Summary

The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.

AVX55022.1
JCVISYN3A_0909

Ribonuclease P protein component.
M. mycoides homolog: Q6MRS3.
TIGRfam Classification: 5=Equivalog.
Category: Essential.

Statistics

Total GO Annotation: 12
Unique PROST Go: 2
Unique BLAST Go: 1
Unique Foldseek Go: 0

Total Homologs: 513
Unique PROST Homologs: 8
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 5

Literature

Danchin and Fang [1]: NA
Yang and Tsui [2]: NA
Antczak et al. [3]: rnpA; Ribonuclease P protein component
Zhang et al. [4]: GO:0001682|tRNA 5'-leader removal
Bianchi et al. [5]: NA

Structures and Sequence Alignment

The best structural homolog that predicted by 1. PBF was Q88RX0 (Ribonuclease P protein component) with a FATCAT P-Value: 0 and RMSD of 1.48 angstrom. The sequence alignment identity is 40.5%.
Structural alignment shown in left. Query protein AVX55022.1 colored as red in alignment, homolog Q88RX0 colored as blue. Query protein AVX55022.1 is also shown in right top, homolog Q88RX0 showed in right bottom. They are colored based on secondary structures.

  AVX55022.1 M-KNKRVIKKNFEFQEIINYKKTVKNFCFVIYYKDN-DQSYLKYGISVGKKIGNAVVRNKVKRQIRMILRQNINEI-GSISK--DVIILVR-----KSVL 90
      Q88RX0 MRKSYRV-KKETEFQQVFETRNSYANRQFVIYVLEKPGQPHFRVGISVGKKIGNAVARNWVKR--R--IRQSITELKPQLKQDADFLVIARPTVAGKSQA 95

  AVX55022.1 ELKYATLSKSLIKLIKEIK-- 109
      Q88RX0 ETK-AYLSHAL-KLAHLLDND 114

Go Annotations

1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.

Source GO Description
1. PBF GO:0042781 3'-tRNA processing endoribonuclease activity
1. PBF GO:0000049 tRNA binding
1. PBF GO:0030677 ribonuclease P complex
1. PBF GO:0033204 ribonuclease P RNA binding
1. PBF GO:0004526 ribonuclease P activity
1. PBF GO:0043199 sulfate binding
1. PBF GO:0034414 tRNA 3'-trailer cleavage, endonucleolytic
1. PBF GO:0001682 tRNA 5'-leader removal
1. PBF GO:0043168 anion binding
5. P GO:0005737 cytoplasm
5. P GO:0030490 maturation of SSU-rRNA
7. B GO:0031404 chloride ion binding

Uniprot GO Annotations

GO Description
GO:0008033 tRNA processing
GO:0003723 RNA binding
GO:0090305 nucleic acid phosphodiester bond hydrolysis
GO:0000049 tRNA binding
GO:0004518 nuclease activity
GO:0090501 RNA phosphodiester bond hydrolysis
GO:0004519 endonuclease activity
GO:0016787 hydrolase activity
GO:0090502 RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0001682 tRNA 5'-leader removal
GO:0004526 ribonuclease P activity

Homologs

1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.

