Summary
The literature section presents previous knowledge about this protein. There have been five different efforts to annotate minimal organism genome. The annotations from those efforts are given in the Literature section for completeness.
AVX55022.1
JCVISYN3A_0909
Ribonuclease P protein component.
M. mycoides homolog: Q6MRS3.
TIGRfam Classification: 5=Equivalog.
Category: Essential.
Statistics
Total GO Annotation: 12
Unique PROST Go: 2
Unique BLAST Go: 1
Unique Foldseek Go: 0
Total Homologs: 513
Unique PROST Homologs: 8
Unique BLAST Homologs: 0
Unique Foldseek Homologs: 5
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PBF was
Q88RX0
(Ribonuclease P protein component) with a FATCAT P-Value: 0 and RMSD of 1.48 angstrom. The sequence alignment identity is 40.5%.
Structural alignment shown in left. Query protein AVX55022.1 colored as red in alignment, homolog Q88RX0 colored as blue.
Query protein AVX55022.1 is also shown in right top, homolog Q88RX0 showed in right bottom. They are colored based on secondary structures.
AVX55022.1 M-KNKRVIKKNFEFQEIINYKKTVKNFCFVIYYKDN-DQSYLKYGISVGKKIGNAVVRNKVKRQIRMILRQNINEI-GSISK--DVIILVR-----KSVL 90 Q88RX0 MRKSYRV-KKETEFQQVFETRNSYANRQFVIYVLEKPGQPHFRVGISVGKKIGNAVARNWVKR--R--IRQSITELKPQLKQDADFLVIARPTVAGKSQA 95 AVX55022.1 ELKYATLSKSLIKLIKEIK-- 109 Q88RX0 ETK-AYLSHAL-KLAHLLDND 114
Go Annotations
1. PBF indicates the go terms that are found by both PROST and BLAST and Foldseek.
2. PF indicates the go terms that are found by only PROST and Foldseek.
3. BF indicates the go terms that are found by only BLAST and Foldseek.
4. PB indicates the go terms that are found by both PROST and BLAST.
5. P indicates the go terms that are found by only PROST.
6. F indicates the go terms that are found by only Foldseek.
7. B indicates the go terms that are found by only BLAST.
Source | GO | Description |
---|---|---|
1. PBF | GO:0042781 | 3'-tRNA processing endoribonuclease activity |
1. PBF | GO:0000049 | tRNA binding |
1. PBF | GO:0030677 | ribonuclease P complex |
1. PBF | GO:0033204 | ribonuclease P RNA binding |
1. PBF | GO:0004526 | ribonuclease P activity |
1. PBF | GO:0043199 | sulfate binding |
1. PBF | GO:0034414 | tRNA 3'-trailer cleavage, endonucleolytic |
1. PBF | GO:0001682 | tRNA 5'-leader removal |
1. PBF | GO:0043168 | anion binding |
5. P | GO:0005737 | cytoplasm |
5. P | GO:0030490 | maturation of SSU-rRNA |
7. B | GO:0031404 | chloride ion binding |
Uniprot GO Annotations
GO | Description |
---|---|
GO:0008033 | tRNA processing |
GO:0003723 | RNA binding |
GO:0090305 | nucleic acid phosphodiester bond hydrolysis |
GO:0000049 | tRNA binding |
GO:0004518 | nuclease activity |
GO:0090501 | RNA phosphodiester bond hydrolysis |
GO:0004519 | endonuclease activity |
GO:0016787 | hydrolase activity |
GO:0090502 | RNA phosphodiester bond hydrolysis, endonucleolytic |
GO:0001682 | tRNA 5'-leader removal |
GO:0004526 | ribonuclease P activity |
Homologs
1. PBF indicates the homologs that are found by both PROST and BLAST and Foldseek.
2. PF indicates the homologs that are found by only PROST and Foldseek.
3. BF indicates the homologs that are found by only BLAST and Foldseek.
4. PB indicates the homologs that are found by both PROST and BLAST.
5. P indicates the homologs that are found by only PROST.
6. F indicates the homologs that are found by only Foldseek.
7. B indicates the homologs that are found by only BLAST.
Source | Homolog | Description | Fatcat Pvalue | PROST Evalue | BLAST Evalue | Foldseek TMScore |
---|---|---|---|---|---|---|
1. PBF | P0A167 | Ribonuclease P protein component | 1.55e-13 | 6.12e-14 | 0.012 | 0.8349 |
1. PBF | B9E8Z6 | Ribonuclease P protein component | 0.00e+00 | 1.33e-45 | 2.40e-14 | 0.8874 |
1. PBF | Q03UI9 | Ribonuclease P protein component | 1.11e-16 | 8.21e-38 | 5.87e-09 | 0.8868 |
1. PBF | B4SPG1 | Ribonuclease P protein component | 4.84e-14 | 1.57e-05 | 0.006 | 0.8665 |
1. PBF | Q3K2X6 | Ribonuclease P protein component | 0.00e+00 | 1.70e-45 | 2.14e-18 | 0.904 |
1. PBF | B8DV04 | Ribonuclease P protein component | 5.66e-15 | 8.00e-32 | 2.23e-05 | 0.8642 |
1. PBF | Q6KH14 | Ribonuclease P protein component | 0.00e+00 | 7.82e-29 | 2.89e-12 | 0.899 |
1. PBF | Q8CMN4 | Ribonuclease P protein component | 1.11e-16 | 7.21e-43 | 2.70e-15 | 0.8902 |
1. PBF | Q8DDI3 | Ribonuclease P protein component | 1.11e-16 | 2.19e-34 | 6.72e-04 | 0.8614 |
1. PBF | Q8EKT4 | Ribonuclease P protein component | 1.11e-16 | 2.39e-33 | 7.47e-05 | 0.868 |
1. PBF | C1CMY8 | Ribonuclease P protein component | 0.00e+00 | 6.32e-20 | 1.79e-15 | 0.914 |
1. PBF | B3DP24 | Ribonuclease P protein component | 5.63e-14 | 1.03e-30 | 1.70e-04 | 0.8569 |
1. PBF | Q6MRS3 | Ribonuclease P protein component | 0.00e+00 | 4.95e-82 | 2.35e-68 | 0.9989 |
1. PBF | C0MFG8 | Ribonuclease P protein component | 0.00e+00 | 1.86e-24 | 6.90e-16 | 0.9048 |
1. PBF | B2TRI3 | Ribonuclease P protein component | 2.22e-16 | 8.77e-27 | 3.02e-07 | 0.8611 |
1. PBF | Q7VJX7 | Ribonuclease P protein component | 1.67e-12 | 9.50e-23 | 2.31e-05 | 0.7443 |
1. PBF | P0A0H5 | Ribonuclease P protein component | 1.11e-16 | 5.52e-45 | 7.72e-13 | 0.8833 |
1. PBF | B2UVJ3 | Ribonuclease P protein component | 2.34e-11 | 4.12e-19 | 2.76e-04 | 0.8294 |
1. PBF | Q4A913 | Ribonuclease P protein component | 1.11e-16 | 2.44e-33 | 9.76e-12 | 0.8964 |
1. PBF | Q1QS97 | Ribonuclease P protein component | 3.06e-13 | 1.49e-24 | 0.005 | 0.8054 |
1. PBF | Q5HCI2 | Ribonuclease P protein component | 1.11e-16 | 5.30e-45 | 6.34e-13 | 0.8914 |
1. PBF | Q7UNR1 | Ribonuclease P protein component | 1.08e-10 | 2.92e-25 | 1.02e-05 | 0.7759 |
1. PBF | Q3IK52 | Ribonuclease P protein component | 1.12e-14 | 3.58e-06 | 4.14e-07 | 0.8475 |
1. PBF | C3KWJ9 | Ribonuclease P protein component | 0.00e+00 | 2.35e-39 | 9.62e-10 | 0.9177 |
1. PBF | P43039 | Ribonuclease P protein component | 0.00e+00 | 8.13e-80 | 4.66e-65 | 0.9984 |
1. PBF | Q8DVX4 | Ribonuclease P protein component | 0.00e+00 | 2.00e-27 | 1.03e-20 | 0.9091 |
1. PBF | Q630B5 | Ribonuclease P protein component | 0.00e+00 | 6.72e-36 | 4.47e-20 | 0.8995 |
1. PBF | A1KCQ1 | Ribonuclease P protein component | 4.44e-16 | 1.79e-28 | 2.44e-06 | 0.8677 |
1. PBF | B0JN62 | Ribonuclease P protein component | 1.55e-15 | 2.00e-33 | 2.00e-06 | 0.8812 |
