Results | PROST

Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX55016.1

JCVISYN3A_0885

tRNA uridine(34) 5-carboxymethylaminomethyl synthesis enzyme.
M. mycoides homolog: Q6MRU5.
TIGRfam Classification: 5=Equivalog.
Category: Quasiessential.

Statistics

Total GO Annotation: 112
Unique PROST Go: 33
Unique BLAST Go: 1
Unique Foldseek Go: 57

Total Homologs: 1358
Unique PROST Homologs: 108
Unique BLAST Homologs: 150
Unique Foldseek Homologs: 350

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: mnmG; tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Zhang et al. [4]: GO:0002098|tRNA wobble uridine modification
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was A5IWD6 (tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG) with a FATCAT P-Value: 0 and RMSD of 1.38 angstrom. The sequence alignment identity is 50.5%.
Structural alignment shown in left. Query protein AVX55016.1 colored as red in alignment, homolog A5IWD6 colored as blue. Query protein AVX55016.1 is also shown in right top, homolog A5IWD6 showed in right bottom. They are colored based on secondary structures.

  AVX55016.1 MKSNYDVIVVGGGHAGVEAALASARLNKKTAL--INLYEDKIATMPCNPSVGGPAKGIVVREIDALGGEMAKAADATALQTKLLNSSRGPGVWALRVQSD 98
      A5IWD6 MVQEYDVIVIGAGHAGVEAGLASARRGAKTLMLTINL--DNIAFMPCNPSVGGPAKGIVVREIDALGGQMAKTIDKTHIQMRMLNTGKGPAVRALRAQAD 98

  AVX55016.1 KEEYSKYMRNVIKNQKNLDLITRACTG----LVYDDNKTVTGIYLDDQT-ILNAKAVIITTGTYLKSEILKGVDRYESGPNNE--KTTKGISKSLIDLGI 191
      A5IWD6 KVLYQQEMKRVIEDEENLHIM----QGMVDELIIEDNE-VKGVRTNIGTEYL-SKAVIITTGTFLRGEIILGNMKYSSGPNHQLPSIT--LSDNLRELGF 190

  AVX55016.1 KLMRFKTGTPARVYRDSVDLTNAVLEPGTDMKLAFSFSTNT-YTPIEKQQPCYLIHSTLETKKIIEDNLEKSAMYSGTVESIGPRYCPSFEDKVVRFKEK 290
      A5IWD6 DIVRFKTGTPPRVNSKTIDYSKTEIQPGDDVGRAFSFET-TEYI-LD-QLPCWLTYTNAETHKVIDDNLHLSAMYSGMIKGTGPRYCPSIEDKFVRFNDK 287

  AVX55016.1 DTHQIFIEPETLNG-DT--WYVQGFSTSMPIEVQELMLKSLPGFENVRVKHWAYAIEYDCIDPMQLSPSLELKDVRNLFTAGQINGTSGYEEAAGQGLIA 387
      A5IWD6 PRHQLFLEPE---GRNTNEVYVQGLSTSLPEHVQRQMLETIPGLEKADMMRAGYAIEYDAIVPTQLWPTLETKMIKNLYTAGQINGTSGYEEAAGQGLMA 384

  AVX55016.1 GINASRKI--DGLDPIILRRDEAYIGVMIDDLVNKGVWEPYRLLTSRAEHRLLLRNDNAETRLKQYGREIGLISDQEWNQYLIYVNE----IEQAIKELK 481
      A5IWD6 GINAAGKVLNTG-EK-ILSRSDAYIGVLIDDLVTKGTNEPYRLLTSRAEYRLLLRHDNADLRLTDMGYELGMISEERYARF----NEKRQQIDAEIKRLS 478

  AVX55016.1 EIRFTPK--SQLAINLKNKNQADLSHGYSGYEIIKIP--TVDINELIEFIPSLQKLKTNQLQSIVIEIRFEGYVKKERQLVDKLVKLERKKIPLDINYSK 577
      A5IWD6 DIRIKPNEHTQ-AI-IEQHGGSRLKDGILAIDLLRRPEMTYDI--ILEILEEEHQLNADVEEQVEIQTKYEGYINKSLQQVEKVKRMEEKKIPEDLDYSK 574

  AVX55016.1 VDNLATEAKDKLEKIRPLNIGQASRITGVNPADIQMLLFYLKKQYPLENI-DN 629
      A5IWD6 IDSLATEAREKLSEVKPLNIAQASRISGVNPADISILLIYL-EQGKLQRVSD- 625

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source	GO	Description
1. PBF	GO:0005737	cytoplasm
1. PBF	GO:0002098	tRNA wobble uridine modification
1. PBF	GO:0050660	flavin adenine dinucleotide binding
1. PBF	GO:0030488	tRNA methylation
2. PF	GO:0008734	L-aspartate oxidase activity
2. PF	GO:0005886	plasma membrane
2. PF	GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors
2. PF	GO:0071949	FAD binding
2. PF	GO:0046300	2,4-dichlorophenoxyacetic acid catabolic process
2. PF	GO:0018666	2,4-dichlorophenol 6-monooxygenase activity
2. PF	GO:0047670	anhydrotetracycline monooxygenase activity
2. PF	GO:0008177	succinate dehydrogenase (ubiquinone) activity
2. PF	GO:0044318	L-aspartate:fumarate oxidoreductase activity
2. PF	GO:0019469	octopine catabolic process
2. PF	GO:0004497	monooxygenase activity
2. PF	GO:0046872	metal ion binding
2. PF	GO:0022900	electron transport chain
4. PB	GO:0047151	methylenetetrahydrofolate-tRNA-(uracil-5-)-methyltransferase (FADH2-oxidizing) activity
4. PB	GO:0070899	mitochondrial tRNA wobble uridine modification
4. PB	GO:0003723	RNA binding
4. PB	GO:0030698	5,10-methylenetetrahydrofolate-dependent tRNA (m5U54) methyltransferase activity
5. P	GO:0006121	mitochondrial electron transport, succinate to ubiquinone
5. P	GO:0045333	cellular respiration
5. P	GO:0017133	mitochondrial electron transfer flavoprotein complex
5. P	GO:0048039	ubiquinone binding
5. P	GO:0031305	integral component of mitochondrial inner membrane
5. P	GO:0009055	electron transfer activity
5. P	GO:0106266	3-chloro THPH synthase activity
5. P	GO:0004368	glycerol-3-phosphate dehydrogenase (quinone) activity
5. P	GO:0046956	positive phototaxis
5. P	GO:0009435	NAD biosynthetic process
5. P	GO:0034628	'de novo' NAD biosynthetic process from aspartate
5. P	GO:0005739	mitochondrion
5. P	GO:0045282	plasma membrane succinate dehydrogenase complex
5. P	GO:0000104	succinate dehydrogenase activity
5. P	GO:0106267	3,5 dichloro-THPH synthase activity
5. P	GO:0019420	dissimilatory sulfate reduction
5. P	GO:0031153	slug development involved in sorocarp development
5. P	GO:0009973	adenylyl-sulfate reductase activity
5. P	GO:0005743	mitochondrial inner membrane
5. P	GO:0004369	glycerol-3-phosphate oxidase activity
5. P	GO:0004174	electron-transferring-flavoprotein dehydrogenase activity
5. P	GO:0102040	fumarate reductase (menaquinone)
5. P	GO:0031148	DIF-1 biosynthetic process
5. P	GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)
5. P	GO:0006099	tricarboxylic acid cycle
5. P	GO:0033539	fatty acid beta-oxidation using acyl-CoA dehydrogenase
5. P	GO:0022904	respiratory electron transport chain
5. P	GO:0009061	anaerobic respiration
5. P	GO:0006113	fermentation
5. P	GO:0009331	glycerol-3-phosphate dehydrogenase complex
5. P	GO:0006105	succinate metabolic process
5. P	GO:0043783	oxidoreductase activity, acting on metal ions, flavin as acceptor
5. P	GO:0006072	glycerol-3-phosphate metabolic process
6. F	GO:0016117	carotenoid biosynthetic process
6. F	GO:0019622	3-(3-hydroxy)phenylpropionate catabolic process
6. F	GO:0005096	GTPase activator activity
6. F	GO:0033765	steroid dehydrogenase activity, acting on the CH-CH group of donors
6. F	GO:0016491	oxidoreductase activity
6. F	GO:0008688	3-(3-hydroxyphenyl)propionate hydroxylase activity
6. F	GO:0034354	'de novo' NAD biosynthetic process from tryptophan
6. F	GO:0009662	etioplast organization
6. F	GO:0016628	oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
6. F	GO:0005093	Rab GDP-dissociation inhibitor activity
6. F	GO:0052837	thiazole biosynthetic process
6. F	GO:0016763	pentosyltransferase activity
6. F	GO:0008115	sarcosine oxidase activity
6. F	GO:0004148	dihydrolipoyl dehydrogenase activity
6. F	GO:0006569	tryptophan catabolic process
6. F	GO:0046467	membrane lipid biosynthetic process
6. F	GO:0019380	3-phenylpropionate catabolic process
6. F	GO:0006739	NADP metabolic process
6. F	GO:0045550	geranylgeranyl reductase activity
6. F	GO:0016636	oxidoreductase activity, acting on the CH-CH group of donors, iron-sulfur protein as acceptor
6. F	GO:0090315	negative regulation of protein targeting to membrane
6. F	GO:0004808	tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity
6. F	GO:0005634	nucleus
6. F	GO:0036245	cellular response to menadione
6. F	GO:0001669	acrosomal vesicle
6. F	GO:0045454	cell redox homeostasis
6. F	GO:0106077	histone succinylation
6. F	GO:0004791	thioredoxin-disulfide reductase activity
6. F	GO:0046653	tetrahydrofolate metabolic process
6. F	GO:0016021	integral component of membrane
6. F	GO:0046608	carotenoid isomerase activity
6. F	GO:0004502	kynurenine 3-monooxygenase activity
6. F	GO:0043420	anthranilate metabolic process
6. F	GO:0015043	leghemoglobin reductase activity
6. F	GO:0004506	squalene monooxygenase activity
6. F	GO:0004362	glutathione-disulfide reductase (NADPH) activity
6. F	GO:0016995	cholesterol oxidase activity
6. F	GO:0005576	extracellular region
6. F	GO:0004324	ferredoxin-NADP+ reductase activity
6. F	GO:0050661	NADP binding
6. F	GO:0016645	oxidoreductase activity, acting on the CH-NH group of donors
6. F	GO:0002097	tRNA wobble base modification
6. F	GO:0045252	oxoglutarate dehydrogenase complex
6. F	GO:0006096	glycolytic process
6. F	GO:0046577	long-chain-alcohol oxidase activity
6. F	GO:0010731	protein glutathionylation
6. F	GO:0019430	removal of superoxide radicals
6. F	GO:0031514	motile cilium
6. F	GO:0032482	Rab protein signal transduction
6. F	GO:0003957	NAD(P)+ transhydrogenase (B-specific) activity
6. F	GO:0050771	negative regulation of axonogenesis
6. F	GO:0006749	glutathione metabolic process
6. F	GO:0008654	phospholipid biosynthetic process
6. F	GO:0047571	3-oxosteroid 1-dehydrogenase activity
6. F	GO:0006650	glycerophospholipid metabolic process
6. F	GO:0008204	ergosterol metabolic process
6. F	GO:0019805	quinolinate biosynthetic process
7. B	GO:0005829	cytosol

Uniprot GO Annotations

GO	Description
GO:0005737	cytoplasm
GO:0008033	tRNA processing
GO:0002098	tRNA wobble uridine modification
GO:0050660	flavin adenine dinucleotide binding