Source Homolog Description Fatcat Pvalue PROST Evalue BLAST Evalue Foldseek TMScore
1. PBF P0A167 Ribonuclease P protein component 1.55e-13 6.12e-14 0.012 0.8349
1. PBF B9E8Z6 Ribonuclease P protein component 0.00e+00 1.33e-45 2.40e-14 0.8874
1. PBF Q03UI9 Ribonuclease P protein component 1.11e-16 8.21e-38 5.87e-09 0.8868
1. PBF B4SPG1 Ribonuclease P protein component 4.84e-14 1.57e-05 0.006 0.8665
1. PBF Q3K2X6 Ribonuclease P protein component 0.00e+00 1.70e-45 2.14e-18 0.904
1. PBF B8DV04 Ribonuclease P protein component 5.66e-15 8.00e-32 2.23e-05 0.8642
1. PBF Q6KH14 Ribonuclease P protein component 0.00e+00 7.82e-29 2.89e-12 0.899
1. PBF Q8CMN4 Ribonuclease P protein component 1.11e-16 7.21e-43 2.70e-15 0.8902
1. PBF Q8DDI3 Ribonuclease P protein component 1.11e-16 2.19e-34 6.72e-04 0.8614
1. PBF Q8EKT4 Ribonuclease P protein component 1.11e-16 2.39e-33 7.47e-05 0.868
1. PBF C1CMY8 Ribonuclease P protein component 0.00e+00 6.32e-20 1.79e-15 0.914
1. PBF B3DP24 Ribonuclease P protein component 5.63e-14 1.03e-30 1.70e-04 0.8569
1. PBF Q6MRS3 Ribonuclease P protein component 0.00e+00 4.95e-82 2.35e-68 0.9989
1. PBF C0MFG8 Ribonuclease P protein component 0.00e+00 1.86e-24 6.90e-16 0.9048
1. PBF B2TRI3 Ribonuclease P protein component 2.22e-16 8.77e-27 3.02e-07 0.8611
1. PBF Q7VJX7 Ribonuclease P protein component 1.67e-12 9.50e-23 2.31e-05 0.7443
1. PBF P0A0H5 Ribonuclease P protein component 1.11e-16 5.52e-45 7.72e-13 0.8833
1. PBF B2UVJ3 Ribonuclease P protein component 2.34e-11 4.12e-19 2.76e-04 0.8294
1. PBF Q4A913 Ribonuclease P protein component 1.11e-16 2.44e-33 9.76e-12 0.8964
1. PBF Q1QS97 Ribonuclease P protein component 3.06e-13 1.49e-24 0.005 0.8054
1. PBF Q5HCI2 Ribonuclease P protein component 1.11e-16 5.30e-45 6.34e-13 0.8914
1. PBF Q7UNR1 Ribonuclease P protein component 1.08e-10 2.92e-25 1.02e-05 0.7759
1. PBF Q3IK52 Ribonuclease P protein component 1.12e-14 3.58e-06 4.14e-07 0.8475
1. PBF C3KWJ9 Ribonuclease P protein component 0.00e+00 2.35e-39 9.62e-10 0.9177
1. PBF P43039 Ribonuclease P protein component 0.00e+00 8.13e-80 4.66e-65 0.9984
1. PBF Q8DVX4 Ribonuclease P protein component 0.00e+00 2.00e-27 1.03e-20 0.9091
1. PBF Q630B5 Ribonuclease P protein component 0.00e+00 6.72e-36 4.47e-20 0.8995
1. PBF A1KCQ1 Ribonuclease P protein component 4.44e-16 1.79e-28 2.44e-06 0.8677
1. PBF B0JN62 Ribonuclease P protein component 1.55e-15 2.00e-33 2.00e-06 0.8812
1. PBF Q5KU54 Ribonuclease P protein component 0.00e+00 7.27e-28 3.15e-20 0.905
1. PBF A6M3M9 Ribonuclease P protein component 7.77e-16 1.95e-26 4.97e-08 0.857
1. PBF Q9ZJH0 Ribonuclease P protein component 5.50e-11 4.00e-19 1.64e-04 0.8254
1. PBF Q02DD9 Ribonuclease P protein component 1.21e-12 8.49e-15 8.53e-04 0.8149
1. PBF B1VAN7 Ribonuclease P protein component 0.00e+00 1.63e-37 4.08e-10 0.8925
1. PBF Q6GD91 Ribonuclease P protein component 1.11e-16 5.30e-45 6.34e-13 0.8917
1. PBF A5IMC2 Ribonuclease P protein component 0.00e+00 2.17e-40 3.06e-07 0.8993
1. PBF Q8RHA6 Ribonuclease P protein component 2.11e-15 1.46e-34 1.49e-09 0.855
1. PBF A4VS84 Ribonuclease P protein component 1.09e-13 1.06e-16 8.75e-07 0.8346
1. PBF C3P3F8 Ribonuclease P protein component 0.00e+00 6.72e-36 4.47e-20 0.8973
1. PBF C0ZVP7 Ribonuclease P protein component 1.38e-13 6.09e-30 0.007 0.8428
1. PBF A6U596 Ribonuclease P protein component 1.11e-16 5.52e-45 7.72e-13 0.8839
1. PBF Q07VS4 Ribonuclease P protein component 1.11e-16 3.43e-33 7.17e-05 0.863
1. PBF B9IT45 Ribonuclease P protein component 0.00e+00 6.87e-44 3.61e-20 0.898
1. PBF Q8EKU0 Ribonuclease P protein component 0.00e+00 1.21e-28 1.92e-14 0.9049
1. PBF B7J207 Ribonuclease P protein component 9.36e-12 2.39e-29 0.012 0.8215
1. PBF B8ZTN6 Ribonuclease P protein component 4.20e-13 1.04e-32 0.016 0.8345
1. PBF B2V1V3 Ribonuclease P protein component 4.44e-16 1.75e-27 3.98e-07 0.8593
1. PBF B3WBV6 Ribonuclease P protein component 0.00e+00 7.96e-33 1.33e-16 0.9035
1. PBF Q88RX0 Ribonuclease P protein component 0.00e+00 3.14e-47 3.67e-12 0.862
1. PBF B1YGB0 Ribonuclease P protein component 0.00e+00 1.02e-39 9.29e-12 0.8833
1. PBF Q3AG60 Ribonuclease P protein component 4.13e-14 3.04e-38 0.023 0.8356
1. PBF Q9AA39 Ribonuclease P protein component 3.85e-13 1.98e-06 0.008 0.8062
1. PBF Q0TLZ0 Ribonuclease P protein component 5.11e-15 6.57e-26 3.74e-04 0.832
1. PBF Q5XDZ0 Ribonuclease P protein component 0.00e+00 1.33e-23 5.18e-17 0.905
1. PBF B5YBN8 Ribonuclease P protein component 6.53e-13 8.37e-40 0.003 0.8266
1. PBF Q4L2Z1 Ribonuclease P protein component 0.00e+00 1.14e-40 2.47e-14 0.8915
1. PBF B7HZH3 Ribonuclease P protein component 0.00e+00 5.52e-45 9.16e-21 0.9001
1. PBF A0AMG4 Ribonuclease P protein component 1.11e-16 9.94e-31 4.58e-14 0.8814
1. PBF P75111 Ribonuclease P protein component 0.00e+00 3.12e-27 0.031 0.8772
1. PBF Q82YV0 Ribonuclease P protein component 0.00e+00 6.18e-35 7.36e-14 0.8972
1. PBF Q8E6W5 Ribonuclease P protein component 0.00e+00 2.51e-46 2.60e-18 0.9047
1. PBF A2RHL3 Ribonuclease P protein component 0.00e+00 7.32e-38 2.45e-11 0.9188
1. PBF Q92SF4 Ribonuclease P protein component 2.18e-12 1.33e-23 8.35e-05 0.7752
1. PBF Q5QZK1 Ribonuclease P protein component 3.66e-15 4.87e-28 0.004 0.8134
1. PBF Q48VE1 Ribonuclease P protein component 0.00e+00 1.33e-23 5.18e-17 0.9051
1. PBF A1S1G7 Ribonuclease P protein component 4.44e-16 1.11e-34 5.95e-07 0.846
1. PBF P9WGZ2 Ribonuclease P protein component 2.60e-14 6.75e-30 0.011 0.8562
1. PBF Q5LW06 Ribonuclease P protein component 1.51e-12 2.16e-29 2.20e-04 0.8216
1. PBF C1CTU8 Ribonuclease P protein component 0.00e+00 6.32e-20 1.79e-15 0.9167
1. PBF Q5FHQ3 Ribonuclease P protein component 1.11e-16 1.64e-20 7.58e-07 0.8752