1. PBF | Q5KU54 | Ribonuclease P protein component | 0.00e+00 | 7.27e-28 | 3.15e-20 | 0.905 |
1. PBF | A6M3M9 | Ribonuclease P protein component | 7.77e-16 | 1.95e-26 | 4.97e-08 | 0.857 |
1. PBF | Q9ZJH0 | Ribonuclease P protein component | 5.50e-11 | 4.00e-19 | 1.64e-04 | 0.8254 |
1. PBF | Q02DD9 | Ribonuclease P protein component | 1.21e-12 | 8.49e-15 | 8.53e-04 | 0.8149 |
1. PBF | B1VAN7 | Ribonuclease P protein component | 0.00e+00 | 1.63e-37 | 4.08e-10 | 0.8925 |
1. PBF | Q6GD91 | Ribonuclease P protein component | 1.11e-16 | 5.30e-45 | 6.34e-13 | 0.8917 |
1. PBF | A5IMC2 | Ribonuclease P protein component | 0.00e+00 | 2.17e-40 | 3.06e-07 | 0.8993 |
1. PBF | Q8RHA6 | Ribonuclease P protein component | 2.11e-15 | 1.46e-34 | 1.49e-09 | 0.855 |
1. PBF | A4VS84 | Ribonuclease P protein component | 1.09e-13 | 1.06e-16 | 8.75e-07 | 0.8346 |
1. PBF | C3P3F8 | Ribonuclease P protein component | 0.00e+00 | 6.72e-36 | 4.47e-20 | 0.8973 |
1. PBF | C0ZVP7 | Ribonuclease P protein component | 1.38e-13 | 6.09e-30 | 0.007 | 0.8428 |
1. PBF | A6U596 | Ribonuclease P protein component | 1.11e-16 | 5.52e-45 | 7.72e-13 | 0.8839 |
1. PBF | Q07VS4 | Ribonuclease P protein component | 1.11e-16 | 3.43e-33 | 7.17e-05 | 0.863 |
1. PBF | B9IT45 | Ribonuclease P protein component | 0.00e+00 | 6.87e-44 | 3.61e-20 | 0.898 |
1. PBF | Q8EKU0 | Ribonuclease P protein component | 0.00e+00 | 1.21e-28 | 1.92e-14 | 0.9049 |
1. PBF | B7J207 | Ribonuclease P protein component | 9.36e-12 | 2.39e-29 | 0.012 | 0.8215 |
1. PBF | B8ZTN6 | Ribonuclease P protein component | 4.20e-13 | 1.04e-32 | 0.016 | 0.8345 |
1. PBF | B2V1V3 | Ribonuclease P protein component | 4.44e-16 | 1.75e-27 | 3.98e-07 | 0.8593 |
1. PBF | B3WBV6 | Ribonuclease P protein component | 0.00e+00 | 7.96e-33 | 1.33e-16 | 0.9035 |
1. PBF | Q88RX0 | Ribonuclease P protein component | 0.00e+00 | 3.14e-47 | 3.67e-12 | 0.862 |
1. PBF | B1YGB0 | Ribonuclease P protein component | 0.00e+00 | 1.02e-39 | 9.29e-12 | 0.8833 |
1. PBF | Q3AG60 | Ribonuclease P protein component | 4.13e-14 | 3.04e-38 | 0.023 | 0.8356 |
1. PBF | Q9AA39 | Ribonuclease P protein component | 3.85e-13 | 1.98e-06 | 0.008 | 0.8062 |
1. PBF | Q0TLZ0 | Ribonuclease P protein component | 5.11e-15 | 6.57e-26 | 3.74e-04 | 0.832 |
1. PBF | Q5XDZ0 | Ribonuclease P protein component | 0.00e+00 | 1.33e-23 | 5.18e-17 | 0.905 |
1. PBF | B5YBN8 | Ribonuclease P protein component | 6.53e-13 | 8.37e-40 | 0.003 | 0.8266 |
1. PBF | Q4L2Z1 | Ribonuclease P protein component | 0.00e+00 | 1.14e-40 | 2.47e-14 | 0.8915 |
1. PBF | B7HZH3 | Ribonuclease P protein component | 0.00e+00 | 5.52e-45 | 9.16e-21 | 0.9001 |
1. PBF | A0AMG4 | Ribonuclease P protein component | 1.11e-16 | 9.94e-31 | 4.58e-14 | 0.8814 |
1. PBF | P75111 | Ribonuclease P protein component | 0.00e+00 | 3.12e-27 | 0.031 | 0.8772 |
1. PBF | Q82YV0 | Ribonuclease P protein component | 0.00e+00 | 6.18e-35 | 7.36e-14 | 0.8972 |
1. PBF | Q8E6W5 | Ribonuclease P protein component | 0.00e+00 | 2.51e-46 | 2.60e-18 | 0.9047 |
1. PBF | A2RHL3 | Ribonuclease P protein component | 0.00e+00 | 7.32e-38 | 2.45e-11 | 0.9188 |
1. PBF | Q92SF4 | Ribonuclease P protein component | 2.18e-12 | 1.33e-23 | 8.35e-05 | 0.7752 |
1. PBF | Q5QZK1 | Ribonuclease P protein component | 3.66e-15 | 4.87e-28 | 0.004 | 0.8134 |
1. PBF | Q48VE1 | Ribonuclease P protein component | 0.00e+00 | 1.33e-23 | 5.18e-17 | 0.9051 |
1. PBF | A1S1G7 | Ribonuclease P protein component | 4.44e-16 | 1.11e-34 | 5.95e-07 | 0.846 |
1. PBF | P9WGZ2 | Ribonuclease P protein component | 2.60e-14 | 6.75e-30 | 0.011 | 0.8562 |
1. PBF | Q5LW06 | Ribonuclease P protein component | 1.51e-12 | 2.16e-29 | 2.20e-04 | 0.8216 |
1. PBF | C1CTU8 | Ribonuclease P protein component | 0.00e+00 | 6.32e-20 | 1.79e-15 | 0.9167 |
1. PBF | Q5FHQ3 | Ribonuclease P protein component | 1.11e-16 | 1.64e-20 | 7.58e-07 | 0.8752 |
1. PBF | C3LGU4 | Ribonuclease P protein component | 0.00e+00 | 6.72e-36 | 4.47e-20 | 0.8992 |
1. PBF | Q6YQX5 | Ribonuclease P protein component | 2.44e-15 | 1.21e-14 | 9.95e-08 | 0.845 |
1. PBF | A9BJC4 | Ribonuclease P protein component | 1.33e-15 | 1.51e-32 | 8.47e-06 | 0.8724 |
1. PBF | Q74H92 | Ribonuclease P protein component | 0.00e+00 | 1.17e-20 | 4.27e-08 | 0.8887 |
1. PBF | B1KQ67 | Ribonuclease P protein component | 2.22e-16 | 1.67e-35 | 1.28e-04 | 0.8619 |
1. PBF | Q879S2 | Ribonuclease P protein component | 1.93e-14 | 1.66e-13 | 0.018 | 0.8792 |
1. PBF | B1IHS3 | Ribonuclease P protein component | 0.00e+00 | 2.69e-40 | 6.20e-10 | 0.9157 |
1. PBF | Q87TR9 | Ribonuclease P protein component | 1.32e-13 | 3.43e-13 | 0.004 | 0.8383 |
1. PBF | Q6G5W3 | Ribonuclease P protein component | 1.11e-16 | 5.30e-45 | 6.34e-13 | 0.8882 |
1. PBF | Q1B0S2 | Ribonuclease P protein component | 2.17e-13 | 1.22e-21 | 8.72e-04 | 0.8602 |
1. PBF | Q1JDN4 | Ribonuclease P protein component | 0.00e+00 | 1.09e-23 | 1.71e-15 | 0.9058 |
1. PBF | Q17ZA3 | Ribonuclease P protein component | 3.77e-11 | 1.96e-21 | 1.89e-05 | 0.8238 |
1. PBF | Q047F7 | Ribonuclease P protein component | 1.11e-16 | 3.85e-23 | 1.38e-10 | 0.8742 |
1. PBF | Q12HM6 | Ribonuclease P protein component | 0.00e+00 | 2.62e-33 | 5.75e-05 | 0.8697 |
1. PBF | A1RQF1 | Ribonuclease P protein component | 0.00e+00 | 2.81e-33 | 1.39e-04 | 0.8712 |
1. PBF | C0ZA70 | Ribonuclease P protein component | 1.78e-15 | 3.54e-15 | 1.06e-14 | 0.8873 |
1. PBF | Q5P4P2 | Ribonuclease P protein component | 3.44e-14 | 9.91e-29 | 0.043 | 0.831 |
1. PBF | B8J2U6 | Ribonuclease P protein component | 1.26e-13 | 3.26e-25 | 3.01e-06 | 0.8619 |
1. PBF | Q1JNK3 | Ribonuclease P protein component | 0.00e+00 | 1.09e-23 | 1.71e-15 | 0.9055 |
1. PBF | Q2FDE7 | Ribonuclease P protein component | 1.11e-16 | 5.52e-45 | 7.72e-13 | 0.883 |
1. PBF | Q1MM57 | Ribonuclease P protein component | 1.25e-12 | 1.86e-22 | 1.62e-04 | 0.7793 |
1. PBF | P66689 | Ribonuclease P protein component | 1.11e-16 | 5.30e-45 | 6.34e-13 | 0.8892 |
1. PBF | Q82FE0 | Ribonuclease P protein component | 7.70e-13 | 2.58e-28 | 0.002 | 0.8238 |
1. PBF | Q8E1E7 | Ribonuclease P protein component | 0.00e+00 | 1.70e-45 | 2.14e-18 | 0.9047 |
1. PBF | Q6F0D5 | Ribonuclease P protein component | 0.00e+00 | 1.40e-55 | 2.60e-25 | 0.9445 |
1. PBF | B5XJN7 | Ribonuclease P protein component | 0.00e+00 | 1.33e-23 | 5.18e-17 | 0.9061 |
