7.30e-14	NA
7. B	Q59385	Copper-exporting P-type ATPase	2.14e-10	NA	1.97e-12	NA
7. B	Q04656	Copper-transporting ATPase 1	6.16e-06	NA	3.27e-10	NA
7. B	Q9SZC9	Copper-transporting ATPase PAA1, chloroplastic	1.57e-07	NA	4.24e-16	NA
7. B	Q9S7J8	Copper-transporting ATPase RAN1	2.80e-08	NA	3.67e-18	NA
7. B	Q9SH30	Probable copper-transporting ATPase HMA5	3.78e-07	NA	7.70e-23	NA
7. B	P70705	Copper-transporting ATPase 1	8.42e-06	NA	2.18e-16	NA
7. B	Q64430	Copper-transporting ATPase 1	8.53e-06	NA	1.70e-17	NA
7. B	Q6UQ17	Phospholipid-transporting ATPase IK	1.31e-09	NA	0.015	NA
7. B	P35670	Copper-transporting ATPase 2	6.53e-06	NA	3.40e-13	NA
7. B	A3BF39	Cadmium/zinc-transporting ATPase HMA2	3.04e-09	NA	1.09e-14	NA
7. B	P9WPS5	Probable cation-transporting ATPase I	1.50e-12	NA	3.61e-45	NA