1. PBF C3LGU4 Ribonuclease P protein component 0.00e+00 6.72e-36 4.47e-20 0.8992
1. PBF Q6YQX5 Ribonuclease P protein component 2.44e-15 1.21e-14 9.95e-08 0.845
1. PBF A9BJC4 Ribonuclease P protein component 1.33e-15 1.51e-32 8.47e-06 0.8724
1. PBF Q74H92 Ribonuclease P protein component 0.00e+00 1.17e-20 4.27e-08 0.8887
1. PBF B1KQ67 Ribonuclease P protein component 2.22e-16 1.67e-35 1.28e-04 0.8619
1. PBF Q879S2 Ribonuclease P protein component 1.93e-14 1.66e-13 0.018 0.8792
1. PBF B1IHS3 Ribonuclease P protein component 0.00e+00 2.69e-40 6.20e-10 0.9157
1. PBF Q87TR9 Ribonuclease P protein component 1.32e-13 3.43e-13 0.004 0.8383
1. PBF Q6G5W3 Ribonuclease P protein component 1.11e-16 5.30e-45 6.34e-13 0.8882
1. PBF Q1B0S2 Ribonuclease P protein component 2.17e-13 1.22e-21 8.72e-04 0.8602
1. PBF Q1JDN4 Ribonuclease P protein component 0.00e+00 1.09e-23 1.71e-15 0.9058
1. PBF Q17ZA3 Ribonuclease P protein component 3.77e-11 1.96e-21 1.89e-05 0.8238
1. PBF Q047F7 Ribonuclease P protein component 1.11e-16 3.85e-23 1.38e-10 0.8742
1. PBF Q12HM6 Ribonuclease P protein component 0.00e+00 2.62e-33 5.75e-05 0.8697
1. PBF A1RQF1 Ribonuclease P protein component 0.00e+00 2.81e-33 1.39e-04 0.8712
1. PBF C0ZA70 Ribonuclease P protein component 1.78e-15 3.54e-15 1.06e-14 0.8873
1. PBF Q5P4P2 Ribonuclease P protein component 3.44e-14 9.91e-29 0.043 0.831
1. PBF B8J2U6 Ribonuclease P protein component 1.26e-13 3.26e-25 3.01e-06 0.8619
1. PBF Q1JNK3 Ribonuclease P protein component 0.00e+00 1.09e-23 1.71e-15 0.9055
1. PBF Q2FDE7 Ribonuclease P protein component 1.11e-16 5.52e-45 7.72e-13 0.883
1. PBF Q1MM57 Ribonuclease P protein component 1.25e-12 1.86e-22 1.62e-04 0.7793
1. PBF P66689 Ribonuclease P protein component 1.11e-16 5.30e-45 6.34e-13 0.8892
1. PBF Q82FE0 Ribonuclease P protein component 7.70e-13 2.58e-28 0.002 0.8238
1. PBF Q8E1E7 Ribonuclease P protein component 0.00e+00 1.70e-45 2.14e-18 0.9047
1. PBF Q6F0D5 Ribonuclease P protein component 0.00e+00 1.40e-55 2.60e-25 0.9445
1. PBF B5XJN7 Ribonuclease P protein component 0.00e+00 1.33e-23 5.18e-17 0.9061
1. PBF B0K5N8 Ribonuclease P protein component 1.11e-16 3.48e-38 4.42e-12 0.9122
1. PBF Q8R6K4 Ribonuclease P protein component 1.11e-16 7.93e-39 1.86e-10 0.8977
1. PBF Q0SPP9 Ribonuclease P protein component 4.88e-15 6.57e-26 3.74e-04 0.8324
1. PBF Q38UE4 Ribonuclease P protein component 0.00e+00 9.19e-30 6.66e-13 0.8957
1. PBF Q1WRF9 Ribonuclease P protein component 0.00e+00 3.04e-49 2.08e-13 0.8973
1. PBF P0A0H4 Ribonuclease P protein component 1.11e-16 5.52e-45 7.72e-13 0.8822
1. PBF C1ER80 Ribonuclease P protein component 0.00e+00 2.74e-45 9.26e-21 0.899
1. PBF Q98R57 Ribonuclease P protein component 0.00e+00 1.04e-31 2.25e-12 0.8984
1. PBF C5C6N8 Ribonuclease P protein component 3.55e-14 2.23e-29 5.48e-04 0.8767
1. PBF A6VF46 Ribonuclease P protein component 2.45e-13 4.35e-15 0.001 0.8165
1. PBF B7K5U5 Ribonuclease P protein component 2.79e-14 1.42e-24 0.002 0.8756
1. PBF C4KZZ5 Ribonuclease P protein component 0.00e+00 1.30e-36 1.08e-15 0.9089
1. PBF A4Y1A2 Ribonuclease P protein component 3.10e-13 1.50e-15 1.24e-05 0.8239
1. PBF P25814 Ribonuclease P protein component 1.11e-16 3.32e-39 3.74e-15 0.8787
1. PBF B8HR50 Ribonuclease P protein component 5.00e-15 1.34e-28 1.02e-05 0.8692
1. PBF B7GMW3 Ribonuclease P protein component 0.00e+00 8.27e-47 5.17e-19 0.8877
1. PBF A5VMV1 Ribonuclease P protein component 0.00e+00 1.18e-37 4.85e-13 0.9004
1. PBF C1L0I8 Ribonuclease P protein component 1.11e-16 1.08e-30 6.98e-14 0.882
1. PBF P55997 Ribonuclease P protein component 2.27e-11 5.70e-19 1.51e-04 0.8262
1. PBF Q8UIB2 Ribonuclease P protein component 2.07e-12 1.43e-21 4.40e-04 0.7761
1. PBF P46610 Ribonuclease P protein component 4.37e-13 1.04e-32 0.016 0.8346
1. PBF Q03D57 Ribonuclease P protein component 0.00e+00 5.84e-34 5.99e-12 0.8982
1. PBF A7GJP3 Ribonuclease P protein component 0.00e+00 2.69e-40 6.20e-10 0.916
1. PBF A5I820 Ribonuclease P protein component 0.00e+00 2.69e-40 6.20e-10 0.9153
1. PBF C6C0J4 Ribonuclease P protein component 6.79e-14 7.61e-38 5.14e-06 0.8578
1. PBF Q03IQ0 Ribonuclease P protein component 0.00e+00 3.63e-43 2.21e-13 0.9154
1. PBF Q8XH26 Ribonuclease P protein component 4.77e-15 6.57e-26 3.74e-04 0.8326
1. PBF P66688 Ribonuclease P protein component 1.11e-16 5.30e-45 6.34e-13 0.8916
1. PBF B2A474 Ribonuclease P protein component 2.22e-16 1.62e-40 1.40e-11 0.8729
1. PBF A7FPL5 Ribonuclease P protein component 0.00e+00 2.69e-40 6.20e-10 0.9164
1. PBF C1DNF9 Ribonuclease P protein component 1.15e-13 1.20e-20 0.042 0.8266
1. PBF B0KEU7 Ribonuclease P protein component 2.66e-13 9.65e-15 0.003 0.8252
1. PBF Q6HAE9 Ribonuclease P protein component 0.00e+00 6.72e-36 4.47e-20 0.8995
1. PBF C1CA87 Ribonuclease P protein component 0.00e+00 6.32e-20 1.79e-15 0.9169
1. PBF Q2YZB7 Ribonuclease P protein component 2.22e-16 1.93e-44 6.29e-13 0.8813
1. PBF Q5WSE7 Ribonuclease P protein component 4.22e-15 4.54e-38 1.33e-04 0.8374
1. PBF Q2N7X0 Ribonuclease P protein component 9.48e-14 1.72e-22 1.03e-10 0.8726
1. PBF A4ITX4 Ribonuclease P protein component 0.00e+00 7.39e-28 5.01e-18 0.9027
1. PBF Q2LSG2 Ribonuclease P protein component 1.21e-12 1.22e-37 6.60e-10 0.8867
1. PBF B8H1E9 Ribonuclease P protein component 3.33e-13 1.98e-06 0.008 0.804
1. PBF C1CGX2 Ribonuclease P protein component 0.00e+00 6.32e-20 1.79e-15 0.8946
1. PBF B2U822 Ribonuclease P protein component 6.80e-10 2.54e-11 5.52e-04 0.6849
1. PBF Q1J8K9 Ribonuclease P protein component 0.00e+00 1.33e-23 5.18e-17 0.9056
1. PBF Q4A750 Ribonuclease P protein component 0.00e+00 2.44e-33 9.76e-12 0.8963