1. PBF | B0K5N8 | Ribonuclease P protein component | 1.11e-16 | 3.48e-38 | 4.42e-12 | 0.9122 |
1. PBF | Q8R6K4 | Ribonuclease P protein component | 1.11e-16 | 7.93e-39 | 1.86e-10 | 0.8977 |
1. PBF | Q0SPP9 | Ribonuclease P protein component | 4.88e-15 | 6.57e-26 | 3.74e-04 | 0.8324 |
1. PBF | Q38UE4 | Ribonuclease P protein component | 0.00e+00 | 9.19e-30 | 6.66e-13 | 0.8957 |
1. PBF | Q1WRF9 | Ribonuclease P protein component | 0.00e+00 | 3.04e-49 | 2.08e-13 | 0.8973 |
1. PBF | P0A0H4 | Ribonuclease P protein component | 1.11e-16 | 5.52e-45 | 7.72e-13 | 0.8822 |
1. PBF | C1ER80 | Ribonuclease P protein component | 0.00e+00 | 2.74e-45 | 9.26e-21 | 0.899 |
1. PBF | Q98R57 | Ribonuclease P protein component | 0.00e+00 | 1.04e-31 | 2.25e-12 | 0.8984 |
1. PBF | C5C6N8 | Ribonuclease P protein component | 3.55e-14 | 2.23e-29 | 5.48e-04 | 0.8767 |
1. PBF | A6VF46 | Ribonuclease P protein component | 2.45e-13 | 4.35e-15 | 0.001 | 0.8165 |
1. PBF | B7K5U5 | Ribonuclease P protein component | 2.79e-14 | 1.42e-24 | 0.002 | 0.8756 |
1. PBF | C4KZZ5 | Ribonuclease P protein component | 0.00e+00 | 1.30e-36 | 1.08e-15 | 0.9089 |
1. PBF | A4Y1A2 | Ribonuclease P protein component | 3.10e-13 | 1.50e-15 | 1.24e-05 | 0.8239 |
1. PBF | P25814 | Ribonuclease P protein component | 1.11e-16 | 3.32e-39 | 3.74e-15 | 0.8787 |
1. PBF | B8HR50 | Ribonuclease P protein component | 5.00e-15 | 1.34e-28 | 1.02e-05 | 0.8692 |
1. PBF | B7GMW3 | Ribonuclease P protein component | 0.00e+00 | 8.27e-47 | 5.17e-19 | 0.8877 |
1. PBF | A5VMV1 | Ribonuclease P protein component | 0.00e+00 | 1.18e-37 | 4.85e-13 | 0.9004 |
1. PBF | C1L0I8 | Ribonuclease P protein component | 1.11e-16 | 1.08e-30 | 6.98e-14 | 0.882 |
1. PBF | P55997 | Ribonuclease P protein component | 2.27e-11 | 5.70e-19 | 1.51e-04 | 0.8262 |
1. PBF | Q8UIB2 | Ribonuclease P protein component | 2.07e-12 | 1.43e-21 | 4.40e-04 | 0.7761 |
1. PBF | P46610 | Ribonuclease P protein component | 4.37e-13 | 1.04e-32 | 0.016 | 0.8346 |
1. PBF | Q03D57 | Ribonuclease P protein component | 0.00e+00 | 5.84e-34 | 5.99e-12 | 0.8982 |
1. PBF | A7GJP3 | Ribonuclease P protein component | 0.00e+00 | 2.69e-40 | 6.20e-10 | 0.916 |
1. PBF | A5I820 | Ribonuclease P protein component | 0.00e+00 | 2.69e-40 | 6.20e-10 | 0.9153 |
1. PBF | C6C0J4 | Ribonuclease P protein component | 6.79e-14 | 7.61e-38 | 5.14e-06 | 0.8578 |
1. PBF | Q03IQ0 | Ribonuclease P protein component | 0.00e+00 | 3.63e-43 | 2.21e-13 | 0.9154 |
1. PBF | Q8XH26 | Ribonuclease P protein component | 4.77e-15 | 6.57e-26 | 3.74e-04 | 0.8326 |
1. PBF | P66688 | Ribonuclease P protein component | 1.11e-16 | 5.30e-45 | 6.34e-13 | 0.8916 |
1. PBF | B2A474 | Ribonuclease P protein component | 2.22e-16 | 1.62e-40 | 1.40e-11 | 0.8729 |
1. PBF | A7FPL5 | Ribonuclease P protein component | 0.00e+00 | 2.69e-40 | 6.20e-10 | 0.9164 |
1. PBF | C1DNF9 | Ribonuclease P protein component | 1.15e-13 | 1.20e-20 | 0.042 | 0.8266 |
1. PBF | B0KEU7 | Ribonuclease P protein component | 2.66e-13 | 9.65e-15 | 0.003 | 0.8252 |
1. PBF | Q6HAE9 | Ribonuclease P protein component | 0.00e+00 | 6.72e-36 | 4.47e-20 | 0.8995 |
1. PBF | C1CA87 | Ribonuclease P protein component | 0.00e+00 | 6.32e-20 | 1.79e-15 | 0.9169 |
1. PBF | Q2YZB7 | Ribonuclease P protein component | 2.22e-16 | 1.93e-44 | 6.29e-13 | 0.8813 |
1. PBF | Q5WSE7 | Ribonuclease P protein component | 4.22e-15 | 4.54e-38 | 1.33e-04 | 0.8374 |
1. PBF | Q2N7X0 | Ribonuclease P protein component | 9.48e-14 | 1.72e-22 | 1.03e-10 | 0.8726 |
1. PBF | A4ITX4 | Ribonuclease P protein component | 0.00e+00 | 7.39e-28 | 5.01e-18 | 0.9027 |
1. PBF | Q2LSG2 | Ribonuclease P protein component | 1.21e-12 | 1.22e-37 | 6.60e-10 | 0.8867 |
1. PBF | B8H1E9 | Ribonuclease P protein component | 3.33e-13 | 1.98e-06 | 0.008 | 0.804 |
1. PBF | C1CGX2 | Ribonuclease P protein component | 0.00e+00 | 6.32e-20 | 1.79e-15 | 0.8946 |
1. PBF | B2U822 | Ribonuclease P protein component | 6.80e-10 | 2.54e-11 | 5.52e-04 | 0.6849 |
1. PBF | Q1J8K9 | Ribonuclease P protein component | 0.00e+00 | 1.33e-23 | 5.18e-17 | 0.9056 |
1. PBF | Q4A750 | Ribonuclease P protein component | 0.00e+00 | 2.44e-33 | 9.76e-12 | 0.8963 |
1. PBF | Q67J29 | Ribonuclease P protein component | 1.55e-15 | 1.30e-37 | 4.04e-06 | 0.8622 |
1. PBF | A8AUN9 | Ribonuclease P protein component | 0.00e+00 | 8.21e-24 | 3.16e-19 | 0.9113 |
1. PBF | A6Q3D2 | Ribonuclease P protein component | 1.38e-13 | 1.38e-34 | 0.027 | 0.8191 |
1. PBF | B4U0S7 | Ribonuclease P protein component | 0.00e+00 | 1.86e-24 | 6.90e-16 | 0.9044 |
1. PBF | B8DCV5 | Ribonuclease P protein component | 2.22e-16 | 4.17e-30 | 3.90e-14 | 0.8806 |
1. PBF | A9AXK0 | Ribonuclease P protein component | 1.11e-16 | 2.75e-12 | 4.81e-04 | 0.902 |
1. PBF | Q1I2H2 | Ribonuclease P protein component | 2.46e-13 | 2.16e-15 | 0.011 | 0.8262 |
1. PBF | C6DYS3 | Ribonuclease P protein component | 0.00e+00 | 6.92e-43 | 2.66e-05 | 0.9024 |
1. PBF | A4YCM4 | Ribonuclease P protein component | 0.00e+00 | 2.81e-33 | 1.39e-04 | 0.8763 |
1. PBF | Q181T2 | Ribonuclease P protein component | 6.55e-15 | 5.76e-45 | 2.78e-11 | 0.8492 |
1. PBF | B8FMU9 | Ribonuclease P protein component | 2.40e-13 | 2.13e-39 | 4.26e-06 | 0.847 |
1. PBF | A9VTM3 | Ribonuclease P protein component | 0.00e+00 | 2.57e-43 | 2.12e-19 | 0.8998 |
1. PBF | A5N455 | Ribonuclease P protein component | 1.67e-15 | 1.24e-42 | 3.74e-07 | 0.9065 |
1. PBF | Q30YQ3 | Ribonuclease P protein component | 6.39e-14 | 6.66e-25 | 1.32e-04 | 0.8746 |
1. PBF | B7GPF7 | Ribonuclease P protein component | 6.49e-14 | 3.70e-30 | 0.002 | 0.8556 |
1. PBF | P0A168 | Ribonuclease P protein component | 1.38e-13 | 6.12e-14 | 0.012 | 0.8364 |
1. PBF | A9KLY3 | Ribonuclease P protein component | 7.77e-15 | 1.04e-28 | 5.70e-08 | 0.893 |
1. PBF | Q6G2G7 | Ribonuclease P protein component | 2.27e-12 | 1.84e-20 | 7.82e-04 | 0.7693 |
1. PBF | Q5M2K4 | Ribonuclease P protein component | 0.00e+00 | 1.10e-43 | 3.67e-13 | 0.9118 |
1. PBF | A6WUK6 | Ribonuclease P protein component | 0.00e+00 | 1.14e-32 | 1.08e-04 | 0.8812 |
1. PBF | P48206 | Ribonuclease P protein component | 5.06e-13 | 3.56e-27 | 0.003 | 0.8435 |
1. PBF | O86449 | Ribonuclease P protein component | 3.72e-13 | 4.62e-39 | 0.008 | 0.87 |