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source	Homolog	Description	Fatcat Pvalue	PROST Evalue	BLAST Evalue	Foldseek TMScore
1. PBF	Q55694	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.46e-76	0.0	0.9778
1. PBF	Q2STD7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.42e-61	5.37e-163	0.9546
1. PBF	A3QJS1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.09e-75	1.18e-167	0.9506
1. PBF	B6JAJ1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.76e-73	6.64e-158	0.9367
1. PBF	A6M3M4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.27e-82	0.0	0.9818
1. PBF	A5U9Q7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.23e-74	2.44e-174	0.8871
1. PBF	Q72B11	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.11e-67	1.90e-159	0.9728
1. PBF	A0RLR1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.66e-85	0.0	0.9816
1. PBF	Q5ZRJ2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.30e-79	2.91e-169	0.962
1. PBF	A1T100	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.24e-78	6.90e-158	0.962
1. PBF	C3LSK0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.67e-76	1.98e-164	0.894
1. PBF	Q9F5X1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.15e-77	2.10e-166	0.9628
1. PBF	C5CW10	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.52e-72	3.15e-162	0.9494
1. PBF	A0PX78	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.33e-79	0.0	0.9759
1. PBF	Q3YVP5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.22e-75	9.87e-169	0.9602
1. PBF	A5IWD6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.11e-84	0.0	0.9789
1. PBF	Q2FDE9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.85e-84	0.0	0.9794
1. PBF	Q5HCI4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.85e-84	0.0	0.9794
1. PBF	B1I835	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.45e-81	0.0	0.9686
1. PBF	B1IHR8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.36e-80	0.0	0.9766
1. PBF	Q2RN76	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.81e-76	1.64e-140	0.9335
1. PBF	Q6ND15	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.05e-71	1.15e-146	0.9418
1. PBF	Q9ZML9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.21e-78	1.38e-156	0.9154
1. PBF	A8LPC3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.06e-75	3.19e-136	0.9417
1. PBF	Q7TU19	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.05e-71	1.90e-177	0.9285
1. PBF	B5QVE1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.22e-75	1.03e-168	0.9596
1. PBF	B1YQK2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.35e-59	1.28e-163	0.9547
1. PBF	Q1R4J1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.13e-74	5.07e-170	0.9602
1. PBF	P0CAV0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.24e-80	5.88e-155	0.9519
1. PBF	Q0TLZ5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.05e-81	0.0	0.9691
1. PBF	C6DJG3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.23e-75	8.35e-178	0.9604
1. PBF	A1WGT2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.40e-74	2.44e-162	0.9412
1. PBF	Q7W0T0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.71e-78	6.14e-151	0.9517
1. PBF	Q2J358	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.28e-74	2.23e-130	0.9383
1. PBF	Q9WYA1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.29e-70	0.0	0.9579
1. PBF	Q5QZI8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.71e-79	3.30e-169	0.9472
1. PBF	A9BQJ1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.12e-68	6.56e-156	0.9397
1. PBF	A9M3R4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.49e-78	1.64e-159	0.9628
1. PBF	A4SC27	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.89e-79	1.27e-171	0.9578
1. PBF	Q6APZ2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.61e-75	1.13e-170	0.9559
1. PBF	Q6YQV5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.49e-78	0.0	0.9781
1. PBF	B8EDW1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.60e-76	2.26e-167	0.9614
1. PBF	Q899S1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.15e-77	0.0	0.9642
1. PBF	Q1QSB9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.01e-72	8.06e-174	0.9565
1. PBF	A1KRM5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.05e-77	1.46e-157	0.9646
1. PBF	Q1J990	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.13e-76	0.0	0.9687
1. PBF	B2IJQ4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.96e-77	2.16e-149	0.9492
1. PBF	A1AVB1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.57e-81	8.22e-160	0.9528
1. PBF	A5CXV2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.01e-83	2.61e-161	0.955
1. PBF	Q4FNR6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.57e-78	4.56e-153	0.9443
1. PBF	Q63PG8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.91e-60	1.82e-163	0.9558
1. PBF	A1V8U3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.54e-60	1.09e-163	0.9554
1. PBF	B0VLL2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.70e-77	3.62e-156	0.9555
1. PBF	B5FDA8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.09e-80	1.84e-171	0.8997
1. PBF	B5RFV4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.22e-75	1.03e-168	0.9628
1. PBF	Q1QBM0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.84e-72	1.40e-160	0.9581
1. PBF	A5G168	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.70e-44	3.41e-114	0.9509
1. PBF	Q2S6M9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.66e-77	7.68e-159	0.8907
1. PBF	Q6G5W5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.11e-84	0.0	0.9787
1. PBF	Q0TAW8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9584
1. PBF	O51879	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.79e-81	9.00e-144	0.9566
1. PBF	Q72H88	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.04e-64	1.17e-137	0.9449
1. PBF	Q317W7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.03e-67	8.62e-179	0.938
1. PBF	A6KZP0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.82e-77	1.28e-144	0.9526
1. PBF	A2BZ61	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.59e-70	1.12e-177	0.9294
1. PBF	A4TSI4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-73	1.15e-168	0.9502
1. PBF	Q02DE3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.15e-79	1.70e-161	0.9498
1. PBF	Q7NM86	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.13e-46	3.66e-176	0.9601
1. PBF	Q11CN3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.53e-77	8.75e-146	0.9478
1. PBF	Q8D3K0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.97e-78	5.21e-153	0.9371
1. PBF	Q5F5Y0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.22e-77	1.41e-156	0.9634
1. PBF	A6TXE4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.23e-80	0.0	0.9495
1. PBF	C4LDX1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.37e-77	2.13e-165	0.9578
1. PBF	Q040F4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.17e-74	0.0	0.9672
1. PBF	Q04MU9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.45e-81	0.0	0.968
1. PBF	B2V6C3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.01e-70	0.0	0.9405
1. PBF	Q2GLA8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.71e-79	1.41e-139	0.9348
1. PBF	Q9PNA7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.53e-74	3.44e-166	0.9297
1. PBF	Q329T0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.64e-74	2.00e-170	0.9599
1. PBF	Q5P4J6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.04e-62	3.43e-155	0.9608
1. PBF	B0TAB5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.53e-75	0.0	0.9631
1. PBF	B1KQ45	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.80e-76	3.85e-163	0.9542
1. PBF	O83084	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.89e-59	1.45e-141	0.9412
1. PBF	Q4UZP9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.88e-71	6.86e-154	0.9483
1. PBF	Q0VKW3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.06e-78	4.17e-165	0.955
1. PBF	Q2YR12	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.54e-76	1.20e-160	0.9452
1. PBF	Q1LHJ8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.89e-64	4.60e-150	0.9431
1. PBF	A8I266	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.46e-72	3.87e-148	0.9438
1. PBF	A5E8G8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.92e-76	1.78e-165	0.9459
1. PBF	A4YCI9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.78e-74	1.66e-168	0.9612
1. PBF	Q8DDH9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.29e-78	1.93e-172	0.8987
1. PBF	Q57AJ7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.54e-76	1.20e-160	0.9453
1. PBF	A9AJF1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-58	3.31e-162	0.958
1. PBF	A3PFG3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.18e-69	1.71e-178	0.9365
1. PBF	Q1I2H6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.35e-78	2.02e-168	0.9589
1. PBF	P47619	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.05e-75	0.0	0.8835
1. PBF	A4VS73	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.89e-77	2.99e-160	0.9616
1. PBF	A4ITX0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.66e-83	0.0	0.9807
1. PBF	A5CY45	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.80e-82	0.0	0.98
1. PBF	Q110Q9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.52e-79	0.0	0.9726
1. PBF	A2BTQ6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.85e-71	1.24e-177	0.9344
1. PBF	A6WUK1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.54e-76	1.30e-167	0.9622
1. PBF	Q98DZ1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.20e-74	2.54e-147	0.9415
1. PBF	Q8FY28	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.95e-76	2.64e-160	0.9393
1. PBF	B9JV52	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.26e-77	8.18e-168	0.9532
1. PBF	A6LG59	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.72e-76	1.65e-155	0.9575
1. PBF	Q6MGL6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.92e-69	1.22e-180	0.9625
1. PBF	C0QPI1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.25e-67	0.0	0.949
1. PBF	B5ER53	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.11e-77	5.90e-155	0.8934
1. PBF	Q7W2I1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.53e-78	2.23e-152	0.9514
1. PBF	Q8XAY0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.10e-74	1.40e-170	0.9594
1. PBF	Q1CCG6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-73	1.15e-168	0.9536
1. PBF	A9IZX9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.11e-75	2.08e-171	0.9409
1. PBF	A5WGD0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.11e-71	1.11e-159	0.9561
1. PBF	A6Q6Q7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.84e-84	0.0	0.9161
1. PBF	A7NBA3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.93e-79	2.10e-174	0.9578
1. PBF	Q88RW8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.09e-78	3.03e-171	0.9639
1. PBF	Q87K98	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.30e-79	6.19e-171	0.8967
1. PBF	Q13E21	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.61e-75	1.03e-142	0.938
1. PBF	Q7VK79	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.44e-69	1.03e-149	0.8979
1. PBF	Q1CUU1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.77e-79	2.66e-157	0.9174
1. PBF	Q3B6Y3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.32e-75	6.44e-166	0.9564
1. PBF	Q0A4L7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.53e-78	2.63e-160	0.9535
1. PBF	Q48BF4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.89e-77	1.17e-164	0.967
1. PBF	Q5H6D9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.30e-71	1.34e-152	0.9472
1. PBF	A5UY26	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.09e-63	3.21e-163	0.9366
1. PBF	A0RQV2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.41e-79	4.15e-155	0.9125
1. PBF	A4JA22	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.75e-59	6.32e-163	0.9579
1. PBF	B4RS92	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.24e-78	1.07e-167	0.9468
1. PBF	Q8DRS6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.31e-80	0.0	0.9543
1. PBF	B2HUB2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.87e-77	8.42e-156	0.9533
1. PBF	Q8PQE8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.42e-69	2.16e-155	0.9466
1. PBF	Q88RX6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.12e-73	0.0	0.9749
1. PBF	Q7V9J7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.81e-62	9.13e-174	0.9298
1. PBF	B0S3V1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.23e-81	0.0	0.9691
1. PBF	Q15MT3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.78e-76	3.01e-170	0.9476
1. PBF	Q31KG6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.65e-80	7.72e-177	0.9686
1. PBF	A7ZTV2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.96
1. PBF	Q4R4P6	Protein MTO1 homolog, mitochondrial	0.00e+00	1.92e-31	7.03e-131	0.937
1. PBF	Q6CYI6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.60e-76	2.01e-177	0.9594
1. PBF	Q663P9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-73	1.15e-168	0.9524
1. PBF	P0DB35	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.90e-76	0.0	0.9678
1. PBF	Q3KLJ9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.60e-64	6.98e-160	0.9656
1. PBF	Q5HTS6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.43e-73	3.08e-166	0.9321
1. PBF	B0V7I0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.02e-77	4.04e-156	0.9548
1. PBF	Q2GHA4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.27e-78	8.35e-138	0.9384
1. PBF	A4WGE6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.28e-74	6.36e-168	0.9633
1. PBF	Q72LR0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.39e-77	2.21e-171	0.9007
1. PBF	A5F468	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.67e-76	1.98e-164	0.8949
1. PBF	Q8Z2Q7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.19e-75	5.38e-169	0.9618
1. PBF	Q8RI88	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2	0.00e+00	5.72e-87	2.40e-170	0.9578
1. PBF	B1XSC4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.05e-79	6.40e-151	0.9043
1. PBF	Q1G7Z5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.53e-78	0.0	0.9555
1. PBF	B7NF57	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9574
1. PBF	Q7U3P8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.46e-73	7.70e-180	0.9559
1. PBF	A8GUR1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.24e-71	5.66e-158	0.9279
1. PBF	A4W4N0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.47e-80	0.0	0.9539
1. PBF	B7H0I9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.81e-77	6.85e-156	0.9561
1. PBF	P53362	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.19e-78	2.84e-176	0.9646
1. PBF	Q81JH3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.66e-85	0.0	0.9817
1. PBF	B1K1K2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.23e-59	1.30e-163	0.957
1. PBF	A0LEF5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.96e-63	9.31e-158	0.9742
1. PBF	Q9RYC3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.00e-67	5.70e-144	0.8914
1. PBF	A8AU87	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.04e-81	0.0	0.9693
1. PBF	A8G1X6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.80e-76	8.59e-162	0.96
1. PBF	Q3YRH0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.00e-78	3.54e-135	0.9341
1. PBF	A9MJQ9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.44e-74	6.64e-168	0.9629
1. PBF	A5VA83	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.20e-73	1.69e-112	0.9429
1. PBF	Q0BJM8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.51e-59	6.25e-164	0.9563
1. PBF	A9KLX8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.35e-76	0.0	0.9676
1. PBF	Q0ADD6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.12e-71	5.92e-157	0.9343
1. PBF	B1JR32	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-73	1.15e-168	0.9483
1. PBF	Q1BR97	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.94e-60	3.68e-163	0.9573
1. PBF	Q24M99	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.89e-78	0.0	0.9735
1. PBF	B7VN07	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.77e-81	1.50e-172	0.8888
1. PBF	A7FPL9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.43e-81	0.0	0.9768
1. PBF	A3M6R5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.22e-77	7.72e-156	0.9544
1. PBF	Q5WSS4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.46e-79	5.33e-171	0.9602
1. PBF	B1X9W9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.958