1. PBF Q67J29 Ribonuclease P protein component 1.55e-15 1.30e-37 4.04e-06 0.8622
1. PBF A8AUN9 Ribonuclease P protein component 0.00e+00 8.21e-24 3.16e-19 0.9113
1. PBF A6Q3D2 Ribonuclease P protein component 1.38e-13 1.38e-34 0.027 0.8191
1. PBF B4U0S7 Ribonuclease P protein component 0.00e+00 1.86e-24 6.90e-16 0.9044
1. PBF B8DCV5 Ribonuclease P protein component 2.22e-16 4.17e-30 3.90e-14 0.8806
1. PBF A9AXK0 Ribonuclease P protein component 1.11e-16 2.75e-12 4.81e-04 0.902
1. PBF Q1I2H2 Ribonuclease P protein component 2.46e-13 2.16e-15 0.011 0.8262
1. PBF C6DYS3 Ribonuclease P protein component 0.00e+00 6.92e-43 2.66e-05 0.9024
1. PBF A4YCM4 Ribonuclease P protein component 0.00e+00 2.81e-33 1.39e-04 0.8763
1. PBF Q181T2 Ribonuclease P protein component 6.55e-15 5.76e-45 2.78e-11 0.8492
1. PBF B8FMU9 Ribonuclease P protein component 2.40e-13 2.13e-39 4.26e-06 0.847
1. PBF A9VTM3 Ribonuclease P protein component 0.00e+00 2.57e-43 2.12e-19 0.8998
1. PBF A5N455 Ribonuclease P protein component 1.67e-15 1.24e-42 3.74e-07 0.9065
1. PBF Q30YQ3 Ribonuclease P protein component 6.39e-14 6.66e-25 1.32e-04 0.8746
1. PBF B7GPF7 Ribonuclease P protein component 6.49e-14 3.70e-30 0.002 0.8556
1. PBF P0A168 Ribonuclease P protein component 1.38e-13 6.12e-14 0.012 0.8364
1. PBF A9KLY3 Ribonuclease P protein component 7.77e-15 1.04e-28 5.70e-08 0.893
1. PBF Q6G2G7 Ribonuclease P protein component 2.27e-12 1.84e-20 7.82e-04 0.7693
1. PBF Q5M2K4 Ribonuclease P protein component 0.00e+00 1.10e-43 3.67e-13 0.9118
1. PBF A6WUK6 Ribonuclease P protein component 0.00e+00 1.14e-32 1.08e-04 0.8812
1. PBF P48206 Ribonuclease P protein component 5.06e-13 3.56e-27 0.003 0.8435
1. PBF O86449 Ribonuclease P protein component 3.72e-13 4.62e-39 0.008 0.87
1. PBF Q0HPE4 Ribonuclease P protein component 0.00e+00 3.37e-33 9.92e-05 0.872
1. PBF Q5HS37 Ribonuclease P protein component 1.11e-16 7.21e-43 2.70e-15 0.8909
1. PBF Q6FZ17 Ribonuclease P protein component 3.78e-12 1.17e-20 0.006 0.8042
1. PBF B0S3V6 Ribonuclease P protein component 0.00e+00 5.66e-33 5.76e-09 0.8991
1. PBF Q9CJ73 Ribonuclease P protein component 0.00e+00 2.74e-36 5.85e-11 0.9171
1. PBF B1LBK1 Ribonuclease P protein component 0.00e+00 4.36e-39 6.61e-08 0.895
1. PBF Q8EU90 Ribonuclease P protein component 1.11e-16 9.74e-38 2.62e-06 0.911
1. PBF C1FP35 Ribonuclease P protein component 0.00e+00 2.69e-40 6.20e-10 0.9146
1. PBF A8MKS3 Ribonuclease P protein component 0.00e+00 8.54e-40 8.86e-08 0.892
1. PBF A3Q8S4 Ribonuclease P protein component 2.36e-13 1.22e-21 8.72e-04 0.8595
1. PBF A5WBB9 Ribonuclease P protein component 1.70e-13 3.27e-15 0.012 0.833
1. PBF Q926Q4 Ribonuclease P protein component 1.11e-16 1.92e-30 6.27e-15 0.8823
1. PBF Q8Y3I1 Ribonuclease P protein component 2.22e-16 1.08e-30 6.98e-14 0.8794
1. PBF Q04ID0 Ribonuclease P protein component 0.00e+00 6.32e-20 1.79e-15 0.9158
1. PBF C0RMG2 Ribonuclease P protein component 4.48e-12 1.42e-15 4.62e-05 0.7773
1. PBF Q5E8Z7 Ribonuclease P protein component 1.33e-15 8.55e-34 8.00e-05 0.8508
1. PBF A7ZAW4 Ribonuclease P protein component 2.22e-16 1.51e-37 1.89e-15 0.8762
1. PBF B8ZPA3 Ribonuclease P protein component 0.00e+00 6.32e-20 1.79e-15 0.9172
1. PBF B1KUB6 Ribonuclease P protein component 0.00e+00 4.41e-41 5.24e-09 0.9205
1. PBF A4J9S4 Ribonuclease P protein component 2.16e-14 7.30e-40 5.25e-06 0.8514
1. PBF A4T4T3 Ribonuclease P protein component 3.21e-12 2.25e-24 0.014 0.8289
1. PBF Q71VQ7 Ribonuclease P protein component 1.11e-16 1.08e-30 6.98e-14 0.8828
1. PBF Q040F1 Ribonuclease P protein component 0.00e+00 2.93e-20 4.32e-08 0.8888
1. PBF Q5X0M0 Ribonuclease P protein component 4.44e-15 3.10e-38 1.42e-04 0.8319
1. PBF B5EGY0 Ribonuclease P protein component 1.22e-15 1.34e-43 3.21e-08 0.894
1. PBF B1XJD2 Ribonuclease P protein component 9.34e-14 6.06e-34 0.007 0.864
1. PBF B7IST7 Ribonuclease P protein component 0.00e+00 3.63e-43 1.30e-19 0.8983
1. PBF A0PX73 Ribonuclease P protein component 0.00e+00 2.00e-48 1.75e-07 0.8879
1. PBF B7H7A5 Ribonuclease P protein component 0.00e+00 2.14e-43 7.16e-20 0.8982
1. PBF A8YTQ9 Ribonuclease P protein component 1.11e-16 7.76e-21 2.04e-07 0.8793
1. PBF B7KHE3 Ribonuclease P protein component 1.89e-15 6.02e-27 6.56e-04 0.883
1. PBF B2IML6 Ribonuclease P protein component 0.00e+00 6.32e-20 1.79e-15 0.917
1. PBF Q0ATU2 Ribonuclease P protein component 0.00e+00 1.29e-30 1.19e-07 0.9069
1. PBF B6EP41 Ribonuclease P protein component 7.77e-16 5.14e-34 1.95e-04 0.8478
1. PBF B1I998 Ribonuclease P protein component 0.00e+00 8.12e-19 1.77e-15 0.9138
1. PBF A5WI39 Ribonuclease P protein component 2.68e-13 4.43e-21 2.02e-04 0.8213
1. PBF Q9A1J4 Ribonuclease P protein component 0.00e+00 1.33e-23 5.18e-17 0.9057
1. PBF A7N1E4 Ribonuclease P protein component 1.11e-16 7.03e-35 2.32e-04 0.8563
1. PBF A7X7A9 Ribonuclease P protein component 1.11e-16 5.30e-45 6.34e-13 0.8913
1. PBF A5G9V6 Ribonuclease P protein component 0.00e+00 6.13e-40 3.44e-10 0.89
1. PBF A0LLH1 Ribonuclease P protein component 1.55e-14 1.52e-35 2.42e-08 0.8951
1. PBF Q4A5G4 Ribonuclease P protein component 0.00e+00 6.18e-35 9.54e-07 0.8859
1. PBF Q9HT05 Ribonuclease P protein component 9.45e-13 8.49e-15 8.53e-04 0.819
1. PBF Q6APZ0 Ribonuclease P protein component 2.43e-11 4.19e-27 0.004 0.8022
1. PBF Q7NPT6 Ribonuclease P protein component 7.75e-14 1.21e-28 0.006 0.8573
1. PBF Q97NI5 Ribonuclease P protein component 0.00e+00 3.84e-19 1.11e-14 0.9144
1. PBF Q8G6J8 Ribonuclease P protein component 1.10e-13 1.03e-30 1.70e-04 0.85
1. PBF Q3J6L7 Ribonuclease P protein component 4.33e-15 4.45e-34 4.78e-04 0.7938
1. PBF A1U8R8 Ribonuclease P protein component 2.15e-13 1.22e-21 8.72e-04 0.8598