1. PBF | Q0HPE4 | Ribonuclease P protein component | 0.00e+00 | 3.37e-33 | 9.92e-05 | 0.872 |
1. PBF | Q5HS37 | Ribonuclease P protein component | 1.11e-16 | 7.21e-43 | 2.70e-15 | 0.8909 |
1. PBF | Q6FZ17 | Ribonuclease P protein component | 3.78e-12 | 1.17e-20 | 0.006 | 0.8042 |
1. PBF | B0S3V6 | Ribonuclease P protein component | 0.00e+00 | 5.66e-33 | 5.76e-09 | 0.8991 |
1. PBF | Q9CJ73 | Ribonuclease P protein component | 0.00e+00 | 2.74e-36 | 5.85e-11 | 0.9171 |
1. PBF | B1LBK1 | Ribonuclease P protein component | 0.00e+00 | 4.36e-39 | 6.61e-08 | 0.895 |
1. PBF | Q8EU90 | Ribonuclease P protein component | 1.11e-16 | 9.74e-38 | 2.62e-06 | 0.911 |
1. PBF | C1FP35 | Ribonuclease P protein component | 0.00e+00 | 2.69e-40 | 6.20e-10 | 0.9146 |
1. PBF | A8MKS3 | Ribonuclease P protein component | 0.00e+00 | 8.54e-40 | 8.86e-08 | 0.892 |
1. PBF | A3Q8S4 | Ribonuclease P protein component | 2.36e-13 | 1.22e-21 | 8.72e-04 | 0.8595 |
1. PBF | A5WBB9 | Ribonuclease P protein component | 1.70e-13 | 3.27e-15 | 0.012 | 0.833 |
1. PBF | Q926Q4 | Ribonuclease P protein component | 1.11e-16 | 1.92e-30 | 6.27e-15 | 0.8823 |
1. PBF | Q8Y3I1 | Ribonuclease P protein component | 2.22e-16 | 1.08e-30 | 6.98e-14 | 0.8794 |
1. PBF | Q04ID0 | Ribonuclease P protein component | 0.00e+00 | 6.32e-20 | 1.79e-15 | 0.9158 |
1. PBF | C0RMG2 | Ribonuclease P protein component | 4.48e-12 | 1.42e-15 | 4.62e-05 | 0.7773 |
1. PBF | Q5E8Z7 | Ribonuclease P protein component | 1.33e-15 | 8.55e-34 | 8.00e-05 | 0.8508 |
1. PBF | A7ZAW4 | Ribonuclease P protein component | 2.22e-16 | 1.51e-37 | 1.89e-15 | 0.8762 |
1. PBF | B8ZPA3 | Ribonuclease P protein component | 0.00e+00 | 6.32e-20 | 1.79e-15 | 0.9172 |
1. PBF | B1KUB6 | Ribonuclease P protein component | 0.00e+00 | 4.41e-41 | 5.24e-09 | 0.9205 |
1. PBF | A4J9S4 | Ribonuclease P protein component | 2.16e-14 | 7.30e-40 | 5.25e-06 | 0.8514 |
1. PBF | A4T4T3 | Ribonuclease P protein component | 3.21e-12 | 2.25e-24 | 0.014 | 0.8289 |
1. PBF | Q71VQ7 | Ribonuclease P protein component | 1.11e-16 | 1.08e-30 | 6.98e-14 | 0.8828 |
1. PBF | Q040F1 | Ribonuclease P protein component | 0.00e+00 | 2.93e-20 | 4.32e-08 | 0.8888 |
1. PBF | Q5X0M0 | Ribonuclease P protein component | 4.44e-15 | 3.10e-38 | 1.42e-04 | 0.8319 |
1. PBF | B5EGY0 | Ribonuclease P protein component | 1.22e-15 | 1.34e-43 | 3.21e-08 | 0.894 |
1. PBF | B1XJD2 | Ribonuclease P protein component | 9.34e-14 | 6.06e-34 | 0.007 | 0.864 |
1. PBF | B7IST7 | Ribonuclease P protein component | 0.00e+00 | 3.63e-43 | 1.30e-19 | 0.8983 |
1. PBF | A0PX73 | Ribonuclease P protein component | 0.00e+00 | 2.00e-48 | 1.75e-07 | 0.8879 |
1. PBF | B7H7A5 | Ribonuclease P protein component | 0.00e+00 | 2.14e-43 | 7.16e-20 | 0.8982 |
1. PBF | A8YTQ9 | Ribonuclease P protein component | 1.11e-16 | 7.76e-21 | 2.04e-07 | 0.8793 |
1. PBF | B7KHE3 | Ribonuclease P protein component | 1.89e-15 | 6.02e-27 | 6.56e-04 | 0.883 |
1. PBF | B2IML6 | Ribonuclease P protein component | 0.00e+00 | 6.32e-20 | 1.79e-15 | 0.917 |
1. PBF | Q0ATU2 | Ribonuclease P protein component | 0.00e+00 | 1.29e-30 | 1.19e-07 | 0.9069 |
1. PBF | B6EP41 | Ribonuclease P protein component | 7.77e-16 | 5.14e-34 | 1.95e-04 | 0.8478 |
1. PBF | B1I998 | Ribonuclease P protein component | 0.00e+00 | 8.12e-19 | 1.77e-15 | 0.9138 |
1. PBF | A5WI39 | Ribonuclease P protein component | 2.68e-13 | 4.43e-21 | 2.02e-04 | 0.8213 |
1. PBF | Q9A1J4 | Ribonuclease P protein component | 0.00e+00 | 1.33e-23 | 5.18e-17 | 0.9057 |
1. PBF | A7N1E4 | Ribonuclease P protein component | 1.11e-16 | 7.03e-35 | 2.32e-04 | 0.8563 |
1. PBF | A7X7A9 | Ribonuclease P protein component | 1.11e-16 | 5.30e-45 | 6.34e-13 | 0.8913 |
1. PBF | A5G9V6 | Ribonuclease P protein component | 0.00e+00 | 6.13e-40 | 3.44e-10 | 0.89 |
1. PBF | A0LLH1 | Ribonuclease P protein component | 1.55e-14 | 1.52e-35 | 2.42e-08 | 0.8951 |
1. PBF | Q4A5G4 | Ribonuclease P protein component | 0.00e+00 | 6.18e-35 | 9.54e-07 | 0.8859 |
1. PBF | Q9HT05 | Ribonuclease P protein component | 9.45e-13 | 8.49e-15 | 8.53e-04 | 0.819 |
1. PBF | Q6APZ0 | Ribonuclease P protein component | 2.43e-11 | 4.19e-27 | 0.004 | 0.8022 |
1. PBF | Q7NPT6 | Ribonuclease P protein component | 7.75e-14 | 1.21e-28 | 0.006 | 0.8573 |
1. PBF | Q97NI5 | Ribonuclease P protein component | 0.00e+00 | 3.84e-19 | 1.11e-14 | 0.9144 |
1. PBF | Q8G6J8 | Ribonuclease P protein component | 1.10e-13 | 1.03e-30 | 1.70e-04 | 0.85 |
1. PBF | Q3J6L7 | Ribonuclease P protein component | 4.33e-15 | 4.45e-34 | 4.78e-04 | 0.7938 |
1. PBF | A1U8R8 | Ribonuclease P protein component | 2.15e-13 | 1.22e-21 | 8.72e-04 | 0.8598 |
1. PBF | Q97CV8 | Ribonuclease P protein component | 1.11e-16 | 3.62e-33 | 4.59e-04 | 0.8867 |
1. PBF | C0QIZ3 | Ribonuclease P protein component | 3.77e-15 | 9.33e-41 | 2.08e-06 | 0.8244 |
1. PBF | P66691 | Ribonuclease P protein component | 0.00e+00 | 1.33e-23 | 5.18e-17 | 0.9055 |
1. PBF | Q81JH0 | Ribonuclease P protein component | 0.00e+00 | 6.72e-36 | 4.47e-20 | 0.8956 |
1. PBF | A1A3X8 | Ribonuclease P protein component | 2.36e-14 | 1.99e-30 | 4.78e-04 | 0.839 |
1. PBF | A6TXE9 | Ribonuclease P protein component | 0.00e+00 | 1.07e-43 | 4.80e-11 | 0.9099 |
1. PBF | Q1JIQ1 | Ribonuclease P protein component | 0.00e+00 | 1.33e-23 | 5.18e-17 | 0.9055 |
1. PBF | B7V7A6 | Ribonuclease P protein component | 3.00e-12 | 8.60e-15 | 0.001 | 0.8156 |
1. PBF | Q72WU0 | Ribonuclease P protein component | 0.00e+00 | 3.81e-45 | 4.07e-20 | 0.8988 |
1. PBF | Q8DN92 | Ribonuclease P protein component | 0.00e+00 | 6.32e-20 | 1.79e-15 | 0.9131 |
1. PBF | B2GA53 | Ribonuclease P protein component | 0.00e+00 | 1.18e-37 | 4.85e-13 | 0.902 |
1. PBF | Q04CX7 | Ribonuclease P protein component | 1.22e-15 | 1.12e-36 | 4.06e-04 | 0.867 |
1. PBF | B9DI94 | Ribonuclease P protein component | 0.00e+00 | 1.12e-45 | 4.03e-13 | 0.8767 |
1. PBF | Q8YDA2 | Ribonuclease P protein component | 3.43e-12 | 5.04e-16 | 1.93e-05 | 0.8221 |
1. PBF | Q48BF0 | Ribonuclease P protein component | 2.48e-13 | 1.58e-13 | 0.013 | 0.8356 |
1. PBF | A0KR34 | Ribonuclease P protein component | 0.00e+00 | 3.37e-33 | 9.92e-05 | 0.8698 |
1. PBF | A8YYS2 | Ribonuclease P protein component | 1.11e-16 | 5.52e-45 | 7.72e-13 | 0.8827 |
1. PBF | Q7M7H7 | Ribonuclease P protein component | 4.44e-16 | 1.79e-33 | 1.92e-05 | 0.8501 |