1. PBF	B0K5N3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.05e-77	0.0	0.9659
1. PBF	Q2A464	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.93e-79	2.10e-174	0.9579
1. PBF	A3P104	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.54e-60	1.09e-163	0.9556
1. PBF	Q49UI5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.44e-84	0.0	0.975
1. PBF	Q8YJS5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.74e-75	1.55e-160	0.9404
1. PBF	A6Q5D5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.67e-79	1.67e-177	0.933
1. PBF	P44763	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.30e-75	7.45e-176	0.9522
1. PBF	A9WKL7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.23e-71	1.75e-170	0.948
1. PBF	Q31DK8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.88e-79	1.27e-161	0.8725
1. PBF	A9NBA8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.18e-77	3.77e-158	0.9612
1. PBF	Q6KID6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.22e-78	0.0	0.9629
1. PBF	Q0SNY6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.27e-76	1.30e-176	0.9612
1. PBF	Q0BW93	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.00e-72	1.07e-145	0.9439
1. PBF	A8YYS0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.85e-84	0.0	0.9786
1. PBF	Q7P0A6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.26e-77	9.83e-156	0.9528
1. PBF	B0UWH3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.60e-80	3.58e-170	0.8891
1. PBF	A9HE13	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.88e-62	7.64e-142	0.9489
1. PBF	Q3BYP1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.11e-68	6.77e-161	0.9472
1. PBF	Q1GCL9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.44e-76	1.49e-157	0.9427
1. PBF	Q9JX41	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.70e-77	1.12e-157	0.9618
1. PBF	P64229	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.11e-84	0.0	0.9795
1. PBF	A1VD34	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.86e-67	1.23e-159	0.9721
1. PBF	P0A3F1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.70e-78	0.0	0.9713
1. PBF	Q02D35	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.64e-61	9.56e-168	0.9523
1. PBF	Q11PC8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.86e-80	7.84e-157	0.9439
1. PBF	Q39PR0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.28e-74	1.13e-173	0.9685
1. PBF	Q1MPS7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.52e-77	4.13e-166	0.967
1. PBF	Q0I6D8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.67e-71	1.44e-173	0.9368
1. PBF	P0DB34	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.90e-76	0.0	0.968
1. PBF	A9VTL9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.25e-85	0.0	0.9817
1. PBF	A9KX17	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.92e-76	5.26e-167	0.9627
1. PBF	A8G7I0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.23e-71	1.89e-174	0.9382
1. PBF	A0AMD1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.86e-81	0.0	0.9819
1. PBF	B9E8Z3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.04e-86	0.0	0.9795
1. PBF	B6JKE5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.28e-78	5.98e-157	0.918
1. PBF	A4XN50	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.91e-84	0.0	0.9787
1. PBF	Q4K399	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.87e-78	2.91e-166	0.9615
1. PBF	Q1MA19	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.67e-76	3.78e-153	0.9359
1. PBF	Q0AKE9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.81e-74	2.84e-165	0.956
1. PBF	Q3AGK9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.68e-73	0.0	0.9566
1. PBF	A7N0X6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.33e-80	4.18e-173	0.9495
1. PBF	Q7MGG9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.01e-77	4.69e-172	0.8956
1. PBF	B3CR62	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.01e-74	8.95e-144	0.9459
1. PBF	A6VF43	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.60e-80	1.12e-160	0.951
1. PBF	A4VYE0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.47e-80	0.0	0.9542
1. PBF	Q310P0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.12e-72	2.47e-159	0.9722
1. PBF	A4J9S0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.40e-81	0.0	0.9782
1. PBF	C1D5H3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.21e-78	9.36e-157	0.9583
1. PBF	Q5FFY7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.44e-78	1.74e-158	0.9346
1. PBF	Q3J6M0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.53e-75	4.97e-161	0.9588
1. PBF	A1WSY5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.50e-67	3.02e-158	0.8635
1. PBF	Q5KU58	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.13e-82	0.0	0.981
1. PBF	A5N450	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.74e-81	0.0	0.9793
1. PBF	P0A3F0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.70e-78	0.0	0.971
1. PBF	B7NR43	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9583
1. PBF	B4TN42	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.87e-75	6.40e-169	0.9621
1. PBF	P64231	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.11e-84	0.0	0.9791
1. PBF	Q9PJP3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.08e-65	3.25e-158	0.9661
1. PBF	A6UEE8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.96e-77	6.16e-158	0.9555
1. PBF	C1D0A9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.94e-70	1.49e-144	0.9637
1. PBF	B7M597	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9604
1. PBF	A6WX77	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.83e-77	1.52e-153	0.9435
1. PBF	B5BIP5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.74e-75	1.12e-168	0.9596
1. PBF	Q0BMJ8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.93e-79	2.10e-174	0.9576
1. PBF	Q5LWF3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.06e-78	3.90e-146	0.9349
1. PBF	O66962	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.69e-65	9.09e-178	0.9412
1. PBF	B0KRB9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.89e-79	1.29e-170	0.9633
1. PBF	B1YGA7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.78e-89	0.0	0.9808
1. PBF	A1RQC1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.78e-74	1.66e-168	0.9607
1. PBF	A4IYN2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.66e-79	2.64e-174	0.9607
1. PBF	Q2K2S1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.77e-71	3.72e-156	0.9388
1. PBF	B0K8H8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.05e-77	0.0	0.966
1. PBF	A4GAI2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.40e-70	1.41e-160	0.9619
1. PBF	Q630B9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.76e-85	0.0	0.9816
1. PBF	B1JFV2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.07e-79	5.17e-168	0.9648
1. PBF	Q8EY59	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.60e-78	2.93e-171	0.9006
1. PBF	Q824M2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.64e-64	1.37e-158	0.9638
1. PBF	B2S1Z2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.89e-59	1.45e-141	0.9435
1. PBF	Q87TS3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.97e-78	6.31e-167	0.9485
1. PBF	B0SS01	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.05e-77	6.35e-177	0.8823
1. PBF	B4SYE2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.69e-75	1.08e-168	0.9615
1. PBF	B7MGG1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.13e-74	5.07e-170	0.9581
1. PBF	Q65CN2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.95e-85	0.0	0.9805
1. PBF	Q3K430	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.93e-79	3.41e-163	0.9558
1. PBF	Q252Y3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.15e-69	1.05e-156	0.9645
1. PBF	Q2RFI9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.89e-78	1.08e-176	0.9756
1. PBF	Q6F0E6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.95e-100	0.0	0.9945
1. PBF	A3CRB1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.46e-82	0.0	0.9682
1. PBF	A1SBV1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.42e-75	1.44e-157	0.9536
1. PBF	A6TG45	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.85e-75	2.01e-171	0.9569
1. PBF	B2A469	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.30e-73	0.0	0.9718
1. PBF	Q2S6G8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.80e-55	1.99e-163	0.9444
1. PBF	Q17VU9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.47e-79	1.66e-159	0.921
1. PBF	Q058G2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.52e-75	4.33e-151	0.9252
1. PBF	Q5FHQ6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.92e-75	0.0	0.9724
1. PBF	A5EV65	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.89e-77	8.40e-151	0.9384
1. PBF	C1FAF1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.48e-60	1.70e-171	0.9394
1. PBF	Q5X9C2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.20e-78	0.0	0.9686
1. PBF	B0RMP9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.59e-71	3.74e-154	0.9494
1. PBF	A7I199	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.66e-75	2.53e-163	0.8973
1. PBF	B1L9P0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.24e-74	0.0	0.9575
1. PBF	Q28VZ5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.07e-78	3.51e-152	0.8554
1. PBF	Q1RGT1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.24e-71	5.66e-158	0.9302
1. PBF	Q033L1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.83e-77	0.0	0.9646
1. PBF	Q2NQ95	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.40e-76	1.29e-171	0.9496
1. PBF	C5BKL4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.77e-77	8.83e-159	0.9499
1. PBF	Q650H5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.06e-78	3.86e-145	0.9451
1. PBF	Q21CM1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.40e-74	2.19e-139	0.9379
1. PBF	A3N2V3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.88e-76	2.13e-165	0.8863
1. PBF	B5YJL3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.01e-79	2.54e-180	0.9744
1. PBF	Q8XH31	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.63e-82	0.0	0.9699
1. PBF	Q6HAF3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.66e-85	0.0	0.9815
1. PBF	A8A6K4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9601
1. PBF	Q2LXU8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.87e-66	1.41e-159	0.9468
1. PBF	B8EQ21	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.73e-74	7.94e-133	0.9473
1. PBF	Q3JXU7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.37e-60	9.11e-164	0.9475
1. PBF	Q8XU65	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.57e-70	6.68e-156	0.9455
1. PBF	A9NEC4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.23e-83	0.0	0.9809
1. PBF	Q4L2Z3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.50e-84	0.0	0.9748
1. PBF	Q1JED6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.32e-77	0.0	0.9673
1. PBF	A1W0H2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.53e-74	3.44e-166	0.9392
1. PBF	A3PNS6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.71e-79	1.19e-136	0.9328
1. PBF	Q7M9M5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.12e-76	1.25e-164	0.9392
1. PBF	Q5N1E7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.47e-80	2.44e-176	0.9711
1. PBF	Q6G1K9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.14e-72	1.78e-167	0.9415
1. PBF	B8D8G6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.09e-78	1.19e-162	0.9562
1. PBF	Q89WP5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.83e-77	3.33e-144	0.942
1. PBF	Q6F9Q1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.13e-76	6.64e-156	0.9559
1. PBF	Q46IB4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.19e-70	5.13e-165	0.9363
1. PBF	Q5NL05	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.81e-65	1.70e-140	0.8572
1. PBF	B7N2I0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9603
1. PBF	B6EHU8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.63e-80	1.14e-167	0.9399
1. PBF	Q6MA36	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.44e-74	6.23e-178	0.9386
1. PBF	Q9KNG4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.67e-76	1.98e-164	0.8959
1. PBF	Q1QRZ1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.37e-74	7.89e-148	0.9428
1. PBF	Q3AP21	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.94e-74	5.94e-167	0.9551
1. PBF	Q3SF55	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.14e-80	5.62e-163	0.9549
1. PBF	A8HAH4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.19e-76	1.41e-168	0.9508
1. PBF	C3PM94	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.82e-75	8.96e-161	0.9369
1. PBF	Q04WG0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.39e-78	5.31e-173	0.8993
1. PBF	B0BZY6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.60e-79	0.0	0.9757
1. PBF	Q47U38	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.70e-77	1.25e-164	0.9566
1. PBF	Q1JJD7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.13e-76	0.0	0.9672
1. PBF	B1ZWP4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.79e-69	2.92e-155	0.906
1. PBF	B1XYL1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.98e-50	3.92e-152	0.9335
1. PBF	Q9Z7T7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.57e-70	6.99e-159	0.965
1. PBF	C0R430	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.44e-78	3.21e-132	0.9072
1. PBF	Q83PJ6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.61e-75	3.06e-169	0.9597
1. PBF	Q746Q4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.39e-70	5.61e-179	0.9704
1. PBF	A7MMW3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.75e-74	1.60e-164	0.943
1. PBF	A2RH03	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.13e-76	0.0	0.9678
1. PBF	B2TUN4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.87e-75	1.76e-169	0.9602
1. PBF	A5IKF8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.49e-74	0.0	0.9671
1. PBF	A8MKR8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.24e-81	0.0	0.9683
1. PBF	Q8E8A9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.23e-75	1.05e-167	0.9565
1. PBF	B0B872	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.55e-64	8.86e-160	0.9674
1. PBF	B7J1B1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.19e-78	2.84e-176	0.9607
1. PBF	Q16CZ6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.32e-77	1.70e-157	0.9425
1. PBF	A3DHY7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.04e-84	0.0	0.9753
1. PBF	Q1IVV5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.45e-62	8.83e-133	0.9057
1. PBF	Q8DLF8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.00e-82	2.04e-178	0.8832
1. PBF	A9R5U9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-73	1.15e-168	0.9486
1. PBF	Q5E1M6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.09e-80	1.84e-171	0.8972
1. PBF	B0BW03	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.80e-76	3.53e-161	0.9361
1. PBF	B1IWZ7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9628
1. PBF	Q8RAT8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1	0.00e+00	1.06e-75	0.0	0.9785
1. PBF	Q7VQW3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.20e-79	3.04e-161	0.9527
1. PBF	Q8Z9R8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-73	1.15e-168	0.9529
1. PBF	B0T6E1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.09e-80	1.61e-154	0.951
1. PBF	P94613	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.18e-77	3.77e-158	0.9613
1. PBF	A7GWM5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.03e-80	3.23e-173	0.9268
1. PBF	A4STQ4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.60e-78	4.63e-163	0.9628
1. PBF	P57117	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.09e-79	7.79e-163	0.9541
1. PBF	Q047G0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.61e-75	0.0	0.9551
1. PBF	A5VT19	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.92e-76	4.88e-162	0.9443
1. PBF	Q3IYH4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.58e-76	7.07e-128	0.9312
1. PBF	A8Z5Q4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.66e-75	9.49e-158	0.9615
1. PBF	Q98QV8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.06e-79	0.0	0.9677
1. PBF	O32806	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.26e-79	0.0	0.9714
1. PBF	Q72WU4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.14e-85	0.0	0.9811