1. PBF Q97CV8 Ribonuclease P protein component 1.11e-16 3.62e-33 4.59e-04 0.8867
1. PBF C0QIZ3 Ribonuclease P protein component 3.77e-15 9.33e-41 2.08e-06 0.8244
1. PBF P66691 Ribonuclease P protein component 0.00e+00 1.33e-23 5.18e-17 0.9055
1. PBF Q81JH0 Ribonuclease P protein component 0.00e+00 6.72e-36 4.47e-20 0.8956
1. PBF A1A3X8 Ribonuclease P protein component 2.36e-14 1.99e-30 4.78e-04 0.839
1. PBF A6TXE9 Ribonuclease P protein component 0.00e+00 1.07e-43 4.80e-11 0.9099
1. PBF Q1JIQ1 Ribonuclease P protein component 0.00e+00 1.33e-23 5.18e-17 0.9055
1. PBF B7V7A6 Ribonuclease P protein component 3.00e-12 8.60e-15 0.001 0.8156
1. PBF Q72WU0 Ribonuclease P protein component 0.00e+00 3.81e-45 4.07e-20 0.8988
1. PBF Q8DN92 Ribonuclease P protein component 0.00e+00 6.32e-20 1.79e-15 0.9131
1. PBF B2GA53 Ribonuclease P protein component 0.00e+00 1.18e-37 4.85e-13 0.902
1. PBF Q04CX7 Ribonuclease P protein component 1.22e-15 1.12e-36 4.06e-04 0.867
1. PBF B9DI94 Ribonuclease P protein component 0.00e+00 1.12e-45 4.03e-13 0.8767
1. PBF Q8YDA2 Ribonuclease P protein component 3.43e-12 5.04e-16 1.93e-05 0.8221
1. PBF Q48BF0 Ribonuclease P protein component 2.48e-13 1.58e-13 0.013 0.8356
1. PBF A0KR34 Ribonuclease P protein component 0.00e+00 3.37e-33 9.92e-05 0.8698
1. PBF A8YYS2 Ribonuclease P protein component 1.11e-16 5.52e-45 7.72e-13 0.8827
1. PBF Q7M7H7 Ribonuclease P protein component 4.44e-16 1.79e-33 1.92e-05 0.8501
1. PBF Q9X1H4 Ribonuclease P protein component 0.00e+00 2.05e-39 2.91e-08 0.8979
1. PBF B1MWS3 Ribonuclease P protein component 1.11e-16 1.46e-42 1.07e-07 0.8831
1. PBF A8EY59 Ribonuclease P protein component 1.68e-11 1.19e-38 1.90e-04 0.7994
1. PBF A9KX22 Ribonuclease P protein component 0.00e+00 1.14e-32 1.08e-04 0.8752
1. PBF Q8FV30 Ribonuclease P protein component 2.14e-12 4.42e-16 4.82e-05 0.7569
1. PBF P21172 Ribonuclease P protein component 1.45e-13 3.78e-22 0.002 0.8607
1. PBF B0K8I3 Ribonuclease P protein component 1.11e-16 3.48e-38 4.42e-12 0.9124
1. PBF P47703 Ribonuclease P protein component 2.22e-16 1.17e-25 2.21e-05 0.8699
1. PBF C5D9Z1 Ribonuclease P protein component 0.00e+00 2.64e-39 1.93e-15 0.895
1. PBF A5IWD8 Ribonuclease P protein component 1.11e-16 5.52e-45 7.72e-13 0.8825
1. PBF Q1CRI1 Ribonuclease P protein component 1.29e-11 3.11e-18 3.07e-04 0.8146
1. PBF B7JIL4 Ribonuclease P protein component 0.00e+00 6.72e-36 4.47e-20 0.8989
1. PBF B5E2W2 Ribonuclease P protein component 0.00e+00 6.32e-20 1.79e-15 0.9139
1. PBF Q03N61 Ribonuclease P protein component 0.00e+00 4.72e-36 1.63e-12 0.9026
1. PBF A7GVQ0 Ribonuclease P protein component 0.00e+00 3.88e-44 1.37e-20 0.9021
1. PBF Q0HD62 Ribonuclease P protein component 0.00e+00 3.37e-33 9.92e-05 0.8725
1. PBF P50069 Ribonuclease P protein component 8.31e-12 1.95e-29 0.048 0.8242
1. PBF A5IIK5 Ribonuclease P protein component 4.33e-15 3.10e-38 1.42e-04 0.8313
1. PBF Q032X2 Ribonuclease P protein component 0.00e+00 7.32e-38 2.45e-11 0.9162
1. PBF C0M7E1 Ribonuclease P protein component 0.00e+00 5.15e-24 2.63e-16 0.9115
1. PBF A9NE63 Ribonuclease P protein component 0.00e+00 1.08e-33 4.47e-12 0.9192
1. PBF A3DAT0 Ribonuclease P protein component 0.00e+00 1.14e-32 1.08e-04 0.8761
1. PBF A9WW33 Ribonuclease P protein component 3.26e-12 1.42e-15 4.62e-05 0.7789
1. PBF B9DVV7 Ribonuclease P protein component 0.00e+00 5.15e-24 4.20e-15 0.903
1. PBF P0A5X9 Ribonuclease P protein component 3.53e-14 6.75e-30 0.011 0.8559
1. PBF Q9P9U0 Ribonuclease P protein component 1.62e-14 6.08e-13 0.018 0.8796
1. PBF A5CVI0 Ribonuclease P protein component 1.69e-14 6.54e-39 0.027 0.8446
1. PBF Q1G7Z2 Ribonuclease P protein component 2.22e-16 3.85e-23 1.38e-10 0.8743
1. PBF P0DF25 Ribonuclease P protein component 0.00e+00 1.33e-23 5.18e-17 0.9053
1. PBF B2GEU6 Ribonuclease P protein component 0.00e+00 7.63e-48 2.06e-13 0.897
1. PBF C5C7X2 Ribonuclease P protein component 1.15e-13 3.78e-22 0.002 0.8659
1. PBF B6JNU5 Ribonuclease P protein component 2.51e-11 1.50e-19 2.25e-04 0.8175
1. PBF Q814F3 Ribonuclease P protein component 0.00e+00 3.35e-43 8.48e-20 0.8981
1. PBF Q5LY00 Ribonuclease P protein component 0.00e+00 1.10e-43 3.67e-13 0.9143
1. PBF A8ZRZ3 Ribonuclease P protein component 1.54e-14 1.62e-32 1.10e-11 0.8624
1. PBF A5CY49 Ribonuclease P protein component 6.66e-16 2.58e-41 7.72e-04 0.864
1. PBF A8GP91 Ribonuclease P protein component 1.87e-11 4.78e-37 0.011 0.7496
1. PBF P0DF24 Ribonuclease P protein component 0.00e+00 1.33e-23 5.18e-17 0.9058
1. PBF B8DYS1 Ribonuclease P protein component 1.14e-12 7.09e-42 0.002 0.8258
1. PBF A9MJT8 Ribonuclease P protein component 8.88e-16 2.71e-33 0.003 0.84
1. PBF Q5WAG0 Ribonuclease P protein component 1.11e-16 1.10e-20 1.49e-10 0.846
1. PBF Q9RCA4 Ribonuclease P protein component 0.00e+00 3.45e-34 1.69e-15 0.8982
1. PBF A2RCF8 Ribonuclease P protein component 0.00e+00 9.16e-24 4.55e-17 0.9062
1. PBF Q7MQK4 Ribonuclease P protein component 1.11e-16 2.19e-34 6.72e-04 0.8532
1. PBF B8EDW7 Ribonuclease P protein component 0.00e+00 1.14e-32 1.08e-04 0.8762
1. PBF A9MCU8 Ribonuclease P protein component 2.65e-12 1.42e-15 4.62e-05 0.8181
1. PBF A8FJG3 Ribonuclease P protein component 1.11e-16 3.89e-30 1.32e-16 0.8828
1. PBF A1SQV9 Ribonuclease P protein component 6.70e-13 1.27e-32 0.002 0.8337
2. PF C1B7S5 Ribonuclease P protein component 1.03e-13 4.87e-28 NA 0.8362
2. PF Q9L7L9 Ribonuclease P protein component 8.81e-13 1.41e-34 NA 0.842
2. PF A4TSL3 Ribonuclease P protein component 1.85e-11 3.71e-34 NA 0.7844
2. PF A2S8D4 Ribonuclease P protein component 2.84e-10 9.53e-15 NA 0.6573