1. PBF | Q9X1H4 | Ribonuclease P protein component | 0.00e+00 | 2.05e-39 | 2.91e-08 | 0.8979 |
1. PBF | B1MWS3 | Ribonuclease P protein component | 1.11e-16 | 1.46e-42 | 1.07e-07 | 0.8831 |
1. PBF | A8EY59 | Ribonuclease P protein component | 1.68e-11 | 1.19e-38 | 1.90e-04 | 0.7994 |
1. PBF | A9KX22 | Ribonuclease P protein component | 0.00e+00 | 1.14e-32 | 1.08e-04 | 0.8752 |
1. PBF | Q8FV30 | Ribonuclease P protein component | 2.14e-12 | 4.42e-16 | 4.82e-05 | 0.7569 |
1. PBF | P21172 | Ribonuclease P protein component | 1.45e-13 | 3.78e-22 | 0.002 | 0.8607 |
1. PBF | B0K8I3 | Ribonuclease P protein component | 1.11e-16 | 3.48e-38 | 4.42e-12 | 0.9124 |
1. PBF | P47703 | Ribonuclease P protein component | 2.22e-16 | 1.17e-25 | 2.21e-05 | 0.8699 |
1. PBF | C5D9Z1 | Ribonuclease P protein component | 0.00e+00 | 2.64e-39 | 1.93e-15 | 0.895 |
1. PBF | A5IWD8 | Ribonuclease P protein component | 1.11e-16 | 5.52e-45 | 7.72e-13 | 0.8825 |
1. PBF | Q1CRI1 | Ribonuclease P protein component | 1.29e-11 | 3.11e-18 | 3.07e-04 | 0.8146 |
1. PBF | B7JIL4 | Ribonuclease P protein component | 0.00e+00 | 6.72e-36 | 4.47e-20 | 0.8989 |
1. PBF | B5E2W2 | Ribonuclease P protein component | 0.00e+00 | 6.32e-20 | 1.79e-15 | 0.9139 |
1. PBF | Q03N61 | Ribonuclease P protein component | 0.00e+00 | 4.72e-36 | 1.63e-12 | 0.9026 |
1. PBF | A7GVQ0 | Ribonuclease P protein component | 0.00e+00 | 3.88e-44 | 1.37e-20 | 0.9021 |
1. PBF | Q0HD62 | Ribonuclease P protein component | 0.00e+00 | 3.37e-33 | 9.92e-05 | 0.8725 |
1. PBF | P50069 | Ribonuclease P protein component | 8.31e-12 | 1.95e-29 | 0.048 | 0.8242 |
1. PBF | A5IIK5 | Ribonuclease P protein component | 4.33e-15 | 3.10e-38 | 1.42e-04 | 0.8313 |
1. PBF | Q032X2 | Ribonuclease P protein component | 0.00e+00 | 7.32e-38 | 2.45e-11 | 0.9162 |
1. PBF | C0M7E1 | Ribonuclease P protein component | 0.00e+00 | 5.15e-24 | 2.63e-16 | 0.9115 |
1. PBF | A9NE63 | Ribonuclease P protein component | 0.00e+00 | 1.08e-33 | 4.47e-12 | 0.9192 |
1. PBF | A3DAT0 | Ribonuclease P protein component | 0.00e+00 | 1.14e-32 | 1.08e-04 | 0.8761 |
1. PBF | A9WW33 | Ribonuclease P protein component | 3.26e-12 | 1.42e-15 | 4.62e-05 | 0.7789 |
1. PBF | B9DVV7 | Ribonuclease P protein component | 0.00e+00 | 5.15e-24 | 4.20e-15 | 0.903 |
1. PBF | P0A5X9 | Ribonuclease P protein component | 3.53e-14 | 6.75e-30 | 0.011 | 0.8559 |
1. PBF | Q9P9U0 | Ribonuclease P protein component | 1.62e-14 | 6.08e-13 | 0.018 | 0.8796 |
1. PBF | A5CVI0 | Ribonuclease P protein component | 1.69e-14 | 6.54e-39 | 0.027 | 0.8446 |
1. PBF | Q1G7Z2 | Ribonuclease P protein component | 2.22e-16 | 3.85e-23 | 1.38e-10 | 0.8743 |
1. PBF | P0DF25 | Ribonuclease P protein component | 0.00e+00 | 1.33e-23 | 5.18e-17 | 0.9053 |
1. PBF | B2GEU6 | Ribonuclease P protein component | 0.00e+00 | 7.63e-48 | 2.06e-13 | 0.897 |
1. PBF | C5C7X2 | Ribonuclease P protein component | 1.15e-13 | 3.78e-22 | 0.002 | 0.8659 |
1. PBF | B6JNU5 | Ribonuclease P protein component | 2.51e-11 | 1.50e-19 | 2.25e-04 | 0.8175 |
1. PBF | Q814F3 | Ribonuclease P protein component | 0.00e+00 | 3.35e-43 | 8.48e-20 | 0.8981 |
1. PBF | Q5LY00 | Ribonuclease P protein component | 0.00e+00 | 1.10e-43 | 3.67e-13 | 0.9143 |
1. PBF | A8ZRZ3 | Ribonuclease P protein component | 1.54e-14 | 1.62e-32 | 1.10e-11 | 0.8624 |
1. PBF | A5CY49 | Ribonuclease P protein component | 6.66e-16 | 2.58e-41 | 7.72e-04 | 0.864 |
1. PBF | A8GP91 | Ribonuclease P protein component | 1.87e-11 | 4.78e-37 | 0.011 | 0.7496 |
1. PBF | P0DF24 | Ribonuclease P protein component | 0.00e+00 | 1.33e-23 | 5.18e-17 | 0.9058 |
1. PBF | B8DYS1 | Ribonuclease P protein component | 1.14e-12 | 7.09e-42 | 0.002 | 0.8258 |
1. PBF | A9MJT8 | Ribonuclease P protein component | 8.88e-16 | 2.71e-33 | 0.003 | 0.84 |
1. PBF | Q5WAG0 | Ribonuclease P protein component | 1.11e-16 | 1.10e-20 | 1.49e-10 | 0.846 |
1. PBF | Q9RCA4 | Ribonuclease P protein component | 0.00e+00 | 3.45e-34 | 1.69e-15 | 0.8982 |
1. PBF | A2RCF8 | Ribonuclease P protein component | 0.00e+00 | 9.16e-24 | 4.55e-17 | 0.9062 |
1. PBF | Q7MQK4 | Ribonuclease P protein component | 1.11e-16 | 2.19e-34 | 6.72e-04 | 0.8532 |
1. PBF | B8EDW7 | Ribonuclease P protein component | 0.00e+00 | 1.14e-32 | 1.08e-04 | 0.8762 |
1. PBF | A9MCU8 | Ribonuclease P protein component | 2.65e-12 | 1.42e-15 | 4.62e-05 | 0.8181 |
1. PBF | A8FJG3 | Ribonuclease P protein component | 1.11e-16 | 3.89e-30 | 1.32e-16 | 0.8828 |
1. PBF | A1SQV9 | Ribonuclease P protein component | 6.70e-13 | 1.27e-32 | 0.002 | 0.8337 |
2. PF | C1B7S5 | Ribonuclease P protein component | 1.03e-13 | 4.87e-28 | NA | 0.8362 |
2. PF | Q9L7L9 | Ribonuclease P protein component | 8.81e-13 | 1.41e-34 | NA | 0.842 |
2. PF | A4TSL3 | Ribonuclease P protein component | 1.85e-11 | 3.71e-34 | NA | 0.7844 |
2. PF | A2S8D4 | Ribonuclease P protein component | 2.84e-10 | 9.53e-15 | NA | 0.6573 |
2. PF | Q1CCJ6 | Ribonuclease P protein component | 1.48e-11 | 3.71e-34 | NA | 0.7902 |
2. PF | Q494B8 | Ribonuclease P protein component | 1.78e-15 | 6.24e-36 | NA | 0.851 |
2. PF | A0K2M6 | Ribonuclease P protein component | 6.62e-14 | 1.54e-13 | NA | 0.8717 |
2. PF | Q7VN34 | Ribonuclease P protein component | 1.11e-15 | 3.74e-27 | NA | 0.8475 |
2. PF | A6WYM5 | Ribonuclease P protein component | 3.89e-12 | 1.18e-14 | NA | 0.7852 |
2. PF | B0RMM7 | Ribonuclease P protein component | 8.39e-14 | 7.26e-09 | NA | 0.8606 |
2. PF | A1KS00 | Ribonuclease P protein component | 2.21e-14 | 1.41e-29 | NA | 0.7513 |
2. PF | B0BAN9 | Ribonuclease P protein component | 5.29e-13 | 1.94e-32 | NA | 0.828 |
2. PF | Q5FPY1 | Ribonuclease P protein component | 2.22e-13 | 2.31e-08 | NA | 0.8687 |
2. PF | Q31MS4 | Ribonuclease P protein component | 1.18e-12 | 4.78e-27 | NA | 0.8498 |
2. PF | A4XDK4 | Ribonuclease P protein component | 5.53e-12 | 5.76e-22 | NA | 0.8435 |
2. PF | A5CVC5 | Ribonuclease P protein component | 3.33e-15 | 6.29e-39 | NA | 0.8979 |
2. PF | B4SYB0 | Ribonuclease P protein component | 7.77e-16 | 1.62e-32 | NA | 0.8403 |
2. PF | B1VJ37 | Ribonuclease P protein component | 1.14e-12 | 1.70e-28 | NA | 0.8489 |
2. PF | Q11LE6 | Ribonuclease P protein component | 9.47e-14 | 3.55e-33 | NA | 0.808 |
2. PF | Q46JN4 | Ribonuclease P protein component | 9.93e-13 | 3.21e-25 | NA | 0.8661 |