1. PBF	A0KR28	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.13e-76	4.83e-169	0.9543
1. PBF	P56138	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.21e-78	4.33e-156	0.9229
1. PBF	Q48QN0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.07e-76	0.0	0.9678
1. PBF	Q3SWH6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.83e-76	1.88e-153	0.9438
1. PBF	B3PNC6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.98e-69	0.0	0.9711
1. PBF	A1JTD9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.70e-74	4.75e-168	0.9569
1. PBF	P57945	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.58e-72	3.65e-174	0.8869
1. PBF	Q7VPP9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.07e-76	3.92e-167	0.884
1. PBF	A6U594	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.11e-84	0.0	0.9751
1. PBF	B7UMK6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.85e-75	1.36e-169	0.9597
1. PBF	B0BCD7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.55e-64	8.86e-160	0.9661
1. PBF	Q21QL5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.02e-56	7.12e-155	0.9381
1. PBF	B5Z9Y2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.74e-78	3.27e-156	0.922
1. PBF	Q8RHA1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 1	0.00e+00	3.89e-77	4.43e-158	0.9476
1. PBF	B3Q8A7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.31e-72	3.84e-145	0.9427
1. PBF	Q5LXK0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.99e-80	0.0	0.9678
1. PBF	A7H2I7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.49e-74	1.38e-166	0.9431
1. PBF	B8G0L2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.89e-79	0.0	0.977
1. PBF	B1HPM2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.32e-84	0.0	0.9818
1. PBF	Q5HAN4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.34e-77	8.51e-158	0.9432
1. PBF	B4E581	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.44e-60	4.28e-163	0.9571
1. PBF	B2T7L1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.03e-67	1.61e-160	0.9465
1. PBF	A7GVP6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.88e-86	0.0	0.9813
1. PBF	Q5NFM8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.26e-79	8.60e-174	0.959
1. PBF	Q68XT0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.93e-77	2.96e-158	0.9274
1. PBF	A6GVK0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.33e-76	3.69e-169	0.9616
1. PBF	B2JJL1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.00e-66	2.16e-161	0.9446
1. PBF	C0Q2P1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.92e-75	7.90e-172	0.9636
1. PBF	A2SMF1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.85e-59	9.98e-156	0.941
1. PBF	Q5PA19	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.80e-63	1.15e-146	0.936
1. PBF	A2CDR8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.72e-69	1.80e-173	0.9235
1. PBF	Q3M790	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.05e-77	0.0	0.8815
1. PBF	A3DAS5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.55e-76	2.31e-167	0.9618
1. PBF	A6W3T9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.25e-81	2.04e-155	0.896
1. PBF	Q662I6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.11e-77	3.46e-174	0.9521
1. PBF	B7L889	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9581
1. PBF	A0M6J7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.06e-79	1.21e-162	0.9626
1. PBF	B1ZGG2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.79e-73	5.88e-133	0.9469
1. PBF	Q602E7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.83e-72	0.0	0.9484
1. PBF	Q8YR87	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.06e-78	0.0	0.8818
1. PBF	A1TI78	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.56e-73	8.96e-158	0.9358
1. PBF	A7NN26	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.40e-67	1.43e-163	0.9366
1. PBF	Q7NAK6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.53e-74	0.0	0.968
1. PBF	Q5M250	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.99e-80	0.0	0.9681
1. PBF	Q814F7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.08e-86	0.0	0.9815
1. PBF	B3H2Q2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.97e-76	1.73e-166	0.9291
1. PBF	A0K2X0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.94e-60	3.68e-163	0.9577
1. PBF	Q2JXG8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.67e-76	0.0	0.9727
1. PBF	Q0HD68	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.40e-76	2.76e-168	0.9555
1. PBF	Q46VW9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.59e-68	5.75e-151	0.9453
1. PBF	P0CD73	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.28e-64	4.68e-160	0.9673
1. PBF	Q6FYB9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.40e-74	6.30e-163	0.9433
1. PBF	Q8PDG1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.88e-71	6.86e-154	0.9452
1. PBF	Q0SPQ4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.73e-82	0.0	0.9705
1. PBF	Q8A2N7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.72e-76	2.35e-146	0.9384
1. PBF	Q4FSB8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.72e-71	6.64e-165	0.9592
1. PBF	Q82YX0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.29e-81	0.0	0.9708
1. PBF	Q4A909	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.25e-72	0.0	0.946
1. PBF	B8CVV6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.56e-76	1.44e-170	0.9502
1. PBF	Q5RB71	Protein MTO1 homolog, mitochondrial	0.00e+00	1.49e-33	6.59e-131	0.9399
1. PBF	Q99XI8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.35e-76	0.0	0.9683
1. PBF	Q67J34	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.13e-82	0.0	0.9707
1. PBF	A6QKK1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.85e-84	0.0	0.9791
1. PBF	Q65PZ9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.43e-79	4.40e-168	0.9532
1. PBF	A5I815	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.43e-81	0.0	0.9777
1. PBF	A9M9E4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.95e-76	2.64e-160	0.9422
1. PBF	B1KUB1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.23e-80	0.0	0.978
1. PBF	A8EWV0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.71e-78	9.15e-176	0.9253
1. PBF	Q6LLF7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.91e-80	1.51e-170	0.9603
1. PBF	Q8KA85	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.14e-76	6.85e-174	0.9548
1. PBF	A5IXW3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.02e-76	0.0	0.9695
1. PBF	B1H0R2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.48e-59	9.46e-168	0.9219
1. PBF	B8GW33	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.24e-80	5.88e-155	0.9515
1. PBF	A0LE47	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.21e-62	7.81e-138	0.8863
1. PBF	A9IJ48	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.48e-78	3.36e-148	0.9517
1. PBF	A7GJN8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.86e-81	0.0	0.9767
1. PBF	Q2P915	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.30e-71	1.34e-152	0.9463
1. PBF	Q9CEJ4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.54e-79	0.0	0.9721
1. PBF	Q6MRU5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.62e-118	0.0	0.9991
1. PBF	B1XJY4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.93e-77	0.0	0.9691
1. PBF	B4F0D8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.07e-74	6.93e-170	0.9502
1. PBF	Q2Y5B4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.23e-78	1.77e-162	0.9565
1. PBF	A1AHS1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.13e-74	5.07e-170	0.9599
1. PBF	C4K911	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.49e-79	1.14e-168	0.9666
1. PBF	Q03N65	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.68e-75	0.0	0.9705
1. PBF	Q1C086	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-73	1.15e-168	0.9537
1. PBF	Q62FS8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.54e-60	1.09e-163	0.9553
1. PBF	B5YXE5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.10e-74	1.40e-170	0.9597
1. PBF	Q5SGV8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.12e-63	8.65e-142	0.9459
1. PBF	Q4QMT9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.97e-76	1.80e-173	0.8867
1. PBF	Q5L6Z0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.14e-65	7.98e-158	0.9647
1. PBF	A5WBB4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.64e-79	1.08e-169	0.9636
1. PBF	A1U7I5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.76e-77	2.05e-161	0.9614
1. PBF	B0BRY1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.88e-76	5.02e-165	0.8916
1. PBF	A1BCG1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.85e-75	3.04e-161	0.9593
1. PBF	Q0I5W4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.90e-79	3.41e-169	0.9491
1. PBF	A2S6L0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.54e-60	1.09e-163	0.9555
1. PBF	A4YJT4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.77e-80	5.29e-152	0.9425
1. PBF	Q21DG2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.85e-80	1.33e-163	0.897
1. PBF	B7GMV9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.16e-73	0.0	0.9803
1. PBF	Q6GD93	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.11e-84	0.0	0.9793
1. PBF	B1M186	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.15e-74	5.04e-132	0.9538
1. PBF	Q8DRH8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.45e-81	0.0	0.9667
1. PBF	A5II62	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.54e-79	2.59e-170	0.9595
1. PBF	A3MQI7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.54e-60	1.09e-163	0.9455
1. PBF	A5GPI1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.17e-66	3.87e-179	0.9236
1. PBF	B5ZAL6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.95e-79	0.0	0.9642
1. PBF	Q3IK39	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.40e-76	2.66e-164	0.9585
1. PBF	B1LL68	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.31e-75	3.23e-169	0.9572
1. PBF	Q8ZKW6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.69e-75	1.08e-168	0.9611
1. PBF	Q4A5P8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.48e-75	0.0	0.9775
1. PBF	Q07UP1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.48e-73	1.24e-136	0.945
1. PBF	Q5WAG4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.50e-89	0.0	0.976
1. PBF	A6T482	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.37e-70	1.16e-159	0.9624
1. PBF	A1W207	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.13e-72	2.00e-162	0.9421
1. PBF	B1AI24	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.89e-78	0.0	0.9642
1. PBF	Q30P84	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.24e-85	1.22e-178	0.9072
1. PBF	B0JGQ4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.97e-78	0.0	0.9708
1. PBF	Q97CW3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.69e-81	0.0	0.977
1. PBF	Q8CMN6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.95e-86	0.0	0.9788
1. PBF	Q5X0Z8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.95e-79	3.75e-170	0.8916
1. PBF	Q8UBM0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.87e-79	1.68e-148	0.9461
1. PBF	A3NF54	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.30e-60	7.04e-163	0.9452
1. PBF	Q3AG55	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.51e-83	0.0	0.9794
1. PBF	P25756	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.83e-79	7.52e-171	0.9636
1. PBF	Q1J457	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.76e-77	0.0	0.968
1. PBF	Q38UF0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.95e-79	0.0	0.965
1. PBF	A4WVY9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.14e-76	1.50e-135	0.9353
1. PBF	Q31UP0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9594
1. PBF	B5EZ07	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.69e-75	1.08e-168	0.9628
1. PBF	B0TQG5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.06e-76	4.69e-168	0.954
1. PBF	Q3AUG9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.62e-74	2.48e-175	0.9556
1. PBF	Q82S78	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.30e-73	1.09e-162	0.9241
1. PBF	Q3JYG3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.38e-77	0.0	0.9702
1. PBF	P59485	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.13e-82	6.12e-147	0.9637
1. PBF	A6LL84	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.50e-69	0.0	0.9497
1. PBF	Q2YZB9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-83	0.0	0.9789
1. PBF	A8EXC3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.71e-76	6.43e-163	0.9316
1. PBF	A5GWP3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.52e-72	2.44e-174	0.951
1. PBF	Q2NJ23	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.48e-78	0.0	0.9748
1. PBF	A5CDS8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.32e-76	2.92e-144	0.9371
1. PBF	Q1IVL5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.76e-73	4.25e-175	0.9524
1. PBF	A9KBS8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.18e-77	3.77e-158	0.9603
1. PBF	Q5GS25	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.77e-47	2.72e-124	0.9012
1. PBF	A9MXB8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.20e-75	5.50e-169	0.9628
1. PBF	Q03D60	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.57e-73	0.0	0.9738
1. PBF	Q2SR15	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.51e-116	0.0	0.9961
1. PBF	A8ACP7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.92e-75	2.30e-170	0.9652
1. PBF	Q8EKU3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.61e-81	0.0	0.9818
1. PBF	P25812	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.25e-83	0.0	0.9801
1. PBF	Q181S8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.92e-82	0.0	0.9744
1. PBF	Q9RCA8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.21e-84	0.0	0.9783
1. PBF	B2US42	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.89e-78	9.21e-158	0.9241
1. PBF	B7IC15	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.81e-77	6.85e-156	0.9549
1. PBF	B0TY78	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.18e-80	1.12e-167	0.9551
1. PBF	A4SUS3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.60e-78	6.37e-149	0.9491
1. PBF	Q13SP0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.29e-66	1.98e-160	0.9441
1. PBF	Q02X03	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.28e-78	0.0	0.9714
1. PBF	Q1GXL9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.83e-76	9.30e-157	0.958
1. PBF	Q478A2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.71e-75	6.84e-157	0.954
1. PBF	B8D6S0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.49e-79	7.22e-163	0.9576
1. PBF	A6VL66	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.00e-73	5.18e-172	0.9595
1. PBF	Q2GD63	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.10e-69	6.67e-145	0.9368
1. PBF	Q97T36	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.09e-81	0.0	0.9669
1. PBF	A8YTQ6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.85e-59	0.0	0.9779
1. PBF	B2UGW0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.65e-69	9.63e-157	0.948
1. PBF	B3CLI3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.89e-52	1.04e-125	0.8878
1. PBF	Q9K1G0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.34e-79	8.12e-159	0.9639
1. PBF	Q60CS5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.87e-75	1.59e-170	0.9628
1. PBF	Q71VV1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.94e-82	0.0	0.9708
1. PBF	Q12HP0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.26e-77	2.40e-168	0.955
1. PBF	Q39ZT1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.01e-72	0.0	0.9701
1. PBF	A7FPF0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.70e-73	1.16e-168	0.9536
1. PBF	A8FMP4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.48e-75	1.83e-164	0.9336
1. PBF	Q926U8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.50e-81	0.0	0.9808
1. PBF	Q9ZE90	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.60e-79	9.74e-155	0.9329
1. PBF	Q8Y3M5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.06e-80	0.0	0.9717
1. PBF	B2K7J2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-73	1.15e-168	0.9523
1. PBF	Q2GC38	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.43e-75	1.12e-125	0.93
1. PBF	Q5PJX1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.74e-75	1.12e-168	0.9616
1. PBF	Q0HPF0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.40e-76	2.76e-168	0.9555