2. PF Q1CCJ6 Ribonuclease P protein component 1.48e-11 3.71e-34 NA 0.7902
2. PF Q494B8 Ribonuclease P protein component 1.78e-15 6.24e-36 NA 0.851
2. PF A0K2M6 Ribonuclease P protein component 6.62e-14 1.54e-13 NA 0.8717
2. PF Q7VN34 Ribonuclease P protein component 1.11e-15 3.74e-27 NA 0.8475
2. PF A6WYM5 Ribonuclease P protein component 3.89e-12 1.18e-14 NA 0.7852
2. PF B0RMM7 Ribonuclease P protein component 8.39e-14 7.26e-09 NA 0.8606
2. PF A1KS00 Ribonuclease P protein component 2.21e-14 1.41e-29 NA 0.7513
2. PF B0BAN9 Ribonuclease P protein component 5.29e-13 1.94e-32 NA 0.828
2. PF Q5FPY1 Ribonuclease P protein component 2.22e-13 2.31e-08 NA 0.8687
2. PF Q31MS4 Ribonuclease P protein component 1.18e-12 4.78e-27 NA 0.8498
2. PF A4XDK4 Ribonuclease P protein component 5.53e-12 5.76e-22 NA 0.8435
2. PF A5CVC5 Ribonuclease P protein component 3.33e-15 6.29e-39 NA 0.8979
2. PF B4SYB0 Ribonuclease P protein component 7.77e-16 1.62e-32 NA 0.8403
2. PF B1VJ37 Ribonuclease P protein component 1.14e-12 1.70e-28 NA 0.8489
2. PF Q11LE6 Ribonuclease P protein component 9.47e-14 3.55e-33 NA 0.808
2. PF Q46JN4 Ribonuclease P protein component 9.93e-13 3.21e-25 NA 0.8661
2. PF Q1LTW1 Ribonuclease P protein component 1.11e-16 2.03e-34 NA 0.8696
2. PF A8GVL0 Ribonuclease P protein component 1.90e-11 4.04e-37 NA 0.7901
2. PF Q7VQV1 Ribonuclease P protein component 1.90e-14 2.97e-33 NA 0.8345
2. PF A8A6G5 Ribonuclease P protein component 1.02e-14 2.53e-32 NA 0.8305
2. PF Q65VC0 Ribonuclease P protein component 3.00e-15 1.53e-27 NA 0.8351
2. PF B4TAV1 Ribonuclease P protein component 6.66e-16 1.62e-32 NA 0.8403
2. PF Q0SN68 Ribonuclease P protein component 2.09e-12 4.33e-33 NA 0.7861
2. PF A4QIE5 Ribonuclease P protein component 6.46e-13 1.97e-27 NA 0.8262
2. PF A2BSA0 Ribonuclease P protein component 2.27e-12 1.22e-31 NA 0.7357
2. PF Q1R4N2 Ribonuclease P protein component 1.91e-13 2.53e-32 NA 0.8054
2. PF A5UID3 Ribonuclease P protein component 2.22e-16 3.96e-33 NA 0.8582
2. PF C4K7P7 Ribonuclease P protein component 2.22e-16 1.61e-33 NA 0.8524
2. PF Q8PEH6 Ribonuclease P protein component 8.49e-14 7.29e-10 NA 0.8602
2. PF Q5N605 Ribonuclease P protein component 9.77e-13 4.78e-27 NA 0.8389
2. PF A4STS7 Ribonuclease P protein component 2.10e-11 3.99e-34 NA 0.7441
2. PF P66687 Ribonuclease P protein component 7.77e-16 1.62e-32 NA 0.8383
2. PF Q15MS5 Ribonuclease P protein component 6.55e-15 1.44e-34 NA 0.8373
2. PF A2BXQ2 Ribonuclease P protein component 3.26e-10 1.36e-28 NA 0.742
2. PF A8ACL6 Ribonuclease P protein component 7.77e-16 1.60e-32 NA 0.8393
2. PF B7N2E9 Ribonuclease P protein component 1.27e-14 2.53e-32 NA 0.8298
2. PF P22835 Ribonuclease P protein component 2.22e-16 1.12e-32 NA 0.8491
2. PF Q5PKU4 Ribonuclease P protein component 9.99e-16 1.62e-32 NA 0.8381
2. PF B4RJJ5 Ribonuclease P protein component 6.50e-13 9.58e-29 NA 0.8035
2. PF Q821V0 Ribonuclease P protein component 4.03e-12 2.63e-07 NA 0.8352
2. PF B8G7S5 Ribonuclease P protein component 3.00e-15 9.97e-07 NA 0.8779
2. PF A1BJZ9 Ribonuclease P protein component 1.28e-10 2.14e-19 NA 0.7693
2. PF C5BF62 Ribonuclease P protein component 4.44e-16 2.01e-32 NA 0.8454
2. PF B9LGI0 Ribonuclease P protein component 2.22e-15 2.17e-04 NA 0.8768
2. PF A1WWE2 Ribonuclease P protein component 3.55e-15 8.43e-30 NA 0.8452
2. PF A2C7A3 Ribonuclease P protein component 8.08e-13 3.12e-26 NA 0.8208
2. PF B7UMH1 Ribonuclease P protein component 9.44e-15 2.53e-32 NA 0.8326
2. PF P57915 Ribonuclease P protein component 4.44e-16 5.24e-35 NA 0.852
2. PF A6WGN2 Ribonuclease P protein component 1.44e-12 2.54e-20 NA 0.8534
2. PF Q4JSC2 Ribonuclease P protein component 2.25e-12 2.72e-28 NA 0.8583
2. PF B0URU5 Ribonuclease P protein component 2.22e-15 1.86e-33 NA 0.8364
2. PF Q8P337 Ribonuclease P protein component 8.50e-14 7.26e-09 NA 0.8598
2. PF B7M556 Ribonuclease P protein component 1.99e-13 2.53e-32 NA 0.8192
2. PF B5BIL6 Ribonuclease P protein component 7.77e-16 8.10e-33 NA 0.8465
2. PF Q9PLD7 Ribonuclease P protein component 1.25e-12 8.14e-32 NA 0.8345
2. PF Q3KKQ8 Ribonuclease P protein component 7.29e-13 3.49e-31 NA 0.8319
2. PF Q8FSU8 Ribonuclease P protein component 1.21e-12 4.53e-26 NA 0.8136
2. PF A5GRN3 Ribonuclease P protein component 1.17e-10 4.47e-30 NA 0.8038
2. PF B5YXA8 Ribonuclease P protein component 1.11e-15 7.20e-32 NA 0.8375
2. PF A9WBG7 Ribonuclease P protein component 9.10e-15 2.17e-04 NA 0.8628
2. PF Q7X5L4 Ribonuclease P protein component 1.76e-12 7.31e-03 NA 0.7822
2. PF Q62EM2 Ribonuclease P protein component 2.68e-10 9.53e-15 NA 0.6571
2. PF B2VCE5 Ribonuclease P protein component 1.33e-15 2.15e-33 NA 0.8347
2. PF Q1RI66 Ribonuclease P protein component 1.78e-11 4.04e-37 NA 0.7903
2. PF P29433 Ribonuclease P protein component 1.11e-16 1.64e-33 NA 0.8661
2. PF Q7U524 Ribonuclease P protein component 1.61e-12 1.10e-26 NA 0.801
2. PF A9IJC1 Ribonuclease P protein component 3.49e-10 2.37e-28 NA 0.6968
2. PF A1V7D7 Ribonuclease P protein component 2.68e-10 9.53e-15 NA 0.6609
2. PF Q92H35 Ribonuclease P protein component 1.53e-11 2.42e-37 NA 0.8134
2. PF A8GT00 Ribonuclease P protein component 2.45e-11 5.94e-38 NA 0.8045
2. PF Q255T8 Ribonuclease P protein component 1.84e-12 3.33e-08 NA 0.8448
2. PF A1U7J6 Ribonuclease P protein component 4.80e-14 1.54e-17 NA 0.8143
2. PF B7NF21 Ribonuclease P protein component 1.29e-14 2.53e-32 NA 0.8292
2. PF Q3K426 Ribonuclease P protein component 2.24e-13 1.12e-11 NA 0.8324
2. PF B1MN96 Ribonuclease P protein component 1.09e-11 1.92e-24 NA 0.8229
2. PF Q1IY22 Ribonuclease P protein component 3.94e-12 1.14e-03 NA 0.794
2. PF A1VZV1 Ribonuclease P protein component 1.02e-13 2.00e-36 NA 0.7806