2. PF | Q1LTW1 | Ribonuclease P protein component | 1.11e-16 | 2.03e-34 | NA | 0.8696 |
2. PF | A8GVL0 | Ribonuclease P protein component | 1.90e-11 | 4.04e-37 | NA | 0.7901 |
2. PF | Q7VQV1 | Ribonuclease P protein component | 1.90e-14 | 2.97e-33 | NA | 0.8345 |
2. PF | A8A6G5 | Ribonuclease P protein component | 1.02e-14 | 2.53e-32 | NA | 0.8305 |
2. PF | Q65VC0 | Ribonuclease P protein component | 3.00e-15 | 1.53e-27 | NA | 0.8351 |
2. PF | B4TAV1 | Ribonuclease P protein component | 6.66e-16 | 1.62e-32 | NA | 0.8403 |
2. PF | Q0SN68 | Ribonuclease P protein component | 2.09e-12 | 4.33e-33 | NA | 0.7861 |
2. PF | A4QIE5 | Ribonuclease P protein component | 6.46e-13 | 1.97e-27 | NA | 0.8262 |
2. PF | A2BSA0 | Ribonuclease P protein component | 2.27e-12 | 1.22e-31 | NA | 0.7357 |
2. PF | Q1R4N2 | Ribonuclease P protein component | 1.91e-13 | 2.53e-32 | NA | 0.8054 |
2. PF | A5UID3 | Ribonuclease P protein component | 2.22e-16 | 3.96e-33 | NA | 0.8582 |
2. PF | C4K7P7 | Ribonuclease P protein component | 2.22e-16 | 1.61e-33 | NA | 0.8524 |
2. PF | Q8PEH6 | Ribonuclease P protein component | 8.49e-14 | 7.29e-10 | NA | 0.8602 |
2. PF | Q5N605 | Ribonuclease P protein component | 9.77e-13 | 4.78e-27 | NA | 0.8389 |
2. PF | A4STS7 | Ribonuclease P protein component | 2.10e-11 | 3.99e-34 | NA | 0.7441 |
2. PF | P66687 | Ribonuclease P protein component | 7.77e-16 | 1.62e-32 | NA | 0.8383 |
2. PF | Q15MS5 | Ribonuclease P protein component | 6.55e-15 | 1.44e-34 | NA | 0.8373 |
2. PF | A2BXQ2 | Ribonuclease P protein component | 3.26e-10 | 1.36e-28 | NA | 0.742 |
2. PF | A8ACL6 | Ribonuclease P protein component | 7.77e-16 | 1.60e-32 | NA | 0.8393 |
2. PF | B7N2E9 | Ribonuclease P protein component | 1.27e-14 | 2.53e-32 | NA | 0.8298 |
2. PF | P22835 | Ribonuclease P protein component | 2.22e-16 | 1.12e-32 | NA | 0.8491 |
2. PF | Q5PKU4 | Ribonuclease P protein component | 9.99e-16 | 1.62e-32 | NA | 0.8381 |
2. PF | B4RJJ5 | Ribonuclease P protein component | 6.50e-13 | 9.58e-29 | NA | 0.8035 |
2. PF | Q821V0 | Ribonuclease P protein component | 4.03e-12 | 2.63e-07 | NA | 0.8352 |
2. PF | B8G7S5 | Ribonuclease P protein component | 3.00e-15 | 9.97e-07 | NA | 0.8779 |
2. PF | A1BJZ9 | Ribonuclease P protein component | 1.28e-10 | 2.14e-19 | NA | 0.7693 |
2. PF | C5BF62 | Ribonuclease P protein component | 4.44e-16 | 2.01e-32 | NA | 0.8454 |
2. PF | B9LGI0 | Ribonuclease P protein component | 2.22e-15 | 2.17e-04 | NA | 0.8768 |
2. PF | A1WWE2 | Ribonuclease P protein component | 3.55e-15 | 8.43e-30 | NA | 0.8452 |
2. PF | A2C7A3 | Ribonuclease P protein component | 8.08e-13 | 3.12e-26 | NA | 0.8208 |
2. PF | B7UMH1 | Ribonuclease P protein component | 9.44e-15 | 2.53e-32 | NA | 0.8326 |
2. PF | P57915 | Ribonuclease P protein component | 4.44e-16 | 5.24e-35 | NA | 0.852 |
2. PF | A6WGN2 | Ribonuclease P protein component | 1.44e-12 | 2.54e-20 | NA | 0.8534 |
2. PF | Q4JSC2 | Ribonuclease P protein component | 2.25e-12 | 2.72e-28 | NA | 0.8583 |
2. PF | B0URU5 | Ribonuclease P protein component | 2.22e-15 | 1.86e-33 | NA | 0.8364 |
2. PF | Q8P337 | Ribonuclease P protein component | 8.50e-14 | 7.26e-09 | NA | 0.8598 |
2. PF | B7M556 | Ribonuclease P protein component | 1.99e-13 | 2.53e-32 | NA | 0.8192 |
2. PF | B5BIL6 | Ribonuclease P protein component | 7.77e-16 | 8.10e-33 | NA | 0.8465 |
2. PF | Q9PLD7 | Ribonuclease P protein component | 1.25e-12 | 8.14e-32 | NA | 0.8345 |
2. PF | Q3KKQ8 | Ribonuclease P protein component | 7.29e-13 | 3.49e-31 | NA | 0.8319 |
2. PF | Q8FSU8 | Ribonuclease P protein component | 1.21e-12 | 4.53e-26 | NA | 0.8136 |
2. PF | A5GRN3 | Ribonuclease P protein component | 1.17e-10 | 4.47e-30 | NA | 0.8038 |
2. PF | B5YXA8 | Ribonuclease P protein component | 1.11e-15 | 7.20e-32 | NA | 0.8375 |
2. PF | A9WBG7 | Ribonuclease P protein component | 9.10e-15 | 2.17e-04 | NA | 0.8628 |
2. PF | Q7X5L4 | Ribonuclease P protein component | 1.76e-12 | 7.31e-03 | NA | 0.7822 |
2. PF | Q62EM2 | Ribonuclease P protein component | 2.68e-10 | 9.53e-15 | NA | 0.6571 |
2. PF | B2VCE5 | Ribonuclease P protein component | 1.33e-15 | 2.15e-33 | NA | 0.8347 |
2. PF | Q1RI66 | Ribonuclease P protein component | 1.78e-11 | 4.04e-37 | NA | 0.7903 |
2. PF | P29433 | Ribonuclease P protein component | 1.11e-16 | 1.64e-33 | NA | 0.8661 |
2. PF | Q7U524 | Ribonuclease P protein component | 1.61e-12 | 1.10e-26 | NA | 0.801 |
2. PF | A9IJC1 | Ribonuclease P protein component | 3.49e-10 | 2.37e-28 | NA | 0.6968 |
2. PF | A1V7D7 | Ribonuclease P protein component | 2.68e-10 | 9.53e-15 | NA | 0.6609 |
2. PF | Q92H35 | Ribonuclease P protein component | 1.53e-11 | 2.42e-37 | NA | 0.8134 |
2. PF | A8GT00 | Ribonuclease P protein component | 2.45e-11 | 5.94e-38 | NA | 0.8045 |
2. PF | Q255T8 | Ribonuclease P protein component | 1.84e-12 | 3.33e-08 | NA | 0.8448 |
2. PF | A1U7J6 | Ribonuclease P protein component | 4.80e-14 | 1.54e-17 | NA | 0.8143 |
2. PF | B7NF21 | Ribonuclease P protein component | 1.29e-14 | 2.53e-32 | NA | 0.8292 |
2. PF | Q3K426 | Ribonuclease P protein component | 2.24e-13 | 1.12e-11 | NA | 0.8324 |
2. PF | B1MN96 | Ribonuclease P protein component | 1.09e-11 | 1.92e-24 | NA | 0.8229 |
2. PF | Q1IY22 | Ribonuclease P protein component | 3.94e-12 | 1.14e-03 | NA | 0.794 |
2. PF | A1VZV1 | Ribonuclease P protein component | 1.02e-13 | 2.00e-36 | NA | 0.7806 |
2. PF | Q9JW46 | Ribonuclease P protein component | 1.71e-14 | 3.53e-29 | NA | 0.8127 |
2. PF | B0BUJ2 | Ribonuclease P protein component | 1.04e-11 | 5.94e-38 | NA | 0.8034 |
2. PF | A7FPB9 | Ribonuclease P protein component | 5.66e-15 | 3.71e-34 | NA | 0.8324 |
2. PF | B1X9T2 | Ribonuclease P protein component | 9.10e-15 | 2.53e-32 | NA | 0.8327 |
2. PF | Q8XB43 | Ribonuclease P protein component | 5.55e-16 | 7.20e-32 | NA | 0.8472 |
2. PF | Q6LW54 | Ribonuclease P protein component | 2.22e-16 | 1.22e-32 | NA | 0.8568 |
2. PF | Q47K73 | Ribonuclease P protein component | 7.93e-12 | 1.69e-08 | NA | 0.8186 |
2. PF | Q3M7J6 | Ribonuclease P protein component | 2.21e-13 | 1.11e-22 | NA | 0.8571 |
2. PF | A8FM14 | Ribonuclease P protein component | 9.78e-14 | 2.45e-36 | NA | 0.7791 |
2. PF | Q21DF8 | Ribonuclease P protein component | 2.02e-13 | 4.11e-18 | NA | 0.8127 |
2. PF | C3LP79 | Ribonuclease P protein component | 3.33e-16 | 2.57e-33 | NA | 0.8521 |