1. PBF	Q1LTU7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.85e-73	3.46e-150	0.9419
1. PBF	B6I3X8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9603
1. PBF	B1I6S1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.27e-64	0.0	0.9592
1. PBF	Q57HW9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.42e-75	8.70e-168	0.9606
1. PBF	A8GLZ9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.98e-77	6.01e-164	0.9318
1. PBF	A1UQU7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.68e-74	3.59e-168	0.9396
1. PBF	A0KQY9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.27e-79	1.17e-163	0.9587
1. PBF	A9BGL2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.91e-70	5.12e-178	0.9547
1. PBF	B7V7A2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.15e-79	1.70e-161	0.9524
1. PBF	Q0SYT5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.61e-75	3.06e-169	0.959
1. PBF	Q9PRA6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.89e-78	0.0	0.9646
1. PBF	B0UJI8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.17e-131	0.9462
1. PBF	Q7WRF1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.42e-78	4.69e-151	0.951
1. PBF	Q39KY9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.36e-59	3.37e-164	0.9578
1. PBF	Q12HF2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.62e-65	4.35e-156	0.926
1. PBF	A1K1Q4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.32e-76	3.66e-153	0.9648
1. PBF	A1AXX7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.25e-81	3.16e-150	0.9464
1. PBF	Q07VT3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.32e-75	1.69e-166	0.9581
1. PBF	A7HNL1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.65e-76	0.0	0.9664
1. PBF	Q7NA86	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.55e-76	2.03e-169	0.9554
1. PBF	B4TAY3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.69e-75	1.08e-168	0.9599
1. PBF	B7JB95	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.11e-77	5.90e-155	0.9423
1. PBF	P0A6U4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9595
1. PBF	Q4AAU6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.02e-72	0.0	0.949
1. PBF	A8F0G3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.03e-75	3.27e-161	0.938
1. PBF	Q14H30	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.26e-79	8.60e-174	0.9573
1. PBF	C4ZZ19	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	0.9581
1. PBF	Q1GP63	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.70e-74	4.33e-122	0.951
1. PBF	Q1CVH6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.67e-62	2.81e-145	0.9324
1. PBF	Q2WBG9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.77e-68	1.29e-149	0.942
1. PBF	Q0K5L6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.03e-62	3.03e-150	0.9441
1. PBF	Q0ATU6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.26e-79	0.0	0.9745
1. PBF	A1VIB1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.48e-63	1.30e-150	0.94
1. PBF	A5FL86	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.90e-76	1.26e-167	0.9617
1. PBF	B9M9W3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.68e-71	5.93e-161	0.9389
1. PBF	A5UHB8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.87e-74	2.45e-175	0.8853
1. PBF	A7ZBK0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.18e-79	4.34e-177	0.9295
1. PBF	Q03I89	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.05e-79	0.0	0.9686
1. PBF	Q5FS12	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.66e-71	1.65e-158	0.9518
1. PBF	Q87DB3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.12e-72	3.39e-149	0.9576
1. PBF	Q0BWA9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.90e-75	1.07e-159	0.9465
1. PBF	Q7MTG9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.52e-75	4.10e-161	0.9535
1. PBF	Q9PBN4	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.82e-75	3.42e-149	0.9568
1. PBF	Q056V5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.39e-78	5.31e-173	0.9002
1. PBF	A8F522	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.60e-49	7.86e-166	0.9663
1. PBF	A7ZAW0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-85	0.0	0.9809
1. PBF	Q5LIY5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.05e-77	1.46e-145	0.9473
1. PBF	B0CJG1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.36e-76	1.09e-158	0.9409
1. PBF	Q4UN88	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.15e-79	1.05e-158	0.9371
1. PBF	Q2N6I8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.09e-75	4.56e-124	0.9401
1. PBF	P64230	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.11e-84	0.0	0.9789
1. PBF	Q73GE7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.34e-75	1.34e-129	0.9058
1. PBF	Q2L2T3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.87e-78	2.76e-159	0.9492
1. PBF	Q494F8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.46e-78	6.93e-161	0.903
1. PBF	B3PIT8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.26e-73	3.31e-156	0.961
1. PBF	Q8NZ02	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.16e-76	0.0	0.968
1. PBF	Q2JI26	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.82e-77	0.0	0.9733
1. PBF	Q92KW2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.24e-78	6.50e-163	0.9502
1. PBF	A5G9V2	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.96e-77	5.71e-172	0.9681
1. PBF	B5FN44	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.22e-75	1.03e-168	0.961
1. PBF	Q8EWN6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.01e-74	0.0	0.9667
1. PBF	A8GQL7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.80e-76	3.53e-161	0.9395
1. PBF	A4Y198	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.89e-78	1.26e-160	0.9596
1. PBF	A1AV42	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.66e-77	1.41e-179	0.9738
1. PBF	Q7TUJ1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.85e-68	3.40e-172	0.9264
1. PBF	Q8R6K9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG 2	0.00e+00	5.52e-75	0.0	0.9806
1. PBF	Q74H95	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.65e-76	0.0	0.9675
1. PBF	Q5HS35	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.95e-86	0.0	0.9784
1. PBF	A0Q753	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.71e-79	4.70e-175	0.9547
1. PBF	C4K176	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.32e-75	1.16e-160	0.9412
1. PBF	A7X7A7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.11e-84	0.0	0.9796
1. PBF	Q73PH1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.41e-72	2.09e-161	0.9429
1. PBF	B8GRC9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.33e-73	6.12e-160	0.9569
1. PBF	B9KGL7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.80e-63	5.45e-147	0.9282
1. PBF	A8FJF9	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.56e-87	0.0	0.9796
1. PBF	B0S904	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.05e-77	6.35e-177	0.8825
1. PBF	Q05FY8	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	8.96e-13	2.09e-90	0.9388
1. PBF	A8GLL0	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	6.82e-75	2.91e-168	0.9606
1. PBF	P75221	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	7.58e-76	0.0	0.9624
1. PBF	A7HSL1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	2.97e-76	7.18e-172	0.9582
1. PBF	A2C5E1	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.40e-70	2.85e-166	0.9352
1. PBF	Q1WVH6	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.53e-74	0.0	0.9656
1. PBF	Q92JI3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	9.65e-76	2.88e-161	0.9391
1. PBF	Q9HT09	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	1.26e-79	7.97e-162	0.9527
1. PBF	Q7ULV7	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	3.31e-63	9.08e-161	0.9375
2. PF	P42534	Putative polyketide hydroxylase	7.20e-03	3.48e-03	NA	0.4027
2. PF	Q1RHB9	Succinate dehydrogenase flavoprotein subunit	1.15e-02	9.07e-08	NA	0.3233
2. PF	D7PI14	Halogenase gsfI	2.56e-04	5.98e-03	NA	0.3293
2. PF	Q92J97	Succinate dehydrogenase flavoprotein subunit	2.37e-02	3.35e-07	NA	0.3418
2. PF	Q0VZ69	Tryptophan 2-halogenase	6.61e-04	1.19e-02	NA	0.3652
2. PF	Q4UJM1	Succinate dehydrogenase flavoprotein subunit	1.19e-02	3.13e-07	NA	0.3126
2. PF	G3FLZ8	Flavin-dependent halogenase armH2	4.40e-04	1.75e-02	NA	0.3984
2. PF	Q59661	Succinate dehydrogenase flavoprotein subunit	8.15e-03	3.89e-08	NA	0.3339
2. PF	Q9HNZ0	L-aspartate oxidase	1.16e-03	1.78e-03	NA	0.3477
2. PF	Q49617	L-aspartate oxidase	8.32e-03	4.10e-05	NA	0.3342
2. PF	Q05355	Putative polyketide hydroxylase	9.50e-03	4.99e-02	NA	0.3917
2. PF	A0A455R7M0	Flavine halogenase ascD	5.72e-04	1.91e-02	NA	0.3706
2. PF	Q9X8N8	L-aspartate oxidase	2.24e-03	5.52e-07	NA	0.2795
2. PF	A0A0U2JT80	Flavin-dependent halogenase armH3	8.94e-04	6.41e-04	NA	0.3998
2. PF	Q8KN28	2,4-dichlorophenol 6-monooxygenase	1.56e-03	2.66e-04	NA	0.3508
2. PF	D9PU00	Fumarate reductase (CoM/CoB) subunit A	6.37e-03	9.36e-07	NA	0.3032
2. PF	P31038	Succinate dehydrogenase flavoprotein subunit	2.15e-02	3.62e-07	NA	0.3183
2. PF	Q68XN9	Succinate dehydrogenase flavoprotein subunit	1.15e-02	1.38e-07	NA	0.3131
3. BF	A5IXT6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.07e-09	NA	1.13e-07	0.5348
4. PB	B1WR77	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.17e-13	3.03e-02	5.80e-10	NA
4. PB	B0UI96	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.37e-13	1.97e-03	0.010	NA
4. PB	Q2K957	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.14e-11	1.88e-03	2.05e-04	NA
4. PB	C4L614	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.78e-13	1.09e-02	1.68e-09	NA
4. PB	Q2RTI8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.93e-13	1.65e-04	3.08e-04	NA
4. PB	P64233	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.73e-13	2.91e-02	0.042	NA
4. PB	P59109	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.87e-13	3.90e-02	1.56e-05	NA
4. PB	Q04A02	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.37e-13	2.62e-02	1.07e-08	NA
4. PB	B0CLM0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.97e-13	2.64e-02	0.043	NA
4. PB	B9MM32	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.77e-13	4.00e-02	1.32e-18	NA
4. PB	Q98LE1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.66e-13	2.47e-03	0.003	NA
4. PB	Q8Y7K1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.03e-13	4.76e-03	1.97e-09	NA
4. PB	C0ZFA9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.21e-13	4.43e-02	8.12e-12	NA
4. PB	B7HLG5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.35e-13	1.66e-02	4.36e-14	NA
4. PB	B7IUJ1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.09e-12	1.06e-02	8.58e-14	NA
4. PB	Q7NFC3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.83e-13	4.43e-02	7.80e-08	NA
4. PB	Q81WK3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.10e-12	8.67e-03	7.64e-14	NA
4. PB	Q72IQ5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.28e-13	2.36e-03	1.96e-13	NA
4. PB	Q92C76	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.13e-13	1.36e-02	7.88e-12	NA
4. PB	P53070	Mitochondrial translation optimization protein 1	0.00e+00	8.06e-32	1.06e-152	NA
4. PB	Q0BYJ6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.78e-13	6.15e-03	0.003	NA
4. PB	A7INE1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.14e-13	2.13e-03	0.024	NA
4. PB	A1VBW6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.26e-12	7.27e-04	1.11e-07	NA
4. PB	C1EP56	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.14e-12	1.05e-02	5.55e-14	NA
4. PB	Q213W6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.29e-13	1.07e-02	0.014	NA
4. PB	B0TH93	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.14e-13	2.20e-02	4.26e-09	NA
4. PB	P0A6U3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	4.61e-75	1.92e-169	NA
4. PB	A8ID68	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.24e-13	1.38e-03	3.47e-05	NA
4. PB	Q2FUQ3	tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG	0.00e+00	5.85e-84	0.0	NA
4. PB	B1ZES7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.73e-13	1.50e-03	0.001	NA
4. PB	Q3A7H9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.45e-12	9.98e-04	1.76e-04	NA
4. PB	Q67PC6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.98e-13	3.30e-03	1.25e-10	NA
4. PB	O13670	Protein MTO1 homolog, mitochondrial	0.00e+00	2.85e-42	6.32e-128	NA
4. PB	A0RHK5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.28e-13	1.05e-02	5.55e-14	NA
4. PB	Q07MJ4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.12e-13	8.99e-03	4.71e-04	NA
4. PB	A5V4M8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.35e-13	3.67e-02	5.33e-04	NA
4. PB	Q9Y2Z2	Protein MTO1 homolog, mitochondrial	0.00e+00	1.05e-31	3.83e-125	NA
4. PB	B0C6V8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.49e-13	5.88e-04	2.58e-09	NA
4. PB	Q20680	Protein MTO1 homolog, mitochondrial	0.00e+00	1.28e-56	5.71e-132	NA
4. PB	A9VT70	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.13e-12	2.36e-02	1.10e-13	NA
4. PB	Q6F1M4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 1	4.01e-13	8.36e-03	1.21e-10	NA
4. PB	A3PDM1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	8.55e-13	2.45e-03	2.32e-11	NA
4. PB	Q8UET6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.40e-13	3.40e-05	3.94e-05	NA
4. PB	Q6G3Y9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.77e-13	1.15e-02	0.023	NA
4. PB	A6U8P9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.14e-13	6.86e-04	0.002	NA
4. PB	B7JJB0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	8.36e-13	1.48e-02	7.05e-14	NA
4. PB	A9BEK6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.27e-10	4.25e-02	9.45e-09	NA
4. PB	Q02YZ3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.57e-13	4.55e-02	1.19e-07	NA
4. PB	A2BXA3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.71e-13	8.51e-03	6.25e-12	NA
4. PB	B2IGU6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.64e-13	1.04e-03	3.13e-07	NA
4. PB	Q732N8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.11e-12	1.66e-02	4.36e-14	NA
4. PB	Q6HEY3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.07e-12	1.48e-02	7.05e-14	NA
4. PB	Q2SRN2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 2	1.47e-09	8.21e-03	3.56e-06	NA
4. PB	A9ISB8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.77e-13	1.27e-03	0.001	NA
4. PB	A1ALD8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.06e-10	1.73e-03	5.52e-09	NA
4. PB	Q5WFP8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.87e-13	1.37e-02	3.98e-07	NA
4. PB	Q11HD9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.52e-13	2.63e-04	0.004	NA
4. PB	Q3MA89	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.24e-13	4.78e-02	0.005	NA
4. PB	Q31AA9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.43e-12	4.27e-03	4.38e-09	NA
4. PB	B7GGC8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.23e-13	1.15e-03	2.82e-12	NA
4. PB	B9M5T8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.52e-13	2.28e-02	3.69e-07	NA
4. PB	P64232	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.47e-13	2.91e-02	0.042	NA
4. PB	Q9S449	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.22e-12	7.04e-03	2.99e-05	NA
4. PB	A8G5I6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.39e-12	3.93e-02	1.06e-08	NA
4. PB	Q5NPP5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.02e-13	1.52e-02	1.03e-04	NA
4. PB	A2RKQ0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.83e-13	4.51e-02	3.20e-07	NA
4. PB	B7HDV5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.69e-12	1.48e-02	1.75e-13	NA
4. PB	A2BRU5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.08e-13	3.20e-02	9.78e-09	NA
4. PB	B9IVC1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.04e-12	1.83e-02	1.69e-13	NA
4. PB	A9MAR7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.10e-13	3.06e-02	0.045	NA
4. PB	A8FD77	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.15e-13	1.95e-02	1.95e-13	NA
4. PB	Q28PE7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.10e-13	5.08e-03	0.009	NA
4. PB	Q88W23	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.89e-13	3.51e-02	4.25e-10	NA
4. PB	Q1G9V1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.01e-13	2.69e-02	1.08e-08	NA
4. PB	A5VQ76	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.49e-13	2.91e-02	0.042	NA
4. PB	A7GRG2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	7.20e-13	3.20e-02	1.33e-13	NA