2. PF Q9JW46 Ribonuclease P protein component 1.71e-14 3.53e-29 NA 0.8127
2. PF B0BUJ2 Ribonuclease P protein component 1.04e-11 5.94e-38 NA 0.8034
2. PF A7FPB9 Ribonuclease P protein component 5.66e-15 3.71e-34 NA 0.8324
2. PF B1X9T2 Ribonuclease P protein component 9.10e-15 2.53e-32 NA 0.8327
2. PF Q8XB43 Ribonuclease P protein component 5.55e-16 7.20e-32 NA 0.8472
2. PF Q6LW54 Ribonuclease P protein component 2.22e-16 1.22e-32 NA 0.8568
2. PF Q47K73 Ribonuclease P protein component 7.93e-12 1.69e-08 NA 0.8186
2. PF Q3M7J6 Ribonuclease P protein component 2.21e-13 1.11e-22 NA 0.8571
2. PF A8FM14 Ribonuclease P protein component 9.78e-14 2.45e-36 NA 0.7791
2. PF Q21DF8 Ribonuclease P protein component 2.02e-13 4.11e-18 NA 0.8127
2. PF C3LP79 Ribonuclease P protein component 3.33e-16 2.57e-33 NA 0.8521
2. PF A9HKS8 Ribonuclease P protein component 2.22e-16 3.34e-37 NA 0.8936
2. PF A1JT84 Ribonuclease P protein component 3.40e-12 2.03e-34 NA 0.7935
2. PF Q3AV41 Ribonuclease P protein component 1.34e-12 2.69e-27 NA 0.8003
2. PF A0LWX2 Ribonuclease P protein component 4.51e-14 1.29e-25 NA 0.8691
2. PF Q3YWB0 Ribonuclease P protein component 2.27e-13 2.53e-32 NA 0.8058
2. PF B8H8Z3 Ribonuclease P protein component 1.63e-13 1.77e-10 NA 0.8574
2. PF Q5L548 Ribonuclease P protein component 1.97e-12 2.32e-09 NA 0.8525
2. PF O84789 Ribonuclease P protein component 6.09e-13 1.31e-32 NA 0.8339
2. PF Q7X5L6 Ribonuclease P protein component 4.56e-12 1.64e-02 NA 0.7723
2. PF Q6F6K8 Ribonuclease P protein component 1.01e-12 3.15e-22 NA 0.8094
2. PF Q663S9 Ribonuclease P protein component 4.33e-15 3.71e-34 NA 0.8337
2. PF B4F0U3 Ribonuclease P protein component 2.22e-16 1.12e-32 NA 0.8493
2. PF Q2NQ69 Ribonuclease P protein component 5.55e-16 1.38e-29 NA 0.8435
2. PF B5XZP6 Ribonuclease P protein component 5.55e-16 9.88e-34 NA 0.8476
2. PF A8G7Q0 Ribonuclease P protein component 8.94e-13 2.82e-34 NA 0.8025
2. PF Q4QLR2 Ribonuclease P protein component 1.11e-16 3.96e-33 NA 0.8579
2. PF Q87TR4 Ribonuclease P protein component 1.11e-16 1.29e-34 NA 0.8619
2. PF B2RHI3 Ribonuclease P protein component 3.74e-12 1.70e-19 NA 0.8169
2. PF Q7VSD8 Ribonuclease P protein component 1.43e-10 6.66e-25 NA 0.6864
2. PF B7L844 Ribonuclease P protein component 6.67e-13 2.53e-32 NA 0.8042
2. PF Q3ZY16 Ribonuclease P protein component 1.11e-16 2.46e-17 NA 0.8251
2. PF A8LXK4 Ribonuclease P protein component 1.10e-11 8.35e-21 NA 0.8273
2. PF P45648 Ribonuclease P protein component 4.44e-16 1.56e-31 NA 0.8429
2. PF Q8YRN1 Ribonuclease P protein component 3.47e-13 1.80e-22 NA 0.8413
2. PF B2S0E4 Ribonuclease P protein component 1.47e-12 4.70e-34 NA 0.8425
2. PF Q4UML0 Ribonuclease P protein component 1.30e-11 7.05e-38 NA 0.7903
2. PF A6W3V2 Ribonuclease P protein component 4.74e-14 5.16e-20 NA 0.8416
2. PF A7H368 Ribonuclease P protein component 6.74e-14 2.45e-36 NA 0.8124
2. PF A9BBJ0 Ribonuclease P protein component 8.94e-13 2.18e-28 NA 0.8695
2. PF A7ZTR0 Ribonuclease P protein component 6.66e-15 2.53e-32 NA 0.8365
2. PF Q9Z6X2 Ribonuclease P protein component 1.56e-11 3.19e-08 NA 0.8571
2. PF C4K1K8 Ribonuclease P protein component 2.14e-11 7.93e-39 NA 0.8366
2. PF Q0I0Y9 Ribonuclease P protein component 2.78e-15 1.86e-33 NA 0.8362
2. PF Q6CYR1 Ribonuclease P protein component 9.99e-16 7.70e-35 NA 0.8379
2. PF A3PE33 Ribonuclease P protein component 1.13e-12 4.16e-32 NA 0.7427
2. PF B7LK46 Ribonuclease P protein component 1.37e-14 2.53e-32 NA 0.8289
2. PF Q9KVY2 Ribonuclease P protein component 2.22e-16 2.57e-33 NA 0.8463
2. PF A8G5Y2 Ribonuclease P protein component 5.17e-12 6.77e-33 NA 0.7295
2. PF B0VQP7 Ribonuclease P protein component 2.89e-13 1.74e-21 NA 0.8264
2. PF A1TI29 Ribonuclease P protein component 4.92e-13 1.05e-26 NA 0.8399
2. PF B7MGC5 Ribonuclease P protein component 1.81e-14 2.53e-32 NA 0.8265
2. PF B6I3T7 Ribonuclease P protein component 1.24e-14 2.53e-32 NA 0.8299
2. PF Q9PNX5 Ribonuclease P protein component 6.99e-14 2.45e-36 NA 0.7857
2. PF B5QUQ2 Ribonuclease P protein component 5.55e-16 1.62e-32 NA 0.8479
2. PF Q7MXI4 Ribonuclease P protein component 3.29e-12 8.23e-19 NA 0.8178
2. PF Q31UV7 Ribonuclease P protein component 1.38e-13 2.53e-32 NA 0.8098
2. PF A9KBT3 Ribonuclease P protein component 6.66e-16 2.69e-31 NA 0.8389
2. PF A0QND4 Ribonuclease P protein component 3.68e-13 4.44e-35 NA 0.8344
2. PF Q3Z7P1 Ribonuclease P protein component 1.11e-16 1.39e-16 NA 0.8209
2. PF B7NR06 Ribonuclease P protein component 4.35e-13 2.53e-32 NA 0.807
2. PF Q68WC8 Ribonuclease P protein component 1.34e-11 3.49e-35 NA 0.7765
2. PF A9NBA3 Ribonuclease P protein component 1.11e-16 1.56e-31 NA 0.8561
2. PF Q2KTI7 Ribonuclease P protein component 9.00e-11 3.73e-26 NA 0.732
2. PF P25817 Ribonuclease P protein component 1.18e-12 3.98e-29 NA 0.8261
2. PF Q7V612 Ribonuclease P protein component 6.74e-13 4.71e-27 NA 0.8159
2. PF B5RLZ8 Ribonuclease P protein component 1.43e-12 2.12e-32 NA 0.8427
2. PF A3NPW9 Ribonuclease P protein component 2.72e-10 7.09e-15 NA 0.6548
2. PF Q98D89 Ribonuclease P protein component 7.89e-14 3.39e-42 NA 0.8451
2. PF B8GRD3 Ribonuclease P protein component 6.35e-12 8.86e-34 NA 0.7696
2. PF Q9ZCU8 Ribonuclease P protein component 1.90e-11 1.70e-35 NA 0.8115
2. PF C3PP52 Ribonuclease P protein component 1.67e-11 2.42e-37 NA 0.8129
2. PF A5F483 Ribonuclease P protein component 3.33e-16 2.57e-33 NA 0.8516
2. PF B1AJP4 Ribonuclease P protein component 7.57e-14 1.01e-34 NA 0.8858
2. PF Q5F4W3 Ribonuclease P protein component 2.08e-14 9.58e-29 NA 0.8075
2. PF Q2VZ17 Ribonuclease P protein component 3.12e-13 2.27e-12 NA 0.8249
2. PF A0KQZ9 Ribonuclease P protein component 6.11e-15 1.55e-33 NA 0.8232