2. PF | A9HKS8 | Ribonuclease P protein component | 2.22e-16 | 3.34e-37 | NA | 0.8936 |
2. PF | A1JT84 | Ribonuclease P protein component | 3.40e-12 | 2.03e-34 | NA | 0.7935 |
2. PF | Q3AV41 | Ribonuclease P protein component | 1.34e-12 | 2.69e-27 | NA | 0.8003 |
2. PF | A0LWX2 | Ribonuclease P protein component | 4.51e-14 | 1.29e-25 | NA | 0.8691 |
2. PF | Q3YWB0 | Ribonuclease P protein component | 2.27e-13 | 2.53e-32 | NA | 0.8058 |
2. PF | B8H8Z3 | Ribonuclease P protein component | 1.63e-13 | 1.77e-10 | NA | 0.8574 |
2. PF | Q5L548 | Ribonuclease P protein component | 1.97e-12 | 2.32e-09 | NA | 0.8525 |
2. PF | O84789 | Ribonuclease P protein component | 6.09e-13 | 1.31e-32 | NA | 0.8339 |
2. PF | Q7X5L6 | Ribonuclease P protein component | 4.56e-12 | 1.64e-02 | NA | 0.7723 |
2. PF | Q6F6K8 | Ribonuclease P protein component | 1.01e-12 | 3.15e-22 | NA | 0.8094 |
2. PF | Q663S9 | Ribonuclease P protein component | 4.33e-15 | 3.71e-34 | NA | 0.8337 |
2. PF | B4F0U3 | Ribonuclease P protein component | 2.22e-16 | 1.12e-32 | NA | 0.8493 |
2. PF | Q2NQ69 | Ribonuclease P protein component | 5.55e-16 | 1.38e-29 | NA | 0.8435 |
2. PF | B5XZP6 | Ribonuclease P protein component | 5.55e-16 | 9.88e-34 | NA | 0.8476 |
2. PF | A8G7Q0 | Ribonuclease P protein component | 8.94e-13 | 2.82e-34 | NA | 0.8025 |
2. PF | Q4QLR2 | Ribonuclease P protein component | 1.11e-16 | 3.96e-33 | NA | 0.8579 |
2. PF | Q87TR4 | Ribonuclease P protein component | 1.11e-16 | 1.29e-34 | NA | 0.8619 |
2. PF | B2RHI3 | Ribonuclease P protein component | 3.74e-12 | 1.70e-19 | NA | 0.8169 |
2. PF | Q7VSD8 | Ribonuclease P protein component | 1.43e-10 | 6.66e-25 | NA | 0.6864 |
2. PF | B7L844 | Ribonuclease P protein component | 6.67e-13 | 2.53e-32 | NA | 0.8042 |
2. PF | Q3ZY16 | Ribonuclease P protein component | 1.11e-16 | 2.46e-17 | NA | 0.8251 |
2. PF | A8LXK4 | Ribonuclease P protein component | 1.10e-11 | 8.35e-21 | NA | 0.8273 |
2. PF | P45648 | Ribonuclease P protein component | 4.44e-16 | 1.56e-31 | NA | 0.8429 |
2. PF | Q8YRN1 | Ribonuclease P protein component | 3.47e-13 | 1.80e-22 | NA | 0.8413 |
2. PF | B2S0E4 | Ribonuclease P protein component | 1.47e-12 | 4.70e-34 | NA | 0.8425 |
2. PF | Q4UML0 | Ribonuclease P protein component | 1.30e-11 | 7.05e-38 | NA | 0.7903 |
2. PF | A6W3V2 | Ribonuclease P protein component | 4.74e-14 | 5.16e-20 | NA | 0.8416 |
2. PF | A7H368 | Ribonuclease P protein component | 6.74e-14 | 2.45e-36 | NA | 0.8124 |
2. PF | A9BBJ0 | Ribonuclease P protein component | 8.94e-13 | 2.18e-28 | NA | 0.8695 |
2. PF | A7ZTR0 | Ribonuclease P protein component | 6.66e-15 | 2.53e-32 | NA | 0.8365 |
2. PF | Q9Z6X2 | Ribonuclease P protein component | 1.56e-11 | 3.19e-08 | NA | 0.8571 |
2. PF | C4K1K8 | Ribonuclease P protein component | 2.14e-11 | 7.93e-39 | NA | 0.8366 |
2. PF | Q0I0Y9 | Ribonuclease P protein component | 2.78e-15 | 1.86e-33 | NA | 0.8362 |
2. PF | Q6CYR1 | Ribonuclease P protein component | 9.99e-16 | 7.70e-35 | NA | 0.8379 |
2. PF | A3PE33 | Ribonuclease P protein component | 1.13e-12 | 4.16e-32 | NA | 0.7427 |
2. PF | B7LK46 | Ribonuclease P protein component | 1.37e-14 | 2.53e-32 | NA | 0.8289 |
2. PF | Q9KVY2 | Ribonuclease P protein component | 2.22e-16 | 2.57e-33 | NA | 0.8463 |
2. PF | A8G5Y2 | Ribonuclease P protein component | 5.17e-12 | 6.77e-33 | NA | 0.7295 |
2. PF | B0VQP7 | Ribonuclease P protein component | 2.89e-13 | 1.74e-21 | NA | 0.8264 |
2. PF | A1TI29 | Ribonuclease P protein component | 4.92e-13 | 1.05e-26 | NA | 0.8399 |
2. PF | B7MGC5 | Ribonuclease P protein component | 1.81e-14 | 2.53e-32 | NA | 0.8265 |
2. PF | B6I3T7 | Ribonuclease P protein component | 1.24e-14 | 2.53e-32 | NA | 0.8299 |
2. PF | Q9PNX5 | Ribonuclease P protein component | 6.99e-14 | 2.45e-36 | NA | 0.7857 |
2. PF | B5QUQ2 | Ribonuclease P protein component | 5.55e-16 | 1.62e-32 | NA | 0.8479 |
2. PF | Q7MXI4 | Ribonuclease P protein component | 3.29e-12 | 8.23e-19 | NA | 0.8178 |
2. PF | Q31UV7 | Ribonuclease P protein component | 1.38e-13 | 2.53e-32 | NA | 0.8098 |
2. PF | A9KBT3 | Ribonuclease P protein component | 6.66e-16 | 2.69e-31 | NA | 0.8389 |
2. PF | A0QND4 | Ribonuclease P protein component | 3.68e-13 | 4.44e-35 | NA | 0.8344 |
2. PF | Q3Z7P1 | Ribonuclease P protein component | 1.11e-16 | 1.39e-16 | NA | 0.8209 |
2. PF | B7NR06 | Ribonuclease P protein component | 4.35e-13 | 2.53e-32 | NA | 0.807 |
2. PF | Q68WC8 | Ribonuclease P protein component | 1.34e-11 | 3.49e-35 | NA | 0.7765 |
2. PF | A9NBA3 | Ribonuclease P protein component | 1.11e-16 | 1.56e-31 | NA | 0.8561 |
2. PF | Q2KTI7 | Ribonuclease P protein component | 9.00e-11 | 3.73e-26 | NA | 0.732 |
2. PF | P25817 | Ribonuclease P protein component | 1.18e-12 | 3.98e-29 | NA | 0.8261 |
2. PF | Q7V612 | Ribonuclease P protein component | 6.74e-13 | 4.71e-27 | NA | 0.8159 |
2. PF | B5RLZ8 | Ribonuclease P protein component | 1.43e-12 | 2.12e-32 | NA | 0.8427 |
2. PF | A3NPW9 | Ribonuclease P protein component | 2.72e-10 | 7.09e-15 | NA | 0.6548 |
2. PF | Q98D89 | Ribonuclease P protein component | 7.89e-14 | 3.39e-42 | NA | 0.8451 |
2. PF | B8GRD3 | Ribonuclease P protein component | 6.35e-12 | 8.86e-34 | NA | 0.7696 |
2. PF | Q9ZCU8 | Ribonuclease P protein component | 1.90e-11 | 1.70e-35 | NA | 0.8115 |
2. PF | C3PP52 | Ribonuclease P protein component | 1.67e-11 | 2.42e-37 | NA | 0.8129 |
2. PF | A5F483 | Ribonuclease P protein component | 3.33e-16 | 2.57e-33 | NA | 0.8516 |
2. PF | B1AJP4 | Ribonuclease P protein component | 7.57e-14 | 1.01e-34 | NA | 0.8858 |
2. PF | Q5F4W3 | Ribonuclease P protein component | 2.08e-14 | 9.58e-29 | NA | 0.8075 |
2. PF | Q2VZ17 | Ribonuclease P protein component | 3.12e-13 | 2.27e-12 | NA | 0.8249 |
2. PF | A0KQZ9 | Ribonuclease P protein component | 6.11e-15 | 1.55e-33 | NA | 0.8232 |
2. PF | B2GJF5 | Ribonuclease P protein component | 6.99e-14 | 1.84e-32 | NA | 0.821 |
2. PF | Q2JQX0 | Ribonuclease P protein component | 1.81e-14 | 1.57e-22 | NA | 0.863 |
2. PF | P66686 | Ribonuclease P protein component | 6.66e-16 | 1.62e-32 | NA | 0.8413 |
2. PF | Q7W2K3 | Ribonuclease P protein component | 1.45e-10 | 6.66e-25 | NA | 0.6578 |
2. PF | Q2JHS3 | Ribonuclease P protein component | 6.13e-14 | 1.25e-11 | NA | 0.8562 |