4. PB	A7Z4N3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.05e-13	1.26e-02	1.25e-16	NA
4. PB	Q2YNL7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.30e-13	4.62e-02	0.039	NA
4. PB	A5GLJ3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.38e-13	4.87e-02	3.49e-10	NA
4. PB	C3P5N4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.22e-12	8.67e-03	7.64e-14	NA
4. PB	Q819X4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.34e-12	2.20e-02	2.02e-13	NA
4. PB	Q7TU75	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	7.66e-13	1.11e-02	4.59e-08	NA
4. PB	Q5LST0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.45e-13	3.51e-02	2.14e-05	NA
4. PB	Q923Z3	Protein MTO1 homolog, mitochondrial	0.00e+00	2.95e-33	7.69e-130	NA
4. PB	Q720E5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.28e-13	1.65e-02	1.46e-10	NA
4. PB	Q57DL3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.07e-13	4.62e-02	0.039	NA
4. PB	Q729K0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	8.42e-13	4.52e-04	1.69e-10	NA
4. PB	Q6MTM6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 1	2.09e-09	1.26e-02	1.65e-06	NA
4. PB	Q1MHL2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.60e-13	5.66e-03	2.57e-04	NA
4. PB	A9VXT4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.33e-13	1.30e-02	2.15e-05	NA
4. PB	B1M5H7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.04e-13	3.27e-04	4.77e-05	NA
4. PB	A0AI79	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.41e-13	4.63e-03	5.32e-09	NA
4. PB	Q636J4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.29e-12	1.48e-02	7.05e-14	NA
4. PB	C3L795	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.23e-12	8.67e-03	7.64e-14	NA
4. PB	B1HQJ3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.66e-14	1.80e-03	4.20e-18	NA
4. PB	P39815	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.14e-13	5.82e-03	3.32e-15	NA
4. PB	Q74JJ8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.14e-13	3.83e-02	3.19e-08	NA
4. PB	Q1ATM0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.61e-13	3.65e-03	8.28e-11	NA
4. PB	A6X1E3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.45e-13	1.12e-03	0.026	NA
4. PB	Q7VD04	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.79e-13	9.74e-03	1.75e-08	NA
4. PB	Q5SID2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.38e-13	2.76e-03	2.67e-13	NA
4. PB	Q65JN6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.04e-13	1.63e-02	4.65e-13	NA
4. PB	Q92Q15	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.54e-13	6.98e-03	1.24e-04	NA
4. PB	O66913	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.19e-13	1.19e-02	1.62e-05	NA
4. PB	Q1IHM1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.55e-15	3.80e-02	1.55e-07	NA
4. PB	Q1J148	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.15e-13	1.45e-02	5.81e-07	NA
5. P	Q9KDJ5	L-aspartate oxidase	6.43e-03	7.28e-05	NA	NA
5. P	O06913	Fumarate reductase flavoprotein subunit	6.57e-02	1.29e-10	NA	NA
5. P	Q0CCX4	Sulochrin halogenase	1.56e-03	1.46e-04	NA	NA
5. P	Q98AV8	L-aspartate oxidase	5.93e-03	4.18e-04	NA	NA
5. P	P27138	2,4-dichlorophenol 6-monooxygenase	1.62e-03	1.34e-03	NA	NA
5. P	Q9HZP5	Electron transfer flavoprotein-ubiquinone oxidoreductase	2.44e-03	1.47e-08	NA	NA
5. P	G3FLZ7	Flavin-dependent halogenase armH1	1.93e-03	2.36e-04	NA	NA
5. P	Q801S2	Succinate dehydrogenase [ubiquinone] flavoprotein subunit B, mitochondrial	1.05e-02	2.84e-03	NA	NA
5. P	Q929Z2	L-aspartate oxidase	5.07e-03	1.88e-02	NA	NA
5. P	Q337B8	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	2.88e-03	1.01e-05	NA	NA
5. P	Q5R616	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	9.85e-03	1.90e-04	NA	NA
5. P	Q9UTJ7	Probable succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	2.21e-02	2.05e-02	NA	NA
5. P	Q8TZL4	L-aspartate oxidase	2.39e-03	5.49e-04	NA	NA
5. P	P94132	Probable electron transfer flavoprotein-ubiquinone oxidoreductase	4.29e-03	1.72e-07	NA	NA
5. P	Q87D19	L-aspartate oxidase	2.73e-03	1.41e-04	NA	NA
5. P	L8EUQ6	12-dehydrotetracycline 5-monooxygenase/anhydrotetracycline 6-monooxygenase	8.15e-04	2.76e-02	NA	NA
5. P	Q5XAK0	Alpha-glycerophosphate oxidase	1.16e-02	4.10e-02	NA	NA
5. P	O86963	Alpha-glycerophosphate oxidase	4.77e-03	4.74e-02	NA	NA
5. P	Q920L2	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	9.37e-03	1.11e-04	NA	NA
5. P	Q00711	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	1.17e-02	1.80e-02	NA	NA
5. P	Q0QF17	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (Fragment)	NA	2.49e-02	NA	NA
5. P	A2R6G7	Halogenase otaD	5.91e-04	1.94e-03	NA	NA
5. P	P26484	Protein FixC	3.30e-04	4.58e-02	NA	NA
5. P	Q5RDD3	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	4.72e-03	6.18e-07	NA	NA
5. P	Q2UPC7	Flavine halogenase aclH	5.47e-04	5.65e-04	NA	NA
5. P	P9WN91	Fumarate reductase flavoprotein subunit	2.07e-03	2.16e-11	NA	NA
5. P	P31040	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	9.81e-03	1.84e-04	NA	NA
5. P	Q9V2R0	L-aspartate oxidase	2.71e-03	7.85e-03	NA	NA
5. P	A0A1E7MYN1	Tetracycline 7-halogenase	6.60e-04	2.62e-02	NA	NA
5. P	Q8Z4K0	L-aspartate oxidase	8.87e-02	5.35e-05	NA	NA
5. P	Q99YI8	Alpha-glycerophosphate oxidase	1.27e-02	3.51e-02	NA	NA
5. P	Q8ZMX9	L-aspartate oxidase	3.62e-02	5.25e-05	NA	NA
5. P	P00363	Fumarate reductase flavoprotein subunit	4.08e-03	6.23e-11	NA	NA
5. P	Q59160	Opine oxidase subunit A	1.97e-02	4.66e-02	NA	NA
5. P	P31039	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	9.91e-03	9.48e-03	NA	NA
5. P	Q6UPE1	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	8.70e-03	2.18e-06	NA	NA
5. P	P47052	Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial	1.02e-02	2.74e-03	NA	NA
5. P	P10902	L-aspartate oxidase	3.76e-02	1.20e-05	NA	NA
5. P	T2G6Z9	Adenylylsulfate reductase subunit alpha	1.54e-02	5.88e-08	NA	NA
5. P	Q8K2B3	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	9.93e-03	6.67e-04	NA	NA
5. P	P20922	Fumarate reductase flavoprotein subunit	9.35e-03	6.40e-11	NA	NA
5. P	Q11190	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	5.72e-03	3.35e-07	NA	NA
5. P	Q54XM6	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	7.84e-03	4.36e-05	NA	NA
5. P	Q8YXJ6	L-aspartate oxidase	2.74e-03	2.79e-04	NA	NA
5. P	P0AC41	Succinate dehydrogenase flavoprotein subunit	1.08e-02	1.33e-07	NA	NA
5. P	L0E155	Flavin-dependent halogenase malA	1.57e-02	1.31e-04	NA	NA
5. P	P0AC42	Succinate dehydrogenase flavoprotein subunit	8.41e-03	1.33e-07	NA	NA
5. P	A0A0U3C228	Flavin-dependent halogenase armH5	9.50e-04	1.21e-03	NA	NA
5. P	Q9ZPX5	Succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial	1.34e-02	4.03e-02	NA	NA
5. P	Q7ZVF3	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	1.03e-02	5.08e-04	NA	NA
5. P	Q3SRR6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	7.66e-13	4.70e-02	NA	NA
5. P	B3FWT7	Non-heme halogenase rdc2	6.89e-04	6.18e-05	NA	NA
5. P	O57765	L-aspartate oxidase	1.48e-03	1.31e-02	NA	NA
5. P	P0AC43	Succinate dehydrogenase flavoprotein subunit	7.86e-03	1.33e-07	NA	NA
5. P	Q3S8Q4	6-methylpretetramide 4-monooxygenase	4.55e-03	4.55e-02	NA	NA
5. P	Q9PC57	L-aspartate oxidase	3.02e-03	3.65e-04	NA	NA
5. P	Q92R32	L-aspartate oxidase	8.65e-03	9.79e-04	NA	NA
5. P	Q8XWM7	L-aspartate oxidase 1	3.99e-02	3.67e-07	NA	NA
5. P	Q4JA33	Digeranylgeranylglycerophospholipid reductase	3.21e-03	1.32e-02	NA	NA
5. P	Q54FI4	Flavin-dependent halogenase chlA	1.80e-03	9.07e-03	NA	NA
5. P	P64175	Fumarate reductase flavoprotein subunit	2.10e-03	2.16e-11	NA	NA
5. P	P55931	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	4.18e-03	1.40e-06	NA	NA
5. P	P9WN90	Fumarate reductase flavoprotein subunit	2.07e-03	2.16e-11	NA	NA
5. P	Q9U3X4	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	1.42e-02	2.69e-02	NA	NA
5. P	P9WJJ8	L-aspartate oxidase	5.32e-03	4.01e-05	NA	NA
5. P	Q921G7	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	4.46e-03	2.40e-06	NA	NA
5. P	C5H881	Non-heme halogenase radH	1.48e-04	1.10e-04	NA	NA
5. P	Q9ZMP0	Fumarate reductase flavoprotein subunit	7.69e-02	1.61e-10	NA	NA
5. P	Q8ZD80	L-aspartate oxidase	3.94e-02	7.00e-04	NA	NA
5. P	Q08822	Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	6.87e-03	1.90e-03	NA	NA
5. P	Q972D2	L-aspartate oxidase	3.22e-03	1.23e-02	NA	NA
5. P	Q9A4C3	L-aspartate oxidase	1.11e-02	1.81e-02	NA	NA
5. P	P44894	Fumarate reductase flavoprotein subunit	6.97e-03	6.83e-11	NA	NA
5. P	Q9JSX4	L-aspartate oxidase	7.38e-03	4.85e-03	NA	NA
5. P	Q09508	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	2.14e-02	2.71e-03	NA	NA
5. P	Q51363	L-aspartate oxidase	3.98e-03	2.88e-05	NA	NA
5. P	P65500	L-aspartate oxidase	4.86e-03	4.01e-05	NA	NA
5. P	Q16134	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	4.48e-03	1.60e-06	NA	NA
5. P	Q8XQG4	L-aspartate oxidase 2	9.20e-03	1.77e-04	NA	NA
5. P	Q8HXW3	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	1.02e-02	1.67e-04	NA	NA
5. P	Q8NZX0	Alpha-glycerophosphate oxidase	1.06e-02	4.21e-02	NA	NA
5. P	Q9KPA4	L-aspartate oxidase	2.37e-03	1.72e-04	NA	NA
5. P	G4V4G6	Succinate dehydrogenase flavoprotein subunit	8.66e-03	4.53e-08	NA	NA
5. P	P9WJJ9	L-aspartate oxidase	3.72e-02	4.01e-05	NA	NA
5. P	Q2PWU9	4-methyl-5-nitrocatechol 5-monooxygenase	1.59e-03	1.83e-02	NA	NA
5. P	Q8SR40	Probable glycerol-3-phosphate dehydrogenase	1.09e-02	2.05e-02	NA	NA
5. P	A0A067XMV4	Flavin-dependent halogenase ptaM	1.55e-04	3.90e-04	NA	NA
5. P	Q60356	Uncharacterized FAD-dependent oxidoreductase MJ0033	2.70e-03	1.19e-07	NA	NA
5. P	Q8ZQU3	Succinate dehydrogenase flavoprotein subunit	8.60e-03	5.22e-08	NA	NA
5. P	P87111	Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	8.67e-03	2.89e-03	NA	NA
5. P	Q0QF01	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	9.35e-03	5.94e-04	NA	NA
5. P	P51054	Succinate dehydrogenase flavoprotein subunit	9.92e-03	2.54e-06	NA	NA
5. P	Q7M827	8-methylmenaquinol:fumarate reductase flavoprotein subunit	6.50e-03	3.54e-05	NA	NA
5. P	Q6PA58	Succinate dehydrogenase [ubiquinone] flavoprotein subunit A, mitochondrial	9.88e-03	2.21e-03	NA	NA
5. P	P38032	L-aspartate oxidase	6.12e-03	1.32e-08	NA	NA
5. P	P17412	Fumarate reductase flavoprotein subunit	1.25e-02	7.75e-09	NA	NA
5. P	Q8U8J4	L-aspartate oxidase	2.83e-03	2.38e-05	NA	NA
5. P	Q8XA23	L-aspartate oxidase	4.02e-02	9.92e-06	NA	NA
5. P	P74562	L-aspartate oxidase	3.34e-03	1.40e-06	NA	NA
5. P	A0A0U3AL34	Flavin-dependent halogenase armH4	1.22e-04	3.51e-04	NA	NA
5. P	Q9K107	L-aspartate oxidase	5.17e-03	5.17e-03	NA	NA
5. P	V3TQ67	Fumarate reductase flavoprotein subunit	6.90e-03	6.36e-10	NA	NA
5. P	Q94523	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	1.12e-02	2.22e-02	NA	NA
5. P	Q9YHT1	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	9.81e-03	3.48e-03	NA	NA
5. P	Q97ZC5	L-aspartate oxidase	2.36e-03	7.04e-03	NA	NA
5. P	Q28ED0	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial	1.06e-02	1.33e-03	NA	NA
5. P	P08065	Succinate dehydrogenase flavoprotein subunit	8.12e-04	1.40e-10	NA	NA
5. P	Q2KIG0	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial	4.55e-03	2.77e-06	NA	NA
6. F	Q3STP0	Ferredoxin--NADP reductase	3.32e-02	NA	NA	0.3884
6. F	Q7MBG9	Soluble pyridine nucleotide transhydrogenase	2.90e-02	NA	NA	0.3988
6. F	Q8TVE9	Digeranylgeranylglycerophospholipid reductase 1	1.56e-03	NA	NA	0.4541
6. F	Q12YW2	Digeranylgeranylglycerophospholipid reductase 1	9.93e-05	NA	NA	0.4927
6. F	Q4L978	4,4'-diaponeurosporene oxygenase	1.23e-02	NA	NA	0.3156
6. F	A9N0H2	Soluble pyridine nucleotide transhydrogenase	2.93e-02	NA	NA	0.3766
6. F	A5VM22	Ferredoxin--NADP reductase	9.72e-03	NA	NA	0.4092
6. F	Q6CZB1	Soluble pyridine nucleotide transhydrogenase	2.04e-02	NA	NA	0.3933
6. F	B7VM91	Soluble pyridine nucleotide transhydrogenase	2.63e-02	NA	NA	0.3696
6. F	B7N8Q4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.17e-03	NA	NA	0.372
6. F	A8FB45	Ferredoxin--NADP reductase 1	2.29e-02	NA	NA	0.4008
6. F	Q03H60	Ferredoxin--NADP reductase	1.03e-02	NA	NA	0.3918
6. F	Q92HY3	Ferredoxin--NADP reductase	1.06e-02	NA	NA	0.5095
6. F	Q8ZA97	Soluble pyridine nucleotide transhydrogenase	2.79e-02	NA	NA	0.3899
6. F	C4K3I8	Soluble pyridine nucleotide transhydrogenase	2.02e-02	NA	NA	0.3542
6. F	Q4ULP1	Thioredoxin reductase	1.90e-02	NA	NA	0.4055
6. F	O13306	Squalene monooxygenase	1.02e-03	NA	NA	0.3904
6. F	A1SKI3	Ferredoxin--NADP reductase	7.94e-03	NA	NA	0.403
6. F	Q3MHH6	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2	7.24e-03	NA	NA	0.3222
6. F	Q0W349	Digeranylgeranylglycerophospholipid reductase	1.74e-03	NA	NA	0.5201
6. F	Q8PU50	Digeranylgeranylglycerophospholipid reductase	8.99e-04	NA	NA	0.499
6. F	A0QRI8	Menaquinone reductase	1.08e-03	NA	NA	0.4613
6. F	A3CM39	Ferredoxin--NADP reductase	2.31e-02	NA	NA	0.4394
6. F	A9A9W1	Thiamine thiazole synthase	4.06e-03	NA	NA	0.5554
6. F	B6HZX3	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.05e-03	NA	NA	0.3895
6. F	B7NK08	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	3.43e-03	NA	NA	0.3945
6. F	A0RKB9	Ferredoxin--NADP reductase 2	1.18e-02	NA	NA	0.4013
6. F	Q13AK7	Ferredoxin--NADP reductase	3.27e-02	NA	NA	0.3777
6. F	Q7D5C1	3-oxosteroid 1-dehydrogenase	3.50e-02	NA	NA	0.3339
6. F	P09820	Protein FixC	4.21e-04	NA	NA	0.4064
6. F	P54980	Phytoene desaturase (neurosporene-forming)	6.54e-04	NA	NA	0.3037
6. F	Q2GJY7	Ferredoxin--NADP reductase	1.75e-02	NA	NA	0.3842
6. F	Q1I7F0	Soluble pyridine nucleotide transhydrogenase	2.14e-02	NA	NA	0.2879
6. F	B0KH90	Soluble pyridine nucleotide transhydrogenase	2.16e-02	NA	NA	0.2871
6. F	Q465Z7	Digeranylgeranylglycerophospholipid reductase	1.57e-04	NA	NA	0.4904
6. F	A5EMW5	Ferredoxin--NADP reductase	3.52e-02	NA	NA	0.3899
6. F	P17059	Hydroxyneurosporene desaturase	1.47e-02	NA	NA	0.3173
6. F	P96800	Uncharacterized protein Mbar_A1602	9.60e-05	NA	NA	0.4835
6. F	Q99RQ5	Ferredoxin--NADP reductase	2.06e-02	NA	NA	0.3742
6. F	A6QJL4	Ferredoxin--NADP reductase	2.04e-02	NA	NA	0.3704
6. F	Q8TQQ6	Digeranylgeranylglycerophospholipid reductase	1.76e-04	NA	NA	0.4955
6. F	Q7YQM0	Rab GDP dissociation inhibitor alpha	4.49e-02	NA	NA	0.3065
6. F	Q5LYY3	Ferredoxin--NADP reductase	1.06e-02	NA	NA	0.4228
6. F	Q6HP49	Ferredoxin--NADP reductase 1	1.61e-02	NA	NA	0.5022
6. F	Q2RMZ4	Ubiquinone hydroxylase UbiL	9.79e-04	NA	NA	0.4037
6. F	B5QXQ7	Soluble pyridine nucleotide transhydrogenase	3.35e-02	NA	NA	0.3681
6. F	B4S9F8	Ferredoxin--NADP reductase	1.40e-02	NA	NA	0.3786
6. F	Q6L0M1	Digeranylgeranylglycerophospholipid reductase	6.30e-05	NA	NA	0.5052
6. F	A4T8B6	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	4.48e-03	NA	NA	0.4021
6. F	P0A9P2	Dihydrolipoyl dehydrogenase	2.35e-02	NA	NA	0.273
6. F	Q2NFZ1	Digeranylgeranylglycerophospholipid reductase 1	2.68e-03	NA	NA	0.497
6. F	A5FMP6	Kynurenine 3-monooxygenase	2.46e-03	NA	NA	0.3916
6. F	P9WKP6	Uncharacterized protein MT0921	8.10e-02	NA	NA	0.2721
6. F	Q2W0C9	Ferredoxin--NADP reductase	4.56e-02	NA	NA	0.4037
6. F	P44941	Uncharacterized protein HI_0933	9.29e-03	NA	NA	0.4352
6. F	Q8HXX7	Rab GDP dissociation inhibitor alpha	5.91e-02	NA	NA	0.3038
6. F	Q97WJ5	Ferredoxin--NADP reductase	8.38e-03	NA	NA	0.3991
6. F	O66790	Thioredoxin reductase	1.28e-02	NA	NA	0.4396
6. F	A4JPY1	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 1	3.70e-03	NA	NA	0.3026
6. F	Q1LKJ7	Ferredoxin--NADP reductase 2	4.14e-02	NA	NA	0.5189
6. F	B2GCE0	Urocanate reductase	2.15e-02	NA	NA	0.2759
6. F	O97555	Rab GDP dissociation inhibitor alpha	3.94e-02	NA	NA	0.3246
6. F	Q87KN5	Soluble pyridine nucleotide transhydrogenase	1.91e-02	NA	NA	0.3917
6. F	P72299	Opine oxidase subunit B	6.91e-02	NA	NA	0.3659
6. F	Q6HBX6	Ferredoxin--NADP reductase 2	1.11e-02	NA	NA	0.4093
6. F	A3Q339	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.37e-02	NA	NA	0.4159
6. F	P50970	Dihydrolipoyl dehydrogenase	2.86e-02	NA	NA	0.2974
6. F	Q5E212	Soluble pyridine nucleotide transhydrogenase	2.73e-02	NA	NA	0.386
6. F	Q68WM0	Ferredoxin--NADP reductase	3.08e-02	NA	NA	0.5194
6. F	Q2GCZ2	Ferredoxin--NADP reductase	3.09e-02	NA	NA	0.4567
6. F	A3QFM9	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	7.44e-02	NA	NA	0.2875
6. F	A1W6V2	Ferredoxin--NADP reductase	2.79e-02	NA	NA	0.4837
6. F	Q2FDU3	4,4'-diaponeurosporene oxygenase	1.37e-02	NA	NA	0.3196
6. F	Q2RNR2	Ferredoxin--NADP reductase	1.16e-02	NA	NA	0.5192
6. F	A7HW48	Ferredoxin--NADP reductase	3.17e-02	NA	NA	0.3807