2. PF B2GJF5 Ribonuclease P protein component 6.99e-14 1.84e-32 NA 0.821
2. PF Q2JQX0 Ribonuclease P protein component 1.81e-14 1.57e-22 NA 0.863
2. PF P66686 Ribonuclease P protein component 6.66e-16 1.62e-32 NA 0.8413
2. PF Q7W2K3 Ribonuclease P protein component 1.45e-10 6.66e-25 NA 0.6578
2. PF Q2JHS3 Ribonuclease P protein component 6.13e-14 1.25e-11 NA 0.8562
2. PF Q2NX51 Ribonuclease P protein component 1.04e-13 2.14e-10 NA 0.8559
2. PF A0PX70 Ribonuclease P protein component 5.18e-13 6.10e-23 NA 0.8484
2. PF Q5YMR7 Ribonuclease P protein component 1.78e-11 3.70e-17 NA 0.858
2. PF P0A7Y9 Ribonuclease P protein component 1.14e-14 2.53e-32 NA 0.8308
2. PF B5RFY5 Ribonuclease P protein component 8.88e-16 1.62e-32 NA 0.8459
2. PF Q8NL51 Ribonuclease P protein component 1.18e-12 1.95e-26 NA 0.8107
2. PF P57130 Ribonuclease P protein component 7.77e-16 1.98e-29 NA 0.8528
2. PF B5EYX4 Ribonuclease P protein component 7.77e-16 1.62e-32 NA 0.8395
2. PF P44306 Ribonuclease P protein component 1.11e-16 3.62e-33 NA 0.861
2. PF B2J0Q5 Ribonuclease P protein component 4.85e-13 9.30e-22 NA 0.871
2. PF Q7X5L0 Ribonuclease P protein component 6.24e-12 2.67e-03 NA 0.7687
2. PF Q1C0B6 Ribonuclease P protein component 5.46e-12 3.71e-34 NA 0.7903
2. PF Q9PPN6 Ribonuclease P protein component 7.03e-14 1.01e-34 NA 0.8874
2. PF Q5HUJ9 Ribonuclease P protein component 6.83e-14 1.06e-36 NA 0.7876
2. PF P59413 Ribonuclease P protein component 2.22e-16 1.06e-32 NA 0.8601
2. PF A1QZM7 Ribonuclease P protein component 5.03e-13 1.08e-33 NA 0.8484
2. PF Q661I0 Ribonuclease P protein component 4.58e-12 1.17e-34 NA 0.8119
2. PF B5RRP4 Ribonuclease P protein component 4.04e-13 2.12e-32 NA 0.8453
2. PF A2C405 Ribonuclease P protein component 1.36e-12 1.86e-25 NA 0.8435
2. PF A7MN01 Ribonuclease P protein component 1.11e-15 1.37e-33 NA 0.837
2. PF Q7TVA1 Ribonuclease P protein component 6.95e-12 2.74e-29 NA 0.8242
2. PF A3MS22 Ribonuclease P protein component 2.90e-10 9.53e-15 NA 0.6525
2. PF C3PL13 Ribonuclease P protein component 1.71e-13 6.95e-32 NA 0.8501
2. PF Q8FBV5 Ribonuclease P protein component 2.90e-14 1.08e-31 NA 0.8271
2. PF Q0SAG9 Ribonuclease P protein component 9.29e-14 1.59e-27 NA 0.8403
2. PF Q7WDJ7 Ribonuclease P protein component 1.40e-10 6.66e-25 NA 0.6775
2. PF A5GN10 Ribonuclease P protein component 1.96e-11 7.45e-25 NA 0.8022
2. PF A3N475 Ribonuclease P protein component 3.59e-10 9.53e-15 NA 0.6591
2. PF B4TN09 Ribonuclease P protein component 6.66e-16 1.62e-32 NA 0.8394
2. PF B1VPE8 Ribonuclease P protein component 2.24e-12 6.36e-26 NA 0.8296
2. PF A1AHN8 Ribonuclease P protein component 7.57e-13 2.53e-32 NA 0.802
2. PF B0B910 Ribonuclease P protein component 4.72e-13 1.94e-32 NA 0.8533
2. PF Q329B4 Ribonuclease P protein component 1.03e-14 2.53e-32 NA 0.8307
2. PF Q4UNK7 Ribonuclease P protein component 7.18e-14 7.26e-09 NA 0.8626
2. PF B1LL31 Ribonuclease P protein component 1.41e-14 2.53e-32 NA 0.8271
2. PF Q3BLZ6 Ribonuclease P protein component 6.06e-14 8.89e-10 NA 0.8673
2. PF Q82X99 Ribonuclease P protein component 6.69e-14 5.72e-32 NA 0.8312
2. PF A7NJ53 Ribonuclease P protein component 6.66e-16 5.98e-18 NA 0.8823
2. PF Q319V1 Ribonuclease P protein component 1.82e-11 1.92e-30 NA 0.7249
2. PF Q0VKU6 Ribonuclease P protein component 2.25e-11 2.82e-34 NA 0.78
2. PF Q0AE58 Ribonuclease P protein component 4.17e-13 1.51e-28 NA 0.8311
2. PF A5V0B3 Ribonuclease P protein component 4.44e-16 3.09e-16 NA 0.8231
2. PF B2TUS4 Ribonuclease P protein component 1.08e-14 2.53e-32 NA 0.8312
2. PF B5ZCB8 Ribonuclease P protein component 2.45e-13 1.15e-21 NA 0.8552
2. PF B5FN12 Ribonuclease P protein component 7.77e-16 1.62e-32 NA 0.8391
2. PF Q602M8 Ribonuclease P protein component 4.60e-13 9.99e-27 NA 0.8388
2. PF A1T0M7 Ribonuclease P protein component 2.66e-15 1.32e-33 NA 0.7961
2. PF Q55005 Ribonuclease P protein component 0.00e+00 1.55e-22 NA 0.9021
2. PF Q63YW3 Ribonuclease P protein component 2.60e-10 7.09e-15 NA 0.6701
2. PF B2HNT8 Ribonuclease P protein component 6.19e-13 6.10e-23 NA 0.8476
2. PF A8L8W2 Ribonuclease P protein component 2.60e-14 2.67e-22 NA 0.8654
2. PF B5Y9B9 Ribonuclease P protein component 2.51e-13 8.32e-18 NA 0.8028
2. PF B0V5R2 Ribonuclease P protein component 3.24e-13 4.70e-21 NA 0.8278
2. PF Q8Z9U4 Ribonuclease P protein component 8.33e-15 3.71e-34 NA 0.8314
2. PF Q6NE96 Ribonuclease P protein component 9.46e-13 5.24e-32 NA 0.8478
2. PF Q13SH2 Ribonuclease P protein component 4.39e-10 7.18e-12 NA 0.7083
2. PF C4ZYY1 Ribonuclease P protein component 7.30e-13 2.53e-32 NA 0.8031
2. PF Q9JXS6 Ribonuclease P protein component 1.31e-12 4.47e-30 NA 0.7653
4. PB Q2FUQ1 Ribonuclease P protein component 1.11e-16 5.52e-45 7.72e-13 NA
4. PB P9WGZ3 Ribonuclease P protein component 4.02e-14 6.75e-30 0.011 NA
5. P A3CQ17 Ribosome-binding factor A 2.14e-02 3.78e-02 NA NA
5. P B5ZBD0 Ribosome-binding factor A 1.22e-01 2.11e-02 NA NA
5. P Q8EWT9 Ribosome-binding factor A 9.22e-02 2.39e-02 NA NA
5. P Q98PP7 Ribosome-binding factor A 3.58e-02 3.21e-02 NA NA
5. P Q49X58 Ribosome-binding factor A 3.75e-02 2.37e-02 NA NA
5. P P0A7Y8 Ribonuclease P protein component 1.14e-14 2.53e-32 NA NA
5. P Q8KGG4 Ribonuclease P protein component 8.06e-11 7.58e-17 NA NA
5. P A5IZH0 Ribosome-binding factor A 5.69e-02 4.84e-02 NA NA
6. F Q7X5K6 Ribonuclease P protein component 6.04e-12 NA NA 0.7566
6. F Q7X5L2 Ribonuclease P protein component 1.87e-10 NA NA 0.7912
6. F Q72LI2 Ribonuclease P protein component 5.28e-12 NA NA 0.7564
6. F Q7X5K8 Ribonuclease P protein component 3.40e-12 NA NA 0.8037
6. F Q9RSH3 Ribonuclease P protein component 1.01e-10 NA NA 0.7849