2. PF | Q2NX51 | Ribonuclease P protein component | 1.04e-13 | 2.14e-10 | NA | 0.8559 |
2. PF | A0PX70 | Ribonuclease P protein component | 5.18e-13 | 6.10e-23 | NA | 0.8484 |
2. PF | Q5YMR7 | Ribonuclease P protein component | 1.78e-11 | 3.70e-17 | NA | 0.858 |
2. PF | P0A7Y9 | Ribonuclease P protein component | 1.14e-14 | 2.53e-32 | NA | 0.8308 |
2. PF | B5RFY5 | Ribonuclease P protein component | 8.88e-16 | 1.62e-32 | NA | 0.8459 |
2. PF | Q8NL51 | Ribonuclease P protein component | 1.18e-12 | 1.95e-26 | NA | 0.8107 |
2. PF | P57130 | Ribonuclease P protein component | 7.77e-16 | 1.98e-29 | NA | 0.8528 |
2. PF | B5EYX4 | Ribonuclease P protein component | 7.77e-16 | 1.62e-32 | NA | 0.8395 |
2. PF | P44306 | Ribonuclease P protein component | 1.11e-16 | 3.62e-33 | NA | 0.861 |
2. PF | B2J0Q5 | Ribonuclease P protein component | 4.85e-13 | 9.30e-22 | NA | 0.871 |
2. PF | Q7X5L0 | Ribonuclease P protein component | 6.24e-12 | 2.67e-03 | NA | 0.7687 |
2. PF | Q1C0B6 | Ribonuclease P protein component | 5.46e-12 | 3.71e-34 | NA | 0.7903 |
2. PF | Q9PPN6 | Ribonuclease P protein component | 7.03e-14 | 1.01e-34 | NA | 0.8874 |
2. PF | Q5HUJ9 | Ribonuclease P protein component | 6.83e-14 | 1.06e-36 | NA | 0.7876 |
2. PF | P59413 | Ribonuclease P protein component | 2.22e-16 | 1.06e-32 | NA | 0.8601 |
2. PF | A1QZM7 | Ribonuclease P protein component | 5.03e-13 | 1.08e-33 | NA | 0.8484 |
2. PF | Q661I0 | Ribonuclease P protein component | 4.58e-12 | 1.17e-34 | NA | 0.8119 |
2. PF | B5RRP4 | Ribonuclease P protein component | 4.04e-13 | 2.12e-32 | NA | 0.8453 |
2. PF | A2C405 | Ribonuclease P protein component | 1.36e-12 | 1.86e-25 | NA | 0.8435 |
2. PF | A7MN01 | Ribonuclease P protein component | 1.11e-15 | 1.37e-33 | NA | 0.837 |
2. PF | Q7TVA1 | Ribonuclease P protein component | 6.95e-12 | 2.74e-29 | NA | 0.8242 |
2. PF | A3MS22 | Ribonuclease P protein component | 2.90e-10 | 9.53e-15 | NA | 0.6525 |
2. PF | C3PL13 | Ribonuclease P protein component | 1.71e-13 | 6.95e-32 | NA | 0.8501 |
2. PF | Q8FBV5 | Ribonuclease P protein component | 2.90e-14 | 1.08e-31 | NA | 0.8271 |
2. PF | Q0SAG9 | Ribonuclease P protein component | 9.29e-14 | 1.59e-27 | NA | 0.8403 |
2. PF | Q7WDJ7 | Ribonuclease P protein component | 1.40e-10 | 6.66e-25 | NA | 0.6775 |
2. PF | A5GN10 | Ribonuclease P protein component | 1.96e-11 | 7.45e-25 | NA | 0.8022 |
2. PF | A3N475 | Ribonuclease P protein component | 3.59e-10 | 9.53e-15 | NA | 0.6591 |
2. PF | B4TN09 | Ribonuclease P protein component | 6.66e-16 | 1.62e-32 | NA | 0.8394 |
2. PF | B1VPE8 | Ribonuclease P protein component | 2.24e-12 | 6.36e-26 | NA | 0.8296 |
2. PF | A1AHN8 | Ribonuclease P protein component | 7.57e-13 | 2.53e-32 | NA | 0.802 |
2. PF | B0B910 | Ribonuclease P protein component | 4.72e-13 | 1.94e-32 | NA | 0.8533 |
2. PF | Q329B4 | Ribonuclease P protein component | 1.03e-14 | 2.53e-32 | NA | 0.8307 |
2. PF | Q4UNK7 | Ribonuclease P protein component | 7.18e-14 | 7.26e-09 | NA | 0.8626 |
2. PF | B1LL31 | Ribonuclease P protein component | 1.41e-14 | 2.53e-32 | NA | 0.8271 |
2. PF | Q3BLZ6 | Ribonuclease P protein component | 6.06e-14 | 8.89e-10 | NA | 0.8673 |
2. PF | Q82X99 | Ribonuclease P protein component | 6.69e-14 | 5.72e-32 | NA | 0.8312 |
2. PF | A7NJ53 | Ribonuclease P protein component | 6.66e-16 | 5.98e-18 | NA | 0.8823 |
2. PF | Q319V1 | Ribonuclease P protein component | 1.82e-11 | 1.92e-30 | NA | 0.7249 |
2. PF | Q0VKU6 | Ribonuclease P protein component | 2.25e-11 | 2.82e-34 | NA | 0.78 |
2. PF | Q0AE58 | Ribonuclease P protein component | 4.17e-13 | 1.51e-28 | NA | 0.8311 |
2. PF | A5V0B3 | Ribonuclease P protein component | 4.44e-16 | 3.09e-16 | NA | 0.8231 |
2. PF | B2TUS4 | Ribonuclease P protein component | 1.08e-14 | 2.53e-32 | NA | 0.8312 |
2. PF | B5ZCB8 | Ribonuclease P protein component | 2.45e-13 | 1.15e-21 | NA | 0.8552 |
2. PF | B5FN12 | Ribonuclease P protein component | 7.77e-16 | 1.62e-32 | NA | 0.8391 |
2. PF | Q602M8 | Ribonuclease P protein component | 4.60e-13 | 9.99e-27 | NA | 0.8388 |
2. PF | A1T0M7 | Ribonuclease P protein component | 2.66e-15 | 1.32e-33 | NA | 0.7961 |
2. PF | Q55005 | Ribonuclease P protein component | 0.00e+00 | 1.55e-22 | NA | 0.9021 |
2. PF | Q63YW3 | Ribonuclease P protein component | 2.60e-10 | 7.09e-15 | NA | 0.6701 |
2. PF | B2HNT8 | Ribonuclease P protein component | 6.19e-13 | 6.10e-23 | NA | 0.8476 |
2. PF | A8L8W2 | Ribonuclease P protein component | 2.60e-14 | 2.67e-22 | NA | 0.8654 |
2. PF | B5Y9B9 | Ribonuclease P protein component | 2.51e-13 | 8.32e-18 | NA | 0.8028 |
2. PF | B0V5R2 | Ribonuclease P protein component | 3.24e-13 | 4.70e-21 | NA | 0.8278 |
2. PF | Q8Z9U4 | Ribonuclease P protein component | 8.33e-15 | 3.71e-34 | NA | 0.8314 |
2. PF | Q6NE96 | Ribonuclease P protein component | 9.46e-13 | 5.24e-32 | NA | 0.8478 |
2. PF | Q13SH2 | Ribonuclease P protein component | 4.39e-10 | 7.18e-12 | NA | 0.7083 |
2. PF | C4ZYY1 | Ribonuclease P protein component | 7.30e-13 | 2.53e-32 | NA | 0.8031 |
2. PF | Q9JXS6 | Ribonuclease P protein component | 1.31e-12 | 4.47e-30 | NA | 0.7653 |
4. PB | Q2FUQ1 | Ribonuclease P protein component | 1.11e-16 | 5.52e-45 | 7.72e-13 | NA |
4. PB | P9WGZ3 | Ribonuclease P protein component | 4.02e-14 | 6.75e-30 | 0.011 | NA |
5. P | A3CQ17 | Ribosome-binding factor A | 2.14e-02 | 3.78e-02 | NA | NA |
5. P | B5ZBD0 | Ribosome-binding factor A | 1.22e-01 | 2.11e-02 | NA | NA |
5. P | Q8EWT9 | Ribosome-binding factor A | 9.22e-02 | 2.39e-02 | NA | NA |
5. P | Q98PP7 | Ribosome-binding factor A | 3.58e-02 | 3.21e-02 | NA | NA |
5. P | Q49X58 | Ribosome-binding factor A | 3.75e-02 | 2.37e-02 | NA | NA |
5. P | P0A7Y8 | Ribonuclease P protein component | 1.14e-14 | 2.53e-32 | NA | NA |
5. P | Q8KGG4 | Ribonuclease P protein component | 8.06e-11 | 7.58e-17 | NA | NA |
5. P | A5IZH0 | Ribosome-binding factor A | 5.69e-02 | 4.84e-02 | NA | NA |
6. F | Q7X5K6 | Ribonuclease P protein component | 6.04e-12 | NA | NA | 0.7566 |
6. F | Q7X5L2 | Ribonuclease P protein component | 1.87e-10 | NA | NA | 0.7912 |
6. F | Q72LI2 | Ribonuclease P protein component | 5.28e-12 | NA | NA | 0.7564 |
6. F | Q7X5K8 | Ribonuclease P protein component | 3.40e-12 | NA | NA | 0.8037 |
6. F | Q9RSH3 | Ribonuclease P protein component | 1.01e-10 | NA | NA | 0.7849 |