6. F	Q632D6	Ferredoxin--NADP reductase	1.12e-02	NA	NA	0.4086
6. F	A8GL77	Soluble pyridine nucleotide transhydrogenase	2.96e-02	NA	NA	0.3848
6. F	Q816D9	Ferredoxin--NADP reductase	1.15e-02	NA	NA	0.3967
6. F	P49819	Dihydrolipoyl dehydrogenase, mitochondrial	3.29e-02	NA	NA	0.2853
6. F	Q0BQJ9	Ferredoxin--NADP reductase	3.31e-02	NA	NA	0.3944
6. F	A2RF47	Ferredoxin--NADP reductase	6.03e-03	NA	NA	0.4198
6. F	P54533	Dihydrolipoyl dehydrogenase	1.89e-02	NA	NA	0.2935
6. F	P9WNY8	Menaquinone reductase	2.52e-04	NA	NA	0.4361
6. F	Q1QX78	Soluble pyridine nucleotide transhydrogenase	2.26e-02	NA	NA	0.2804
6. F	P66008	Soluble pyridine nucleotide transhydrogenase	2.99e-02	NA	NA	0.3762
6. F	C1DR10	Soluble pyridine nucleotide transhydrogenase	2.17e-02	NA	NA	0.255
6. F	P85207	Dihydrolipoyl dehydrogenase	1.58e-02	NA	NA	0.2834
6. F	O97556	Rab GDP dissociation inhibitor beta	6.39e-02	NA	NA	0.2909
6. F	A9VRK8	Ferredoxin--NADP reductase 1	1.58e-02	NA	NA	0.5204
6. F	Q219B6	Ferredoxin--NADP reductase	3.43e-02	NA	NA	0.3984
6. F	Q73GH2	Ferredoxin--NADP reductase	7.97e-03	NA	NA	0.3824
6. F	A8F1N2	Ferredoxin--NADP reductase	1.81e-02	NA	NA	0.4075
6. F	Q6FRV2	Glutathione reductase	3.91e-02	NA	NA	0.2637
6. F	P09623	Dihydrolipoyl dehydrogenase, mitochondrial	4.70e-02	NA	NA	0.2967
6. F	Q72LG3	Ferredoxin--NADP reductase	1.38e-02	NA	NA	0.3618
6. F	B1YDX0	Thiamine thiazole synthase	2.17e-03	NA	NA	0.5631
6. F	Q795R8	Uncharacterized protein YtfP	3.15e-03	NA	NA	0.4423
6. F	A8GW75	Ferredoxin--NADP reductase	9.70e-03	NA	NA	0.5212
6. F	Q9AGP1	Sarcosine oxidase subunit alpha	1.74e-01	NA	NA	0.398
6. F	Q5JE27	Digeranylgeranylglycerophospholipid reductase	6.19e-04	NA	NA	0.4928
6. F	Q8Z4Z3	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.32e-01	NA	NA	0.327
6. F	Q89HV6	Ferredoxin--NADP reductase	3.39e-02	NA	NA	0.3983
6. F	P31023	Dihydrolipoyl dehydrogenase, mitochondrial	8.39e-02	NA	NA	0.3049
6. F	Q60HG3	Dihydrolipoyl dehydrogenase, mitochondrial	4.92e-02	NA	NA	0.2795
6. F	C3LPZ2	Soluble pyridine nucleotide transhydrogenase	2.46e-02	NA	NA	0.3878
6. F	Q1LPH7	Ferredoxin--NADP reductase 1	1.67e-02	NA	NA	0.4681
6. F	P21856	Rab GDP dissociation inhibitor alpha	4.07e-02	NA	NA	0.3021
6. F	A8EYV4	Ferredoxin--NADP reductase	2.95e-02	NA	NA	0.5081
6. F	A4X398	Ferredoxin--NADP reductase	1.03e-02	NA	NA	0.3931
6. F	A1UJP4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	4.37e-03	NA	NA	0.4051
6. F	P57112	Soluble pyridine nucleotide transhydrogenase	2.19e-02	NA	NA	0.2666
6. F	Q979Y7	Digeranylgeranylglycerophospholipid reductase	7.28e-05	NA	NA	0.5301
6. F	A5CF57	Ferredoxin--NADP reductase	1.35e-02	NA	NA	0.4006
6. F	Q8ENX4	Ferredoxin--NADP reductase 2	6.80e-03	NA	NA	0.4116
6. F	O26377	Digeranylgeranylglycerophospholipid reductase 1	4.53e-05	NA	NA	0.5062
6. F	Q1WUT6	Ferredoxin--NADP reductase	1.88e-02	NA	NA	0.3814
6. F	A4YXZ8	Ferredoxin--NADP reductase	3.50e-02	NA	NA	0.3983
6. F	A7ZWZ4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.13e-03	NA	NA	0.3737
6. F	C8WLM1	Digoxin reductase	4.13e-02	NA	NA	0.3224
6. F	Q5RAP5	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2	7.89e-03	NA	NA	0.3127
6. F	Q8DW88	Urocanate reductase	6.50e-02	NA	NA	0.2957
6. F	Q67QU3	Ferredoxin--NADP reductase	5.02e-03	NA	NA	0.5426
6. F	P0A9P1	Dihydrolipoyl dehydrogenase	2.71e-02	NA	NA	0.2932
6. F	Q8ETS1	Ferredoxin--NADP reductase 1	1.72e-02	NA	NA	0.392
6. F	Q4J6Z4	Ferredoxin--NADP reductase 2	9.15e-03	NA	NA	0.4016
6. F	B5WWZ8	Long-chain-alcohol oxidase FAO1	2.75e-01	NA	NA	0.2312
6. F	Q53589	4,4'-diaponeurosporene oxygenase	1.39e-02	NA	NA	0.3286
6. F	O57920	Digeranylgeranylglycerophospholipid reductase	1.64e-04	NA	NA	0.4312
6. F	Q88KY8	Soluble pyridine nucleotide transhydrogenase	2.09e-02	NA	NA	0.2696
6. F	B1ICY3	Ferredoxin--NADP reductase	1.06e-02	NA	NA	0.4235
6. F	A4XSQ1	Soluble pyridine nucleotide transhydrogenase	2.45e-02	NA	NA	0.2687
6. F	Q12WF0	Digeranylgeranylglycerophospholipid reductase 2	1.99e-04	NA	NA	0.502
6. F	Q6BPI1	Glutathione reductase	4.85e-02	NA	NA	0.3456
6. F	Q9SPB1	Leghemoglobin reductase	4.03e-02	NA	NA	0.3053
6. F	A0R4S9	3-oxosteroid 1-dehydrogenase	4.18e-02	NA	NA	0.3152
6. F	B3QXR3	Ferredoxin--NADP reductase 2	1.49e-02	NA	NA	0.4069
6. F	A6US00	Digeranylgeranylglycerophospholipid reductase	1.62e-04	NA	NA	0.5116
6. F	B1YKW2	Ferredoxin--NADP reductase 1	2.56e-02	NA	NA	0.4026
6. F	Q81XS0	Ferredoxin--NADP reductase 2	1.18e-02	NA	NA	0.3984
6. F	Q38YJ1	Ferredoxin--NADP reductase 2	8.73e-03	NA	NA	0.4112
6. F	Q5R4B1	Dihydrolipoyl dehydrogenase, mitochondrial	8.44e-02	NA	NA	0.2811
6. F	Q2NFF7	Digeranylgeranylglycerophospholipid reductase 2	1.85e-04	NA	NA	0.5197
6. F	Q88UC0	Ferredoxin--NADP reductase	5.49e-03	NA	NA	0.4158
6. F	Q3K9F5	Soluble pyridine nucleotide transhydrogenase	2.03e-02	NA	NA	0.4043
6. F	Q72YF6	Ferredoxin--NADP reductase 2	1.13e-02	NA	NA	0.4033
6. F	F2R776	Rifampicin monooxygenase	1.07e-03	NA	NA	0.3846
6. F	Q1RHV1	Ferredoxin--NADP reductase	9.28e-03	NA	NA	0.5234
6. F	A2SFW9	Ferredoxin--NADP reductase	5.54e-02	NA	NA	0.3438
6. F	Q3S8R0	6-methylpretetramide 4-monooxygenase	1.57e-05	NA	NA	0.4255
6. F	Q8CIZ7	Dihydrolipoyl dehydrogenase, mitochondrial	6.95e-02	NA	NA	0.2871
6. F	A5W6F5	Soluble pyridine nucleotide transhydrogenase	2.25e-02	NA	NA	0.25
6. F	B5Z2Q2	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.09e-03	NA	NA	0.3287
6. F	Q8KHZ8	Flavin-dependent tryptophan halogenase RebH	2.45e-02	NA	NA	0.3671
6. F	Q3Z585	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.14e-03	NA	NA	0.3776
6. F	A8H2Z3	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.10e-01	NA	NA	0.3418
6. F	P21880	Dihydrolipoyl dehydrogenase	3.26e-02	NA	NA	0.2713
6. F	B4F1H1	Soluble pyridine nucleotide transhydrogenase	2.05e-02	NA	NA	0.4091
6. F	A4F891	Ferredoxin--NADP reductase	1.01e-02	NA	NA	0.3924
6. F	B7LUN3	Soluble pyridine nucleotide transhydrogenase	3.26e-02	NA	NA	0.3765
6. F	O32823	Thioredoxin reductase	1.87e-02	NA	NA	0.4198
6. F	Q6LLT9	Soluble pyridine nucleotide transhydrogenase	1.96e-02	NA	NA	0.3719
6. F	Q3IMI0	Thiamine thiazole synthase	3.36e-02	NA	NA	0.6124
6. F	B1JQ50	Soluble pyridine nucleotide transhydrogenase	2.86e-02	NA	NA	0.3958
6. F	P22637	Cholesterol oxidase	1.08e-01	NA	NA	0.2529
6. F	Q6LXJ8	Thiamine thiazole synthase	3.97e-03	NA	NA	0.5534
6. F	Q9ZD33	Ferredoxin--NADP reductase	1.87e-02	NA	NA	0.5065
6. F	B1J606	Soluble pyridine nucleotide transhydrogenase	2.19e-02	NA	NA	0.2525
6. F	A9VMZ3	Ferredoxin--NADP reductase 2	1.15e-02	NA	NA	0.4118
6. F	Q9HKS9	Digeranylgeranylglycerophospholipid reductase	7.68e-05	NA	NA	0.5398
6. F	B0BXN8	Ferredoxin--NADP reductase	1.05e-02	NA	NA	0.5096
6. F	Q1QZP3	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.90e-01	NA	NA	0.3163
6. F	P0A0E7	Dihydrolipoyl dehydrogenase	2.02e-02	NA	NA	0.2793
6. F	A0M4X2	Kynurenine 3-monooxygenase	2.40e-03	NA	NA	0.4107
6. F	A0QB57	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.63e-03	NA	NA	0.3913
6. F	Q48KI8	Soluble pyridine nucleotide transhydrogenase	2.27e-02	NA	NA	0.2856
6. F	P50397	Rab GDP dissociation inhibitor beta	4.39e-02	NA	NA	0.3197
6. F	B2JZF3	Soluble pyridine nucleotide transhydrogenase	2.75e-02	NA	NA	0.39
6. F	A6VJ23	Digeranylgeranylglycerophospholipid reductase	2.32e-04	NA	NA	0.4911
6. F	B1LIN2	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.16e-03	NA	NA	0.3553
6. F	A1VQ12	Ferredoxin--NADP reductase	4.33e-02	NA	NA	0.5036
6. F	Q17043	Aplysianin-A	2.91e-02	NA	NA	0.3112
6. F	A7I9P9	Digeranylgeranylglycerophospholipid reductase	2.88e-04	NA	NA	0.5156
6. F	A9R6N5	Soluble pyridine nucleotide transhydrogenase	2.94e-02	NA	NA	0.3889
6. F	A6UWL1	Digeranylgeranylglycerophospholipid reductase	1.72e-04	NA	NA	0.5217
6. F	Q12B36	Ferredoxin--NADP reductase	3.69e-02	NA	NA	0.3571
6. F	O87386	Sarcosine oxidase subunit alpha	1.87e-01	NA	NA	0.4059
6. F	Q0D1P2	FAD-dependent monooxygenase terD	5.51e-03	NA	NA	0.4217
6. F	B7UNU0	Soluble pyridine nucleotide transhydrogenase	3.39e-02	NA	NA	0.3707
6. F	Q1CBU5	Soluble pyridine nucleotide transhydrogenase	2.79e-02	NA	NA	0.403
6. F	B1XBJ4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	3.20e-03	NA	NA	0.3937
6. F	Q5FH31	Ferredoxin--NADP reductase	1.99e-02	NA	NA	0.3894
6. F	A9C3H6	Ferredoxin--NADP reductase	2.88e-02	NA	NA	0.3693
6. F	A8GS72	Ferredoxin--NADP reductase	1.16e-02	NA	NA	0.4001
6. F	Q7A3D9	4,4'-diaponeurosporene oxygenase	1.41e-02	NA	NA	0.3133
6. F	P53572	Protein FixC	5.76e-04	NA	NA	0.4238
6. F	B5REZ6	Soluble pyridine nucleotide transhydrogenase	3.50e-02	NA	NA	0.3673
6. F	A4SNE3	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.35e-01	NA	NA	0.3058
6. F	A6TAC9	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.91e-03	NA	NA	0.3859
6. F	A7GUD5	Ferredoxin--NADP reductase 2	1.11e-02	NA	NA	0.4117
6. F	P09063	Dihydrolipoyl dehydrogenase	3.06e-02	NA	NA	0.2941
6. F	Q9K7F3	Ferredoxin--NADP reductase	1.02e-02	NA	NA	0.4017
6. F	Q6IWZ0	L-amino-acid oxidase	6.29e-02	NA	NA	0.3213
6. F	Q1B5E2	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.99e-03	NA	NA	0.4102
6. F	Q8DD46	Soluble pyridine nucleotide transhydrogenase	2.51e-02	NA	NA	0.3509
6. F	C5A6E5	Digeranylgeranylglycerophospholipid reductase	5.26e-04	NA	NA	0.4995
6. F	A6VGT9	Thiamine thiazole synthase	3.96e-03	NA	NA	0.5951
6. F	Q8Z9K9	Protein FixC	6.29e-04	NA	NA	0.4491
6. F	A8GNK2	Ferredoxin--NADP reductase	1.84e-02	NA	NA	0.5118
6. F	Q9ZD97	Thioredoxin reductase	1.61e-02	NA	NA	0.4223
6. F	O18480	Dihydrolipoyl dehydrogenase	3.47e-02	NA	NA	0.2662
6. F	Q4ULM2	Ferredoxin--NADP reductase	2.10e-02	NA	NA	0.5091
6. F	Q9XBQ9	Soluble pyridine nucleotide transhydrogenase	2.26e-02	NA	NA	0.2847
6. F	A0A1R3RGJ2	Halogenase otaD	1.09e-04	NA	NA	0.4181
6. F	A2SQK1	Digeranylgeranylglycerophospholipid reductase	1.38e-04	NA	NA	0.4954
6. F	Q8S4R4	Prolycopene isomerase, chloroplastic	1.03e-02	NA	NA	0.2984
6. F	Q2GGH5	Ferredoxin--NADP reductase	1.93e-02	NA	NA	0.4095
6. F	A6TC10	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.46e-01	NA	NA	0.3245
6. F	Q8EWR4	Ferredoxin--NADP reductase	1.24e-02	NA	NA	0.3996
6. F	B2G9D0	Ferredoxin--NADP reductase	1.05e-02	NA	NA	0.4076
6. F	K7QRJ5	Dialkyldecalin synthase	2.54e-03	NA	NA	0.4101
6. F	Q5WAF1	Ferredoxin--NADP reductase 1	1.77e-02	NA	NA	0.3912
6. F	Q6C5H4	Glutathione reductase	2.35e-02	NA	NA	0.2778
6. F	Q742Z1	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.80e-03	NA	NA	0.3837
6. F	Q03ZE9	Ferredoxin--NADP reductase	6.48e-03	NA	NA	0.3844
6. F	P31052	Dihydrolipoyl dehydrogenase	2.00e-02	NA	NA	0.2779
6. F	A0R1T4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	4.80e-03	NA	NA	0.3927
6. F	Q46YY3	Ferredoxin--NADP reductase 2	4.47e-02	NA	NA	0.3571
6. F	A9A6R1	Digeranylgeranylglycerophospholipid reductase	2.16e-04	NA	NA	0.5262
6. F	B0BPE2	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.50e-01	NA	NA	0.3243
6. F	Q2YIQ2	D-erythritol 1-phosphate dehydrogenase	1.86e-03	NA	NA	0.3555
6. F	A7Z8C1	Ferredoxin--NADP reductase 2	1.29e-02	NA	NA	0.4023
6. F	A7FD10	Soluble pyridine nucleotide transhydrogenase	2.60e-02	NA	NA	0.3922
6. F	F9UNH3	Urocanate reductase	5.26e-02	NA	NA	0.3077
6. F	Q476N1	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	4.22e-03	NA	NA	0.3322
6. F	A6U499	Ferredoxin--NADP reductase	1.91e-02	NA	NA	0.3697
6. F	Q8Y5U4	Ferredoxin--NADP reductase 1	5.70e-03	NA	NA	0.5288
6. F	Q8TUV8	Digeranylgeranylglycerophospholipid reductase 2	1.07e-04	NA	NA	0.4847
6. F	Q1QNQ1	Ferredoxin--NADP reductase	3.35e-02	NA	NA	0.3873
6. F	Q8U4J0	Digeranylgeranylglycerophospholipid reductase	6.72e-04	NA	NA	0.435
6. F	Q0KCD1	Ferredoxin--NADP reductase 1	1.78e-02	NA	NA	0.4702
6. F	O27753	Digeranylgeranylglycerophospholipid reductase 2	6.17e-04	NA	NA	0.4617
6. F	A5FYH8	Ferredoxin--NADP reductase	3.65e-02	NA	NA	0.3932
6. F	Q75F69	Squalene monooxygenase	1.48e-03	NA	NA	0.3619
6. F	Q4KFA6	Soluble pyridine nucleotide transhydrogenase	2.37e-02	NA	NA	0.2809
6. F	B2GEF7	Ferredoxin--NADP reductase	1.02e-02	NA	NA	0.4457
6. F	P35484	Dihydrolipoyl dehydrogenase (Fragment)	2.54e-02	NA	NA	0.3956
6. F	Q1BGA7	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	4.75e-03	NA	NA	0.3906
6. F	Q98M06	Ferredoxin--NADP reductase	3.41e-02	NA	NA	0.3915
6. F	Q04HB6	Ferredoxin--NADP reductase	1.77e-02	NA	NA	0.5075
6. F	O07561	Uncharacterized aromatic compound monooxygenase YhjG	1.15e-03	NA	NA	0.4289
6. F	B7MPB4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.08e-03	NA	NA	0.3696
6. F	B3CTT3	Ferredoxin--NADP reductase	1.32e-02	NA	NA	0.4022
6. F	Q0K8J6	Ferredoxin--NADP reductase 2	4.52e-02	NA	NA	0.3673
6. F	Q5KVP7	Ferredoxin--NADP reductase	9.62e-03	NA	NA	0.4162
6. F	Q5SL28	Ferredoxin--NADP reductase	1.01e-02	NA	NA	0.3661
6. F	A4FZB4	Digeranylgeranylglycerophospholipid reductase	1.83e-04	NA	NA	0.4778
6. F	P9WMV6	Uncharacterized GMC-type oxidoreductase MT0511/MT0512	1.21e-01	NA	NA	0.2889
6. F	P11959	Dihydrolipoyl dehydrogenase	2.11e-02	NA	NA	0.2923
6. F	Q6HA23	Glutathione reductase	4.63e-02	NA	NA	0.2588
6. F	Q9Y9Z0	Thiamine thiazole synthase	2.50e-02	NA	NA	0.5339
6. F	Q9V2B0	Digeranylgeranylglycerophospholipid reductase	1.88e-04	NA	NA	0.4567
6. F	P17054	Phytoene desaturase (neurosporene-forming)	7.66e-03	NA	NA	0.3158
6. F	Q5M3J6	Ferredoxin--NADP reductase	1.05e-02	NA	NA	0.424
6. F	P68645	Protein FixC	2.60e-04	NA	NA	0.4585
6. F	B3CMJ8	Ferredoxin--NADP reductase	1.32e-02	NA	NA	0.3887
6. F	A6H1P4	Kynurenine 3-monooxygenase	2.59e-03	NA	NA	0.3907
6. F	B3R4A7	Ferredoxin--NADP reductase 1	1.92e-02	NA	NA	0.4675
6. F	Q58PK7	Anhydrotetracycline monooxygenase	1.46e-03	NA	NA	0.4157
6. F	Q6M083	Digeranylgeranylglycerophospholipid reductase	1.66e-04	NA	NA	0.514
6. F	B2IHR5	Ferredoxin--NADP reductase	3.48e-02	NA	NA	0.3999
6. F	A4SVT8	Ferredoxin--NADP reductase	8.09e-02	NA	NA	0.3648
6. F	A3N0L8	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	2.27e-01	NA	NA	0.347
6. F	B7M2Z5	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.09e-03	NA	NA	0.3667
6. F	Q13QI0	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	5.41e-03	NA	NA	0.3096
6. F	Q2NER9	Digeranylgeranylglycerophospholipid reductase 3	3.62e-04	NA	NA	0.4831
6. F	P9WHH4	Probable soluble pyridine nucleotide transhydrogenase	1.55e-02	NA	NA	0.4444
6. F	Q5HDI3	Ferredoxin--NADP reductase	1.99e-02	NA	NA	0.3707
6. F	P50529	Soluble pyridine nucleotide transhydrogenase	1.98e-02	NA	NA	0.3843
6. F	Q4ZV77	Soluble pyridine nucleotide transhydrogenase	2.08e-02	NA	NA	0.2895
6. F	Q5FT88	Ferredoxin--NADP reductase	1.94e-02	NA	NA	0.3834
6. F	Q6N2U4	Ferredoxin--NADP reductase	3.45e-02	NA	NA	0.3953
6. F	Q83MI1	Soluble pyridine nucleotide transhydrogenase	3.50e-02	NA	NA	0.3727
6. F	A8AXQ6	Ferredoxin--NADP reductase	1.39e-02	NA	NA	0.434
6. F	Q9Z4P0	Fumarate reductase flavoprotein subunit	1.75e-02	NA	NA	0.3389
6. F	Q3YS71	Ferredoxin--NADP reductase	1.60e-02	NA	NA	0.3888
6. F	A7X5Z9	Ferredoxin--NADP reductase	1.92e-02	NA	NA	0.3731
6. F	A9N465	tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC	1.50e-01	NA	NA	0.2936
6. F	Q2ITC6	Ferredoxin--NADP reductase	3.28e-02	NA	NA	0.3765
6. F	Q66G61	Soluble pyridine nucleotide transhydrogenase	2.11e-02	NA	NA	0.392
6. F	A0B573	Digeranylgeranylglycerophospholipid reductase	1.04e-04	NA	NA	0.4732
6. F	Q8X680	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.04e-03	NA	NA	0.3696
6. F	B8GGQ9	Digeranylgeranylglycerophospholipid reductase	1.15e-04	NA	NA	0.5045
6. F	A1U1Y5	Soluble pyridine nucleotide transhydrogenase	1.94e-02	NA	NA	0.2939
6. F	P60028	Rab GDP dissociation inhibitor alpha	4.83e-02	NA	NA	0.3141
6. F	B1XWQ5	Ferredoxin--NADP reductase	3.40e-02	NA	NA	0.3726
6. F	A1JI37	Soluble pyridine nucleotide transhydrogenase	2.74e-02	NA	NA	0.39
6. F	A7ZI94	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.01e-03	NA	NA	0.3936
6. F	B3R5L8	Ferredoxin--NADP reductase 2	4.72e-02	NA	NA	0.508
6. F	Q03PJ4	Ferredoxin--NADP reductase	9.87e-03	NA	NA	0.3954
6. F	Q5HBC7	Ferredoxin--NADP reductase	1.20e-02	NA	NA	0.396
6. F	A5F4K5	Soluble pyridine nucleotide transhydrogenase	2.45e-02	NA	NA	0.3556
6. F	A6V3A6	Soluble pyridine nucleotide transhydrogenase	2.23e-02	NA	NA	0.2645
6. F	A3CST9	Digeranylgeranylglycerophospholipid reductase	2.53e-04	NA	NA	0.4451
6. F	O07622	Putative Rieske 2Fe-2S iron-sulfur protein YhfW	5.25e-03	NA	NA	0.3463
6. F	P43783	Glutathione reductase	4.52e-02	NA	NA	0.2948
6. F	A1TCX2	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.64e-03	NA	NA	0.408
6. F	Q3V7Z9	Thiamine thiazole synthase	1.64e-02	NA	NA	0.5875
6. F	O29786	Digeranylgeranylglycerophospholipid reductase	7.51e-04	NA	NA	0.5076
6. F	Q07RK6	Ferredoxin--NADP reductase	3.35e-02	NA	NA	0.3863
6. F	A4JQH4	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 2	7.71e-03	NA	NA	0.3653
6. F	A5UNX8	Digeranylgeranylglycerophospholipid reductase	6.99e-04	NA	NA	0.5135
6. F	B7L503	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	1.10e-03	NA	NA	0.3646
6. F	A8A770	Soluble pyridine nucleotide transhydrogenase	3.22e-02	NA	NA	0.3723
6. F	Q7MQ83	Soluble pyridine nucleotide transhydrogenase	2.50e-02	NA	NA	0.3837
6. F	Q9HUY1	Dihydrolipoyl dehydrogenase 3	2.95e-02	NA	NA	0.2885
6. F	A1WQW2	Ferredoxin--NADP reductase	4.89e-02	NA	NA	0.3802
6. F	Q9I3D1	Dihydrolipoyl dehydrogenase	1.73e-02	NA	NA	0.2741
6. F	M1WCF5	Monoogygenase CPUR_05431	6.78e-03	NA	NA	0.3822
6. F	A0A4P8GF19	Flavin-dependent monooxygenase eupH	4.26e-04	NA	NA	0.3929
6. F	Q8NUQ3	4,4'-diaponeurosporene oxygenase	1.49e-02	NA	NA	0.3222
6. F	I1R9B0	Thioredoxin reductase FGSG_00043	4.80e-02	NA	NA	0.4009
6. F	Q6L1Y6	Ferredoxin--NADP reductase	8.18e-03	NA	NA	0.4255
6. F	Q1RJD8	Thioredoxin reductase	1.84e-02	NA	NA	0.4272
6. F	P14218	Dihydrolipoyl dehydrogenase	2.12e-02	NA	NA	0.2788
6. F	Q03JS2	Ferredoxin--NADP reductase	9.79e-03	NA	NA	0.422
6. F	Q50068	Dihydrolipoyl dehydrogenase	3.93e-02	NA	NA	0.2868
6. F	Q483W3	Ferredoxin--NADP reductase	3.58e-02	NA	NA	0.3825
6. F	P99084	Dihydrolipoyl dehydrogenase	1.95e-02	NA	NA	0.2697
6. F	A8Z563	Ferredoxin--NADP reductase	2.10e-02	NA	NA	0.3702
6. F	B3QXE1	Ferredoxin--NADP reductase 1	1.63e-02	NA	NA	0.3636
6. F	Q1CNP4	Soluble pyridine nucleotide transhydrogenase	2.73e-02	NA	NA	0.3963
6. F	Q0TA96	Soluble pyridine nucleotide transhydrogenase	5.31e-02	NA	NA	0.4095
6. F	A4XD40	Kynurenine 3-monooxygenase	3.08e-03	NA	NA	0.3304
6. F	D0VWY5	Glutathione amide reductase	6.12e-02	NA	NA	0.283
6. F	B3QPZ8	Ferredoxin--NADP reductase	1.43e-02	NA	NA	0.387
6. F	Q8ZRW9	Protein FixC	6.42e-04	NA	NA	0.454
6. F	C3K4W1	Soluble pyridine nucleotide transhydrogenase	2.35e-02	NA	NA	0.2839
6. F	O05139	Soluble pyridine nucleotide transhydrogenase	2.05e-02	NA	NA	0.2752
6. F	Q5RCE1	Rab GDP dissociation inhibitor beta	4.10e-02	NA	NA	0.294
6. F	P31046	Dihydrolipoyl dehydrogenase 3	3.51e-02	NA	NA	0.2883
6. F	Q2SIP2	Soluble pyridine nucleotide transhydrogenase	2.41e-02	NA	NA	0.2775
6. F	Q60151	Glutathione reductase	4.04e-02	NA	NA	0.2898
6. F	Q81ZB7	Ferredoxin--NADP reductase 1	1.59e-02	NA	NA	0.3917
6. F	Q045M0	Ferredoxin--NADP reductase	2.12e-02	NA	NA	0.417
6. F	B5XQI9	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	9.98e-04	NA	NA	0.3902
6. F	Q74KS6	Ferredoxin--NADP reductase	2.05e-02	NA	NA	0.4104
6. F	A0R951	Ferredoxin--NADP reductase 1	1.65e-02	NA	NA	0.5023
6. F	Q9S158	3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	2.34e-03	NA	NA	0.3623
6. F	A8AKW0	Soluble pyridine nucleotide transhydrogenase	3.27e-02	NA	NA	0.3747
6. F	A4FWG7	Thiamine thiazole synthase	4.10e-03	NA	NA	0.6068
7. B	C1C6S2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.27e-12	NA	1.74e-07	NA
7. B	Q0ANF3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.49e-13	NA	0.008	NA
7. B	B9DS62	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.05e-12	NA	7.84e-09	NA
7. B	Q55692	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.53e-13	NA	3.37e-07	NA
7. B	C6E557	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.96e-13	NA	1.98e-09	NA
7. B	Q97R84	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.16e-12	NA	2.60e-08	NA
7. B	A5G7S3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	8.92e-14	NA	2.93e-06	NA
7. B	Q1JLM2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.86e-13	NA	1.57e-08	NA
7. B	Q043R6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.49e-13	NA	1.03e-08	NA
7. B	A5D2W5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.47e-13	NA	2.06e-10	NA
7. B	B9KRK8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.75e-14	NA	8.45e-05	NA
7. B	C0MFF9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.79e-13	NA	2.11e-07	NA
7. B	Q8CPH2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.86e-13	NA	2.22e-15	NA
7. B	B0JFX8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.33e-13	NA	0.001	NA
7. B	C1CRV5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.08e-12	NA	1.06e-06	NA
7. B	A5IJ51	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.94e-14	NA	3.95e-06	NA
7. B	Q2W4D9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.03e-12	NA	0.003	NA
7. B	A3PJ80	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.29e-14	NA	9.71e-05	NA
7. B	C0M6C7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.02e-12	NA	2.18e-07	NA
7. B	Q8E5M6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.29e-12	NA	4.28e-09	NA
7. B	Q2JRF7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.34e-13	NA	4.93e-08	NA
7. B	Q3K1B8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.20e-12	NA	7.31e-09	NA
7. B	A2REF7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.43e-13	NA	1.44e-08	NA
7. B	Q5N5J0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.42e-13	NA	2.27e-06	NA
7. B	Q5FKE1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.09e-13	NA	7.72e-10	NA
7. B	Q24UF0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.59e-14	NA	2.38e-07	NA
7. B	Q3AX63	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.08e-13	NA	9.23e-13	NA
7. B	A4WRQ2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.31e-14	NA	2.08e-04	NA
7. B	Q7U7T2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.66e-13	NA	1.55e-12	NA
7. B	B8E2F5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.30e-14	NA	6.72e-09	NA
7. B	B2V9U2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.19e-09	NA	4.52e-10	NA
7. B	C1CDT9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.21e-12	NA	1.69e-07	NA
7. B	Q2YXL7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.78e-13	NA	9.79e-15	NA
7. B	Q6ALS7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.36e-13	NA	2.00e-11	NA
7. B	Q9CG79	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.34e-13	NA	5.89e-07	NA
7. B	Q0AYP4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.47e-13	NA	2.41e-09	NA
7. B	A7HL16	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.25e-13	NA	6.97e-09	NA
7. B	B1XK17	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.83e-13	NA	7.86e-04	NA
7. B	Q9RXU7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.80e-13	NA	3.30e-06	NA
7. B	Q1JBP0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.92e-13	NA	1.57e-08	NA
7. B	Q5HPU1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.41e-13	NA	2.22e-15	NA
7. B	A4J5Z8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.32e-13	NA	4.93e-09	NA
7. B	A6U169	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.22e-13	NA	1.11e-14	NA
7. B	A1USB2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.22e-13	NA	0.002	NA
7. B	P0DB36	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.88e-13	NA	9.68e-08	NA
7. B	Q46K52	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.72e-13	NA	1.25e-10	NA
7. B	Q03KX0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.57e-12	NA	1.62e-09	NA
7. B	Q5M4M7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.15e-12	NA	1.63e-09	NA
7. B	Q8DZX5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.69e-12	NA	7.31e-09	NA
7. B	Q39X89	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.91e-14	NA	4.76e-15	NA
7. B	A4XIW8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.91e-13	NA	1.38e-12	NA
7. B	P64235	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.17e-13	NA	9.79e-15	NA
7. B	B5YFC6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.55e-09	NA	5.12e-10	NA
7. B	Q8DQ51	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.40e-12	NA	1.74e-07	NA
7. B	B9KAP3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	7.35e-14	NA	3.08e-07	NA
7. B	B1L7X2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.41e-13	NA	2.38e-06	NA
7. B	Q2JQ64	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.60e-12	NA	2.41e-09	NA
7. B	B1YIB2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.52e-13	NA	1.79e-11	NA
7. B	B5Y8G1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.33e-13	NA	2.73e-10	NA
7. B	Q2G718	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.84e-14	NA	1.25e-05	NA
7. B	A4VUS8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.17e-12	NA	2.44e-10	NA
7. B	A0LDC6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.21e-13	NA	2.90e-05	NA
7. B	P64236	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.96e-13	NA	9.79e-15	NA
7. B	Q1JGS2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.08e-13	NA	2.29e-08	NA
7. B	A5ISD5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.74e-13	NA	1.11e-14	NA
7. B	Q2LT41	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.41e-13	NA	4.90e-05	NA
7. B	Q6GHI4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.67e-13	NA	1.52e-14	NA
7. B	A9FRC1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.06e-12	NA	6.27e-04	NA
7. B	C0QTE2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.04e-13	NA	1.05e-04	NA
7. B	O68141	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.62e-13	NA	8.59e-04	NA
7. B	A7X1M6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.65e-13	NA	9.79e-15	NA
7. B	Q49X36	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.44e-13	NA	3.97e-14	NA
7. B	Q38WZ1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.42e-13	NA	1.59e-07	NA
7. B	Q8P106	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.39e-13	NA	1.44e-08	NA
7. B	A8F516	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.50e-08	NA	4.23e-05	NA
7. B	Q99ZL9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.96e-13	NA	1.65e-08	NA
7. B	A3DCM0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.57e-13	NA	9.14e-09	NA
7. B	B0T866	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.79e-13	NA	0.002	NA
7. B	B2A334	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.99e-15	NA	2.64e-11	NA
7. B	Q3AIZ7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.07e-12	NA	8.85e-13	NA
7. B	B1IBA6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.98e-13	NA	1.74e-07	NA
7. B	Q1MQ25	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	8.86e-13	NA	1.75e-05	NA
7. B	Q2NAC8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.31e-14	NA	4.29e-07	NA
7. B	Q6MTB4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 2	8.33e-15	NA	4.21e-10	NA
7. B	Q9WZJ3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.46e-13	NA	2.09e-06	NA
7. B	B1I258	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.41e-13	NA	1.25e-11	NA
7. B	A5EJU4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.94e-13	NA	1.05e-04	NA
7. B	Q5HGI1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.81e-13	NA	9.79e-15	NA
7. B	Q1QMC9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	7.82e-13	NA	0.025	NA
7. B	Q5M014	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.24e-12	NA	1.63e-09	NA
7. B	Q6MHW5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.23e-12	NA	0.009	NA
7. B	A4W125	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.34e-12	NA	2.44e-10	NA
7. B	Q1GTZ7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.87e-13	NA	3.33e-05	NA
7. B	Q5XC46	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.65e-13	NA	6.89e-09	NA
7. B	A7HDU6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	7.77e-13	NA	0.023	NA
7. B	Q1GGU2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.17e-14	NA	3.43e-05	NA
7. B	A9NHD0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.11e-13	NA	8.90e-06	NA
7. B	Q6F0T3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 2	3.84e-13	NA	2.70e-07	NA
7. B	Q2RJP8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.33e-09	NA	3.06e-09	NA
7. B	B8JES4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.38e-13	NA	1.54e-06	NA
7. B	Q2SS13	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO 1	9.21e-15	NA	4.61e-11	NA
7. B	Q2ILE0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.63e-13	NA	1.90e-05	NA
7. B	B4UII2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.76e-13	NA	1.22e-06	NA
7. B	A2C3G4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.18e-12	NA	1.72e-10	NA
7. B	Q3AB71	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.95e-13	NA	1.65e-07	NA
7. B	Q2FZ31	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.20e-13	NA	9.79e-15	NA
7. B	Q834K1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.58e-13	NA	2.49e-09	NA
7. B	B7IFU6	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.05e-13	NA	5.51e-10	NA
7. B	A6LJK8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.58e-13	NA	2.81e-08	NA
7. B	Q6G9W2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.82e-13	NA	9.79e-15	NA
7. B	Q9A566	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.23e-13	NA	0.002	NA
7. B	Q9KA24	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.92e-14	NA	9.87e-12	NA
7. B	A2C8E1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	8.28e-13	NA	1.21e-11	NA
7. B	B5EHR5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.15e-13	NA	3.65e-10	NA
7. B	B2IP98	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.18e-12	NA	2.60e-08	NA
7. B	A3CN32	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.18e-12	NA	2.67e-10	NA
7. B	Q74A44	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.03e-13	NA	2.69e-11	NA
7. B	P05428	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.93e-13	NA	5.06e-09	NA
7. B	Q02C58	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.02e-13	NA	7.95e-07	NA
7. B	Q1WU04	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.58e-13	NA	1.33e-10	NA
7. B	A6QGF1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.83e-14	NA	9.79e-15	NA
7. B	P64234	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.64e-13	NA	9.79e-15	NA
7. B	C1CK27	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.06e-12	NA	1.69e-07	NA
7. B	Q2IWI0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.85e-13	NA	1.81e-06	NA
7. B	Q2FHI7	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.97e-13	NA	9.79e-15	NA
7. B	Q8YNJ4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.16e-13	NA	0.005	NA
7. B	B8ZP43	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.88e-12	NA	1.69e-07	NA
7. B	B4U7L4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.03e-13	NA	5.65e-08	NA
7. B	Q48TI1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.11e-13	NA	6.09e-08	NA
7. B	A8LK18	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.40e-13	NA	8.05e-07	NA
7. B	Q166D3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	7.84e-14	NA	4.29e-05	NA
7. B	B5E446	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.08e-12	NA	1.74e-07	NA
7. B	A8Z3T1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.98e-13	NA	9.79e-15	NA
7. B	P0DB37	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.63e-13	NA	9.68e-08	NA
7. B	Q4L5V3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.72e-13	NA	2.52e-12	NA
7. B	Q039E2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.77e-13	NA	2.39e-09	NA
7. B	Q8REM9	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.27e-13	NA	5.07e-06	NA
7. B	Q1J6J1	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.32e-13	NA	1.54e-08	NA
7. B	A5GU85	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.45e-13	NA	1.94e-09	NA
7. B	Q0IB24	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.67e-13	NA	5.09e-13	NA
7. B	A8YV48	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	0.00e+00	NA	9.69e-12	NA
7. B	Q31NM4	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	6.08e-13	NA	2.27e-06	NA
7. B	Q04KY2	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.09e-12	NA	1.74e-07	NA
7. B	Q312C5	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	9.46e-13	NA	7.35e-08	NA
7. B	Q89L21	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	4.88e-13	NA	0.019	NA
7. B	B9DPG3	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	2.47e-13	NA	1.93e-16	NA
7. B	A4YV54	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	7.11e-13	NA	0.003	NA
7. B	Q3J349	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	3.51e-14	NA	9.21e-05	NA
7. B	A8AXH0	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	1.32e-12	NA	3.02e-10	NA
7. B	Q136I8	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO	5.50e-13	NA	1.13e-06	NA